1VQNV

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqnV00
3G6EV 1YJWV 3OW2U 1VQ4V 2OTLV 1M1KW 3CC4V 2QEXV 1YHQV 1VQ7V 3G4SV 3I56V 4WCEV 3CMEV 4WFAV 1QVGU 3CCEV 1VQPV 1KC8W 1Q82W 1S72V 4WFBV 1YJ9V 1YJNV 2D3OW 1W2BU 1KD1W 1VQKV 5DM6V 1K8AW 3CCSV 1N8RW 3CCVV 3CC7V 1NJIW 3CCMV 3CCUV 1VQOV 4WF9V 1K73W 1VQ9V 3CCLV 1M90W 1QVFU 1Q7YW 1YIJV 1VQ6V 1VQ5V 3G71V 3CMAV 1Q86W 1VQMV 1K9MW 3CC2V 3CXCU 3CCQV 3CCJV 2QA4V 3I55V 3CCRV 1VQLV 1YI2V 1VQNV 3CD6V 2OTJV 1R73A 1VQ8V 1Q81W 1YITV 1JJ2U 3CPWU 1KQSU
chains in the Genus database with same CATH superfamily
3SYCA 5GONA 2Y69B 4KP4A 1EFRG 5IE9A 3M99B 3RT3C 4AILC 4O2BB 2Q6AA 4YHHO 3E2EA 4F6RA 1F4NA 4WBNB 1YTFB 1R6NA 1EN6A 4RO2A 5LMUO 4J42A 2UXBB 5B5EZ 4IYIA 3CC2V 5E79Z 4RAIA 4Z1VA 5JJEB 3I55V 1NBMG 2YSUB 2IU0A 4JI5B 5GTIZ 3ZEDA 2M6YA 4HBNA 4WFFA 3D36C 1JFFB 2PI5A 1FXKB 3OUFA 2YIAA 2LW1A 1P4RA 1N34O 3CCLV 1Q7YW 4EFEA 1AROP 3K79A 5LXTA 3T1YB 4UCRA 1JFFA 1YI2V 4J9YB 4GKKO 4DV2O 1E1RG 2JRIA 3J80N 4EFBA 3RYCB 1HWYA 5H2FZ 4EB6A 3K5OA 2D3OW 1VQKV 5BZBA 3CE2A 3SPGA 5J2UA 4RUFA 4CH4A 5KHKA 3CJHB 2KG7A 1F7YA 1JA8A 1OCZB 4MVSA 2Y4UA 3DXRB 2WLMA 5L3DA 3P30A 1M57C 1FFTB 2KG7B 4PA9A 5IJ9A 3JSNA 3T4ZA 1UJWB 1F51A 2P22C 4BR6A 1VQNV 2DJVA 4JYBA 5CA0A 4DR3O 1SERA 1P7GA 5E1AC 1H2GA 2VRZA 2XNDG 3FD9A 3CCVV 2E75B 1M5IA 3VQWA 2Z0AA 1QLEC 3BY6A 2DWEC 4P2ZA 2CTQA 2YICA 4DV1O 2EZOA 1I5XA 3FYEB 2JDIG 4LF6O 4G27B 4UFZA 4TV8B 4BIZA 1NQTA 2GTSA 2L6LA 2JEUA 5GTHZ 3M7MX 3P3NA 3VBBA 4TWKA 3T1HB 1GN4A 3EFFK 1D5NA 4TV8A 4YXWG 3U10A 2Q7EA 5KHJA 1PP9H 5LMUB 1V9PA 3SYPA 1W59A 3JALB 3ML0A 4UB8Z 1AJPA 2W6IG 3ZHUA 4DV0B 4LF4O 5B1BC 4I55A 1MSWD 5H6QA 3BHPA 2P7TC 4JI5O 5DEDA 4FLYA 5J2TB 4UCTA 3CC7V 2N74A 4GKJB 3WFVA 3EHBB 3B09A 3K5LA 5B3SC 1YIJV 1FXKC 1YSCA 1Y4MA 4X65O 3CHXA 2WWWA 5LYJA 4DXWA 4B3MO 1GN6A 4PHZA 2EBOA 4X1KA 3FB8C 5IWAB 4GKKB 2Q5ZA 3KKYA 5BR8B 1Q6IA 1RM1C 4DV5B 1GM8A 4DR3B 2V4DA 1VMGA 1PD3A 4U7OA 4LF5O 3D3IA 2UXDB 1NKDA 4PDMA 5EYPA 2QM7A 1YEWA 2P6JA 1B3QA 3OW2U 1FFXB 2WA3A 3HKBA 3UT5B 3HKCA 1VQPV 5JVDA 1E79G 4MTXA 4WFEA 2GSMB 4DW1A 4PDVA 1R3IC 1MG1A 3ZHRA 1S3JA 2CH7B 4O4HA 2UXCO 1NT2B 3ABMB 3J7AU 1M57B 2ZDIA 1PL0A 2JS5A 3OT7A 3JD3A 3N2KB 2D2CB 4PD4F 5JCOA 2ZKOA 2DQ3A 5KX5B 5FL7G 4J9ZB 2V7QG 2YXHA 3F7VC 3FB7C 4DR1B 1Z5WA 1L8DA 1DTOA 2H3OA 1COWG 3RVZA 2CTWA 3APOA 2HHHB 3ZCCA 2XAGA 2Q0AA 2R9RB 2WLIB 4DV7B 1M56C 4NXNB 3ZRWA 2PY5A 1SKVA 5L3BA 3H01A 1S72V 2F93B 3WG7C 2L35A 4B7KA 5AG2A 1N8RW 5TISZ 4Z2WA 4JI6B 4X66O 1VF5B 4B3MB 4HNAB 1PKXA 1X59A 4NKGB 3E8HA 3QO8A 1N34B 2A0LA 5DECA 3FX7A 1NS1A 1EN4A 1AJQA 2F4VO 3JAKB 3K06A 4DV6O 2EX3A 1VQOV 1VP7A 2HVJC 2YS8A 1GM9A 4FLTA 3JASA 1AR1B 1AR4A 2B1GA 3CCJV 3AG1B 1Y6XA 2LGWA 4GKJO 4UXNA 3CJHA 1SC5B 4ICGA 2YXLA 5JQGB 2E74B 1KMIZ 2DN9A 2UXDO 3I56V 3H1JH 3K5NA 1SZXA 3SR2C 3AG1C 2E76B 1V55C 4LP8A 2LFSA 4JI4O 1S76D 2DWDC 1H38A 4DR1O 2E5LO 4DR5B 2ZQMA 4JV5O 4DUYO 3Q4HA 2DYSB 1G1XB 2EIJC 1Q3EA 4HAMA 2CDYA 2B9ZA 4JV5B 4IGGA 3B2EE 2JVDA 2QWOB 1O9HA 5L3EA 3TJTA 1WPBA 2EIJB 1K97A 1WP8A 1B04A 3OAAG 2WA4A 3AK2A 1M93A 1ZAUA 1WP7A 1AI4A 2OTLV 3EVKA 5CN0A 1WLEA 4X62O 5F2VO 4DV3O 4LF8O 3P3PA 2A9HA 4LF4B 4F6EA 1AI6A 4CS4A 3IC9A 3MHSC 2ZE8A 3M8AA 3B8MA 1NTKH 1S5LZ 3BPZA 1BE3H 1GRJA 3ETEA 2WLHA 2IJHA 4YIOA 2GDSA 2CTRA 1Q5OA 3LSQA 2LP7A 3OEHG 4X65B 1XL6A 5CA1A 2ZD9A 3OMAB 1DF5A 4H44B 4LF9O 3ABLB 4I0XB 3X2QC 4FJCC 2OCHA 4NXMO 3ZRWB 1SQQH 1WJZA 1N36B 1K9MW 1S77D 1K7DA 5CA1B 3SPCA 4DR4O 3R66A 4X20B 2KQXA 3W7SA 4I4TA 2WLNA 3P32A 1H2LA 4YIPA 1BHBA 1FXKA 2YUAA 4NYKA 4MVRA 4QE7A 4IIJA 4FM0A 2F4VB 2WSSG 4DV4O 1GTOA 2EILB 3FAVA 4G2KA 1Y76A 1GAXA 3DXRA 3RYHA 1TUBB 3JD0A 4UCVA 4I50A 5A2QN 3H9VA 5H5NA 4AHCA 3HPLC 5JJJB 1SA0A 1Y67A 3H1IH 1FFXA 2ZR2A 2JGDB 4PA6A 4DUYB 1WAZA 1IBKO 5JVDB 1Y76B 2Q69A 1BMFG 4BIOA 5LL6Y 2QKAA 2EINC 3AG3C 5IDJA 4JI0O 3CEIA 1Q86W 2JGUA 1Q81W 4U3JB 4DR7O 1UPGA 2ZM6B 1WPXA 4B08A 5DM6V 2YIBA 3LDDA 1K73W 2DYSC 2PTMA 4U3JA 1K4DC 1IX9A 4TUYB 2YI8A 1DK1A 2LJ2A 1KB9F 1R73A 1HR0B 3OFNG 3C3SA 4ZHQB 3AK3A 4LFBO 4A5UB 1XNQO 2LFRA 1VQ7V 2ZIMA 4JYYA 1IDSA 2BTQB 4O2AB 4J41A 4TUYA 3E22A 4C7UA 4MW3A 2F23A 3N2GB 1MMMA 2ZNIA 3N27A 1AI7A 1OZ0A 4DK1A 4E4EA 4B3SO 3RYIA 4O2AA 2RMKB 2RDCA 5LGNA 4X1IA 2AGAA 1YF2A 3G4SV 3QVNA 2ZNJA 3OEEG 4FFBB 4GX1A 2E3CA 2GV9A 5JH7A 4FZ0A 1VF6A 1M90W 1QVFU 1H2MA 1D5AA 1TAEA 1P84F 4I0XA 5IJ0A 4JI1O 5B1AC 1JX9A 1W0JG 4MVMA 3L73H 4J7KA 2QWPB 3SYQA 3S3XA 4DR5O 2HFEC 4GT1A 4MTFA 5JH7B 4KHPB 3OMNB 3VQXA 4JI8B 5B1AB 2X6AA 1MSDA 1H2KA 5IJ0B 2YC0A 4I4TB 5LXTB 1LR1A 1L0LH 2AZ2A 1KBHA 3JCUZ 1ZX3A 2HJFC 2F1MA 4JI8O 2EJ7A 2X7RB 3CPWU 1GN2A 1YJWV 3K59A 4ZI7B 3ZHSA 2XAQA 2XAJA 4X88A 3QF7A 4DR6O 2PUSA 2K1EA 1N0JA 5LP6C 3TXQA 1R6TA 2V1DA 4MSWC 5KLVH 2EULA 4NTWA 2E5LB 3NXSA 5B1OA 4X1YA 2LQTA 5KHHA 1IBMB 4JYAO 4JI2B 4UCSA 3CC4V 1R3JC 5LBQA 3K08A 3E83A 2OT5A 3ETQA 4QJFB 4YHHB 4TOIA 2QWRB 4P30A 4B3SB 1H2NA 4AI8A 1N33O 2Y48A 1H8EG 3UO3A 1ORQC 1CXZB 2UXXA 4LWSA 2CH7A 4O4HB 1VQ5V 4PJ0Z 3ZHTA 1VQLV 1L1FA 3U11A 1S0VA 5FLXN 5L3CA 4DR4B 2JK5C 4F6RB 5KUMA 1I7FA 1YTFD 1GN3A 3T1HO 3BA8A 3LUTB 3QTCA 3KCYA 1FKAO 3SJBC 2JEXA 5FPOA 1PM9A 2IJKA 5CBHA 1QQCA 3D8CA 3ZX6A 4MVUA 4DV4B 5KA5A 2EIMC 3ASNB 4DRXB 2HJDA 4QNHB 5EZYA 4UCUA 4U7NA 3CSXA 1S5JA 1SETA 4L8JA 1AVMA 2DQ0A 3QO7A 2RN9A 5EIBC 4ZOLB 2RQ6A 3OD4A 1QLNA 4HYOA 3H1HH 1WB7A 3K0GA 5DN6G 1BL8A 3BCCH 1JQ0A 1M1KW 1TUBA 2BCCH 2QEXV 3B40A 2BTOA 1J95A 4GLXA 3UQ8A 3THOA 5L3GA 1KD1W 4ZOLA 1XOUA 4CH5A 2UUCB 2QE7G 1G4YB 3K0DA 5JWPA 3ZIAG 3ASOB 3ICXA 3JASB 4GCZA 5LMNB 1EN5A 1O9GA 2BSKA 3E86A 1NR7A 2UU9O 5IJ9B 3NR7A 4X89A 3SDLA 2R9AA 4DR2O 3L75H 3CXHF 4NVPA 3ASOC 4MT8A 2YXYA 3KZIZ 1AR5A 3LSUA 1VQ6V 1S5HC 2IM9A 1R1BA 4B3TB 3G67A 4DV0O 4GYCB 4LCUC 3HKBB 1DGSA 4I9WA 3K3WA 4N23A 1NU1H 2MK3A 4GZRB 4NB5A 2QM8A 3SJAC 4ZHQA 1YJ9V 2AHYA 1XNRB 4N21A 3BAAA 3UKMA 5LHGA 4DV6B 1IBLO 4KFMA 4UV8A 4DR2B 1XMOO 4TQDA 3W7XA 5KA6A 5LOVB 3ZS8C 5KX5A 1VEWA 2NN4A 2YIDA 4H33A 4X62B 2QTSA 3BVOA 4YJ3B 2VS0A 1XL4A 3CCMV 3JALA 1SESA 3SYOA 3JYCA 2R72A 1XDCA 4YJ3A 2ADPA 4X20A 3IC7A 3K58A 3UM7A 5IWAO 1HNZB 3W7TA 2EZPA 4K0KB 1XUQA 4WBNA 4OX9B 2P06A 2XASA 2BOBC 4WFBV 1BZKA 3G6BA 2PYJA 3SYAA 4IIJB 5KMGA 2OCCC 4OPHA 3CRAA 4LFCB 1B6QA 1HNWO 3OE7G 4PELA 4JI0B 1K4CC 1OHHG 2CGNA 1KU9A 3KCXA 3E8BA 1YDXA 4Q6GA 1WB8A 3B77A 4PI2A 4JF3A 4R6ZA 2FTKA 5L3FA 2ZXWB 4GX5A 1IBMO 4JYAB 5IY5B 2YDEA 4J11A 3CCUV 1I94O 3T2MA 3APQA 3CRMA 2P4VA 2FB5A 3DC5A 1BQZA 2C2AA 5JJNB 1N33B 3DC6A 1GKFA 1SS3A 2UUAB 1QR9A 2DW4A 5IY5C 4DR7B 2H94A 4CH6A 5KUKA 2F95B 4LNUB 1AJNA 2XTAA 4LH7A 3JAWA 3AG2C 4JGSA 3QNEA 4QIWF 5ITZA 2UU9B 4XDJA 5LGUA 1EZJA 2X6BA 2HVKC 1F23A 1OCRC 2QGNA 2Q4PA 3ZMUA 2KSDA 3JARA 5FNVB 1RPRA 2M7WA 4BAYA 1CEZA 2GUZB 4JAUA 3OR6C 1YHQV 1OCCC 1SZTA 1NI8A 2UUAO 4FZ1A 2HEPA 1RP3B 2A7WA 4H0LB 2ZT9B 4IL6Z 1FS0G 1XNRO 2IJJA 1YCIA 3OGCC 1VF7A 3RYIB 3WB0A 3AG4B 2ZE6A 2DYRC 2ITCC 1Q43A 3E8FA 4QPKA 3L72H 5EC1C 3ZMSA 1RM1B 2Y4TA 3HR0A 1Z5VA 4ASUG 2GTAA 2VWJA 1Q82W 1WNSA 3TETA 3FKSG 2QM4A 4NXMB 2QKCA 2DYRB 1JVMA 4MVOA 5FPRA 4CH3A 1XBLA 4O2BA 3CX5F 2QA4V 4R7CA 1QCEA 1NH2B 3D3QA 2ADQB 4JYCA 1BQ0A 1LUWA 3F7YC 1NH2D 2XAHA 1M9NA 4LR3A 3PN1A 5C8YB 1OCZC 3ETDA 3FFQA 2QKSA 4UVCA 4I55B 4KL1A 3A8TA 3T4DA 2PF4E 2ZE7A 4K8ZA 2JJ1G 1V54B 3RBZA 2QWQB 4JI7O 4WFGA 4LFBB 3LSSA 3BABA 3E35A 2W0FC 4LF5B 4EEQA 1KC8W 1KKDA 4K35A 1AI5A 3BRCA 5CB4A 3RYCA 5KAFZ 5LYJB 4JPRA 1M56B 1R3LC 1PV0A 2AXTZ 4X1YB 1XI1A 3PJSK 4BIUA 1F4MA 3E8GA 1IXBA 1XHXA 3R65A 4K3AA 3CWBH 2Q8VA 3CRQA 1KYOF 1PNMA 5IYBO 3IFXA 4PI0A 1SF9A 1SRYA 3JSLA 1W0KG 4UVBA 2EIKB 4YY3B 3C90A 3JCZA 5B1BB 2Z3YA 4LNUA 1TVKA 1U97A 2Y69C 3VQVA 2OYQA 3L71H 3ZMVA 2JJ2G 3CRRA 2EIKC 3TXSA 5CMUA 1VQ4V 4DUZB 1OCRB 2ZIOA 3JATB 1R6KA 3H1KH 2NR5A 5H6RA 4MVQA 5LA6B 2IH1C 4PDRA 2Q73A 1ENVA 3ZMZA 1AP6A 2P67A 3K57A 3UO2A 5K1PA 1NTZH 4O4LB 4CC6A 1I0HA 1KQSU 2ZCEA 2WPDG 4TV9A 5B3SB 3E22B 2KKWA 1QNMA 3AG4C 2DMXA 3MD0A 3TCUA 3N2GA 3GVMA 4TSFG 3MAQA 2WLKA 4FMTA 4O4LA 5GW7A 3ZMTA 1QBZA 4O4JB 3CMAV 3BA9A 5EBMC 2Q7GA 3ABMC 4CBCA 1EM1A 4ZKIA 1Q8IA 4JTCB 1Q6HA 4GUNA 4X64O 3RYHB 4UB6Z 2MW2B 5J2TA 5BMVB 3ZJZA 1A32A 1FD9A 2FYUH 1I94B 4FLUA 3D36A 1FJGB 4DV3B 4LF8B 3G6EV 2ETNA 2QR4A 4X66B 1NVPD 4JI6O 5HFMA 3ABUA 3W7WA 4DV1B 4EKWA 1N32B 4FLZA 3DTUB 3LNMB 4QGPA 2WAMA 1V54C 1KP3A 1RPOA 3K03A 3L74H 1YVWA 5D5PA 2RJZA 1VQMV 2OTJV 1I08A 1ZSPA 2CAZC 4UCOA 3X2QB 1QLEB 4ZI7A 5C93A 4FLVA 1T5EA 3ZBHA 5EYPB 3IAYA 1FXVA 3CCEV 4AQYO 4YJ2A 4ZBMA 3BEHA 4BW9A 2DE0X 3VOUA 1JR9A 4I7ZB 5K1XA 3K5MA 1EBOA 2A79B 1NZ6A 2GHYA 1N32O 3F5TA 5LOVA 4JI1B 4LF7O 3ETGA 1HDJA 2YI9A 5CA3A 5J2UB 3WG7B 2HKOA 2BTQA 3ZRXA 2ATKC 1KP2A 4RWUA 4NR1A 4NTYA 4KHPO 3TGUH 4LF7B 1QVGU 3N2KA 4U3FH 2EILC 3A0HZ 1BGYH 4IYHA 4DV7O 3S3WA 2IW5A 2WLLB 3JATA 2ZDIC 4LFAO 1XQ8A 3GB7C 1H2SB 3DGEA 1CPYA 2LGQA 4DV2B 2RCVA 1MZFA 3MDSA 3AG3B 3OR7C 2YIBD 2WLLA 1IXMA 1TGOA 2XAFA 1K34A 1OJHA 4O4IB 1AILA 1P49A 3L9DA 2P5OA 3OGIB 3A2FA 1VIBA 1XHZA 1GK9A 3FB6C 4L87A 4WFHA 1MZEA 2LW7A 1DF4A 1GO3F 4JI2O 2VQFO 4NTXA 5EZYB 4D7SA 1B06A 4LF6B 1EZVH 1OCOB 2NNUA 2Q67A 3ZRVA 3AG7A 5LGTA 3SGIA 1JCHA 3MHHC 1N0NA 1LUVA 2JIZG 1J5EB 1KUQA 1OCOC 1PL4A 2X6CA 3IJ4A 2N05A 3T1YO 2ZINA 1YITV 1OV9A 2CK3G 1X4TA 4J7JA 4GX0A 3OMIB 2Q0OC 5H9CA 1FPOA 4D6TH 4IHJB 2JS3A 2N04A 4RQEA 2H8PC 3HKDA 1E1QG 1Q6UA 1SQFA 3JARB 4MS2A 3JD4A 4Z1MG 2XUMA 2AW9A 2GUZA 2BSKB 1VQ8V 1D2DA 1TA8A 3HKDB 5BY1A 1MABG 5EBWC 1XMQO 1FJGO 3RVYA 1K8AW 1UFIA 1HR0O 3Q4HB 2QSAA 3W7UA 1NTMH 4UUJC 1NVPB 5KAIZ 4W4KA 4AQYB 4OXSA 4DV5O 2F43G 3G71V 4MW8A 1I5YA 1NR1A 1RSOB 2ODMA 3ABLC 2HLDG 2OIGA 2ARHA 5EK0A 1DLBA 4JZGA 1BT8A 3F5WC 3HB3B 3WB1A 2NLJC 3J81N 3BFRA 4LFCO 4DRXA 2VQEB 5LMNO 1ZL8A 1Y74A 2A3QA 4QE9A 1HP8A 3KG2A 4H37A 1XEQA 3QO5A 3CB2A 3SPJA 3OTFA 1SQVH 4FIPC 4JAAA 1IURA 3ABKC 1P7BA 5LP6B 2Y0PA 5C8YA 4FK5C 3T1CA 4R8CA 1US6A 4JTDB 5EC2C 4RUEA 5HFLA 1K5SA 4X1IB 4PA4A 1Y66A 1VF6C 1JJOA 3HKEB 2CTPA 4O4IA 1V55B 5BMVA 4FPPA 1ZLZA 2W0XA 4K0KO 4FFBA 4FM1A 1URFA 5CB4B 1MNGA 4DUZO 2ZR3A 3SJQC 3OTOB 1QR8A 1ZTEA 2EJRA 5CBFA 3CP1A 3EXAA 3FB5C 3JD1A 2A06H 5IT9N 2X0LA 1IVSA 3O65A 4D7TA 4PV1B 1IBLB 5KHGA 2ZM6O 4IHJA 1N4CA 4JTAB 4X9QA 2OWOA 3RFRA 4RQFA 1SQXH 3RWRD 4P9OA 1GMGA 2GBOA 1MOFA 4LFAB 2QWNB 1RFYA 2G38A 3L70H 1ZWIC 3UT5A 1ROPA 4FLWA 2UUBO 4YY3O 4LF9B 1HNWB 2PGGA 4X8AA 1BSMA 4JI4B 1IZ3A 4TQFA 1K33A 1PPJH 4IT5A 5J9PC 4FFKA 4JI3O 1IBKB 3QG5A 3RW0A 4TV9B 3U0ZA 1WA8A 4P9PA 4OX9O 3A0BZ 2Q68A 2B5UA 5B1NA 3CMEV 4WFAV 2PI4A 2P4KA 2UUCO 2BOCC 3K9AA 4MTOA 1KECA 4G28B 2YEVB 1G6UA 2Y0IA 4FVMA 5LA6A 3STLC 5LHHA 5B66Z 3LDCA 1SQBH 3ABTA 2O57A 3AK1A 4I5SA 3SPIA 1J5EO 2IJIA 4I9QA 1ZL8B 2HP8A 1FYJA 4R50A 4DK0A 4OGQB 5BR8O 2KB1A 5LP6A 2XHBA 2UXBO 3ABKB 4DYLA 4HNAA 4DW0A 4O4JA 2IBZH 1XILA 2B1IA 3RGBA 3E89A 1LNQA 2EINB 1YXBA 4JASA 1JOYA 3I5DA 2FMLA 4B3TO 5EBLC 1NJIW 2R9IA 3JAKA 4E2LA 4JZ2A 4CS2A 1XMOB 5LHIA 2IU3A 4CZZA 4JI7B 5CBGA 2QJ1A 3STZC 3B8NA 1PNLA 1HNXB 4NXNO 4YJ2B 2IH3C 1G8MA 2RNBA 1YJNV 3ZN1A 4PA3A 1XNQB 1SQGA 5FNVA 2CUGA 2QTOA 1XMQB 4FLXA 2HG5C 1N36O 3CCQV 4LBEC 5EIBD 1JJ2U 3OM3B 2AZ0A 3C3TA 4EB6B 1RSOA 2OCCB 2Q7HA 1VARA 3FAVB 2Z5UA 3JAMN 3RYFB 3IGAC 2ILMA 3GWOA 4X1KB 3CCSV 3ASNC 1HNZO 2JGDA 1H8HG 2WLJA 3CXCU 1FXHA 1GH6A 2PYLA 1JMKC 3RYFA 3FYIB 1BS3A 1YZBA 5IYZA 4W4LA 2Q9LA 3LNNA 3GWKC 4HZ3A 1AB3A 1WA8B 3HKCB 1U96A 1QHTA 4QPJA 5JCOC 1KKCA 2F66C 2ITDC 5IYCO 2UXCB 3AEIA 5IYZB 5GONB 5CA0B 1BHAA 2VQFB 4B3RO 4CC5A 3H1LH 2ZE5A 4FM2A 1W2BU 1QU7A 3SPHA 4J80A 4TT3G 3OTOO 4JAVA 4UVAA 1OCCB 1SQPH 3B4SA 4BW5A 3CD6V 3TK1A 2HHHO 3CCRV 1K5QA 2K9PA 3O9OA 3A0RA 4Q20A 4CS3A 2P90A 2XT9A 3ZN0A 5A9GA 5KMGB 4B7EA 4LH6A 2WLIA 1M4UA 4PA7A 3JD2A 4LC1A 3WB2A 5BXZA 1GM7A 3SJCC 2FL4A 4F4LA 3RN4A 2PZSA 4XDKA 1BCCH 2VWKA 2VQEO 4JI3B 1Z2GA 3K9SA 3VQYA 4J10A 2DOSA 3LDEA 1JPXA 1Q90D 4I50B 1TVKB 3CS5A 1SA0B 2QDOA 3WU2Z 3ZHVA 4K8XA 1HNXO 4H13B 4ABMA 2UUBB 1HW7A 1WN7A 3OUSA 1AP5A 2AHZA 3DSQA 3CRCA 5D5QA 5IYDO 1TUEB 2OIEA 3JAWB 2BE3A 4KUMA 5ITZB 1XREA 1L0NH 4MTGA 5JQGA 4WCEV 1K92A 4BWAA 4UV9A 3CYOA 4PDLA 2CE4A 2FKXA 2EIMB 2HR3A 3UCSC 4B3RB 4OPAA 3G80A 4ZIBA 4XDLA 1VQ9V 1Y74B 3ZHQA 2YEVA 3ZRSA 4XBFA 1K3EA 2LO1A 3K04A 1ZUQA 4X64B 1FAFA 4GX2A 1CP9A 1PNKA 2R70A 4KXRA 1R3KC 2XOKG 1THZA 4WF9V 4DR6B 3HKEA 2CGOA 4J7ZA 4DO2A 2W6JG 1MA1A 4MVZA 2UXNA 2ZXWC 3AG2B 5KHIA 4LWSB
chains in the Genus database with same CATH topology
2H94A 5EK0A 3W7SA 1DLBA 3SYCA 5KUKA 2WLNA 3P32A 3F5WC 2Y69B 4KP4A 1EFRG 3M99B 2Q6AA 3E2EA 1AJNA 3HB3B 1BHBA 2NLJC 1FXKA 3AG2C 1F4NA 4JGSA 3QNEA 4QIWF 1YTFB 1R6NA 4XDJA 4MVRA 4QE7A 4RO2A 5LGUA 1EZJA 2X6BA 2HVKC 2WSSG 1F23A 3CC2V 1GTOA 1OCRC 2EILB 4G2KA 4RAIA 3ZMUA 3I55V 4QE9A 3KG2A 4H37A 1RPRA 2M7WA 1NBMG 2YSUB 3QO5A 2IU0A 4BAYA 1CEZA 3SPJA 3JD0A 4JAUA 4FIPC 4WFFA 3OR6C 3ABKC 1P7BA 1OCCC 1SZTA 3HPLC 1YHQV 2PI5A 4FK5C 2ZR2A 1FXKB 3OUFA 3T1CA 4PA6A 4R8CA 2Q69A 1BMFG 4JTDB 4RUEA 5EC2C 5HFLA 1FS0G 1P4RA 2EINC 3AG3C 5IDJA 3CCLV 1K5SA 1Q7YW 1AROP 2IJJA 3K79A 1Y66A 4PA4A 1Q86W 3OGCC 1YI2V 3AG4B 1V55B 4J9YB 4FPPA 1Q81W 2DYRC 2ITCC 1E1RG 5EC1C 3E8FA 4QPKA 3ZMSA 1RM1B 1HWYA 1WPXA 4ASUG 2ZR3A 1Q82W 2D3OW 1VQKV 5DM6V 3SJQC 5BZBA 3FKSG 3TETA 1QR8A 2EJRA 2DYRB 3SPGA 1JVMA 5CBFA 4RUFA 3LDDA 4MVOA 1K73W 2DYSC 1K4DC 3CP1A 2QA4V 4R7CA 1QCEA 1NH2B 1OCZB 1R73A 3FB5C 4MVSA 3JD1A 4JYCA 3OFNG 2WLMA 5L3DA 3F7YC 1NH2D 2LFRA 2X0LA 2XAHA 1VQ7V 1M9NA 3P30A 1M57C 1FFTB 1OCZC 4PA9A 3ETDA 4MW3A 4JTAB 2QKSA 3T4ZA 1UJWB 1AI7A 1OZ0A 1F51A 4UVCA 1VQNV 3T4DA 4RQFA 2JJ1G 1V54B 4JYBA 3RBZA 5LGNA 4P9OA 4WFGA 1SERA 1GMGA 1MOFA 3G4SV 3LSSA 5E1AC 3E35A 2W0FC 1H2GA 3OEEG 1ZWIC 1KC8W 1KKDA 4GX1A 1AI5A 2XNDG 1ROPA 3CCVV 1QLEC 3BY6A 2DWEC 1M90W 4P2ZA 1QVFU 4X8AA 4JPRA 1M56B 1R3LC 1K33A 2EZOA 5J9PC 3PJSK 4BIUA 5B1AC 1F4MA 1I5XA 3E8GA 3FYEB 1JX9A 1W0JG 2JDIG 4G27B 4MVMA 4BIZA 3R65A 1NQTA 3RW0A 4P9PA 2JEUA 3SYQA 1PNMA 2Q68A 5IYBO 2B5UA 3VBBA 2HFEC 4GT1A 4MTFA 5B1NA 3IFXA 3CMEV 4WFAV 2PI4A 3OMNB 2BOCC 3K9AA 4TWKA 1SRYA 5B1AB 2X6AA 4MTOA 1W0KG 4UVBA 2EIKB 1KECA 4G28B 2YEVB 3EFFK 3JCZA 5B1BB 2Z3YA 4YXWG 3STLC 2Y69C 5LHHA 2HJFC 3SYPA 3LDCA 3ABTA 2X7RB 3ML0A 3ZMVA 2W6IG 1AJPA 2JJ2G 4I5SA 2EIKC 3SPIA 3CPWU 2IJIA 1YJWV 5CMUA 1VQ4V 5B1BC 1MSWD 5H6QA 1OCRB 2XAQA 4R50A 2P7TC 1R6KA 2XAJA 4X88A 3CC7V 5H6RA 2KB1A 4MVQA 3WFVA 2K1EA 3EHBB 2IH1C 3ABKB 4PDRA 5B3SC 1YIJV 5IY5C 2V1DA 4MSWC 1FXKC 1ENVA 3NXSA 3ZMZA 5B1OA 1YSCA 2P67A 1Y4MA 2B1IA 3E89A 2WWWA 1KQSU 1LNQA 4DXWA 1R3JC 2EINB 3CC4V 2WPDG 5LBQA 3K08A 5B3SB 2EBOA 3E83A 2OT5A 3FB8C 4JASA 4QJFB 3AG4C 4P30A 1JOYA 3MD0A 3TCUA 4TSFG 2Y48A 5EBLC 1NJIW 2WLKA 1H8EG 2R9IA 4FMTA 1RM1C 1GM8A 4E2LA 1ORQC 2UXXA 5LHIA 5GW7A 3ZMTA 1PD3A 1QBZA 1VQ5V 3CMAV 2IU3A 4U7OA 5EBMC 4CZZA 3D3IA 1VQLV 1NKDA 4PDMA 1L1FA 2QM7A 5CBGA 1S0VA 2P6JA 5L3CA 3STZC 3B8NA 3OW2U 1PNLA 2JK5C 3ABMC 5KUMA 1YTFD 2IH3C 4CBCA 1G8MA 4ZKIA 3LUTB 1E79G 1VQPV 4MTXA 4WFEA 2GSMB 1YJNV 3ZN1A 4PA3A 4PDVA 4JTCB 1R3IC 1MG1A 1S3JA 2JEXA 5CBHA 2IJKA 2QTOA 3ABMB 3ZJZA 2HG5C 1M57B 2ZDIA 3CCQV 1PL0A 4LBEC 4MVUA 3JD3A 3D36A 1JJ2U 3OM3B 5KA5A 2EIMC 3ASNB 3G6EV 2OCCB 1NVPD 2DQ3A 4QNHB 5FL7G 5HFMA 4J9ZB 2V7QG 2Z5UA 3ABUA 3W7WA 4EKWA 3F7VC 3FB7C 4U7NA 3DTUB 3LNMB 3IGAC 3GWOA 3CCSV 2WAMA 1DTOA 1KP3A 1V54C 1SETA 1RPOA 3ASNC 3K03A 1COWG 2DQ0A 1H8HG 3RVZA 3QO7A 2WLJA 1VQMV 3CXCU 2OTJV 3ZCCA 1QLNA 1FXHA 2XAGA 4HYOA 3K0GA 3FYIB 3X2QB 2R9RB 5DN6G 1QLEB 1BL8A 1JQ0A 2WLIB 5C93A 1M1KW 2QEXV 1M56C 3ZRWA 1J95A 5L3BA 3H01A 1FXVA 3CCEV 1S72V 3WG7C 5L3GA 4HZ3A 1KD1W 1N8RW 4ZBMA 4QPJA 3BEHA 3VOUA 2ITDC 5IYCO 1PKXA 1EBOA 1G4YB 2A79B 2GHYA 2QE7G 3AEIA 3E8HA 3K0DA 3QO8A 2A0LA 3ETGA 5CA3A 3ZIAG 3ASOB 4GCZA 3WG7B 1BHAA 2HKOA 3ZRXA 2ATKC 3E86A 1KP2A 1NR7A 4X89A 1AJQA 1QVGU 2EILC 1W2BU 3SPHA 3ASOC 3K06A 4MT8A 4TT3G 1VQOV 2HVJC 1GM9A 2IW5A 2WLLB 2ZDIC 4JAVA 4UVAA 1VQ6V 1OCCB 4BW5A 1AR1B 1S5HC 2B1GA 3CD6V 3TK1A 3CCJV 3CCRV 3AG1B 1K5QA 3GB7C 4UXNA 3DGEA 3A0RA 4Q20A 1CPYA 2P90A 4I9WA 4LCUC 4N23A 3K3WA 3ZN0A 2MK3A 3AG3B 2QM8A 3OR7C 2WLIA 4PA7A 3I56V 2WLLA 3JD2A 1IXMA 4LC1A 1YJ9V 3AG1C 2AHYA 2XAFA 1K34A 1V55C 1GM7A 4LP8A 4N21A 3UKMA 5LHGA 4F4LA 2LFSA 4KFMA 4XDKA 4UV8A 1S76D 2DWDC 1H38A 1GK9A 3FB6C 4L87A 4WFHA 3W7XA 2ZQMA 5KA6A 1DF4A 1GO3F 4H33A 1OCOB 2DYSB 2NNUA 2Q67A 3LDEA 1JPXA 2EIJC 3ZRVA 4HAMA 5LGTA 1JCHA 1XL4A 3MHHC 3CCMV 5L3EA 2JIZG 1SESA 3SYOA 3OUSA 2AHZA 3JYCA 1OCOC 2X6CA 2EIJB 1K97A 3OAAG 3IC7A 1YITV 3UM7A 2CK3G 5IYDO 1TUEB 3W7TA 2EZPA 1AI4A 4GX0A 2OTLV 3OMIB 5H9CA 5CN0A 1WLEA 4KUMA 4MTGA 2A9HA 4WCEV 2XASA 1K92A 2BOBC 4WFBV 4UV9A 3CYOA 4PDLA 1AI6A 3SYAA 2EIMB 4RQEA 2HR3A 3MHSC 2OCCC 2H8PC 3B8MA 1E1QG 4XDLA 1VQ9V 1B6QA 3ETEA 3OE7G 2WLHA 2YEVA 4PELA 4MS2A 3JD4A 4Z1MG 1K4CC 1OHHG 2IJHA 3ZRSA 4XBFA 1VQ8V 3E8BA 1K3EA 3LSQA 2LP7A 3K04A 3B77A 3OEHG 4JF3A 1XL6A 4R6ZA 2FTKA 5L3FA 1MABG 2ZXWB 2ZD9A 3OMAB 4GX2A 5EBWC 4GX5A 1CP9A 1PNKA 3RVYA 1DF5A 1K8AW 3ABLB 3X2QC 5IY5B 3W7UA 4FJCC 1R3KC 3CCUV 2XOKG 1THZA 4UUJC 3T2MA 3ZRWB 4WF9V 1NVPB 2C2AA 4OXSA 2F43G 3G71V 1K9MW 1S77D 4DO2A 2W6JG 4MW8A 4MVZA 1K7DA 1I5YA 2UXNA 2ZXWC 1NR1A 1GKFA 3SPCA 3AG2B 1QR9A 2DW4A 3ABLC 2HLDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E V;  1YJW V;  3OW2 U;  1VQ4 V;  2OTL V;  1M1K W;  3CC4 V;  2QEX V;  1YHQ V;  1VQ7 V;  3G4S V;  3I56 V;  4WCE V;  3CME V;  4WFA V;  1QVG U;  3CCE V;  1VQP V;  1KC8 W;  1Q82 W;  1S72 V;  4WFB V;  1YJ9 V;  1YJN V;  2D3O W;  1W2B U;  1KD1 W;  1VQK V;  5DM6 V;  1K8A W;  3CCS V;  1N8R W;  3CCV V;  3CC7 V;  1NJI W;  3CCM V;  3CCU V;  1VQO V;  4WF9 V;  1K73 W;  1VQ9 V;  3CCL V;  1M90 W;  1QVF U;  1Q7Y W;  1YIJ V;  1VQ6 V;  1VQ5 V;  3G71 V;  3CMA V;  1Q86 W;  1VQM V;  1K9M W;  3CC2 V;  3CXC U;  3CCQ V;  3CCJ V;  2QA4 V;  3I55 V;  3CCR V;  1VQL V;  1YI2 V;  1VQN V;  3CD6 V;  2OTJ V;  1R73 A;  1VQ8 V;  1Q81 W;  1YIT V;  1JJ2 U;  3CPW U;  1KQS U; 
#chains in the Genus database with same CATH topology
 3SYC A;  5GON A;  2Y69 B;  4KP4 A;  1EFR G;  5IE9 A;  3M99 B;  3RT3 C;  4AIL C;  4O2B B;  2Q6A A;  4YHH O;  3E2E A;  4F6R A;  1F4N A;  4WBN B;  1YTF B;  1R6N A;  1EN6 A;  4RO2 A;  5LMU O;  4J42 A;  2UXB B;  5B5E Z;  4IYI A;  3CC2 V;  5E79 Z;  4RAI A;  4Z1V A;  5JJE B;  3I55 V;  1NBM G;  2YSU B;  2IU0 A;  4JI5 B;  5GTI Z;  3ZED A;  2M6Y A;  4HBN A;  4WFF A;  3D36 C;  1JFF B;  2PI5 A;  1FXK B;  3OUF A;  2YIA A;  2LW1 A;  1P4R A;  1N34 O;  3CCL V;  1Q7Y W;  4EFE A;  1ARO P;  3K79 A;  5LXT A;  3T1Y B;  4UCR A;  1JFF A;  1YI2 V;  4J9Y B;  4GKK O;  4DV2 O;  1E1R G;  2JRI A;  3J80 N;  4EFB A;  3RYC B;  1HWY A;  5H2F Z;  4EB6 A;  3K5O A;  2D3O W;  1VQK V;  5BZB A;  3CE2 A;  3SPG A;  5J2U A;  4RUF A;  4CH4 A;  5KHK A;  3CJH B;  2KG7 A;  1F7Y A;  1JA8 A;  1OCZ B;  4MVS A;  2Y4U A;  3DXR B;  2WLM A;  5L3D A;  3P30 A;  1M57 C;  1FFT B;  2KG7 B;  4PA9 A;  5IJ9 A;  3JSN A;  3T4Z A;  1UJW B;  1F51 A;  2P22 C;  4BR6 A;  1VQN V;  2DJV A;  4JYB A;  5CA0 A;  4DR3 O;  1SER A;  1P7G A;  5E1A C;  1H2G A;  2VRZ A;  2XND G;  3FD9 A;  3CCV V;  2E75 B;  1M5I A;  3VQW A;  2Z0A A;  1QLE C;  3BY6 A;  2DWE C;  4P2Z A;  2CTQ A;  2YIC A;  4DV1 O;  2EZO A;  1I5X A;  3FYE B;  2JDI G;  4LF6 O;  4G27 B;  4UFZ A;  4TV8 B;  4BIZ A;  1NQT A;  2GTS A;  2L6L A;  2JEU A;  5GTH Z;  3M7M X;  3P3N A;  3VBB A;  4TWK A;  3T1H B;  1GN4 A;  3EFF K;  1D5N A;  4TV8 A;  4YXW G;  3U10 A;  2Q7E A;  5KHJ A;  1PP9 H;  5LMU B;  1V9P A;  3SYP A;  1W59 A;  3JAL B;  3ML0 A;  4UB8 Z;  1AJP A;  2W6I G;  3ZHU A;  4DV0 B;  4LF4 O;  5B1B C;  4I55 A;  1MSW D;  5H6Q A;  3BHP A;  2P7T C;  4JI5 O;  5DED A;  4FLY A;  5J2T B;  4UCT A;  3CC7 V;  2N74 A;  4GKJ B;  3WFV A;  3EHB B;  3B09 A;  3K5L A;  5B3S C;  1YIJ V;  1FXK C;  1YSC A;  1Y4M A;  4X65 O;  3CHX A;  2WWW A;  5LYJ A;  4DXW A;  4B3M O;  1GN6 A;  4PHZ A;  2EBO A;  4X1K A;  3FB8 C;  5IWA B;  4GKK B;  2Q5Z A;  3KKY A;  5BR8 B;  1Q6I A;  1RM1 C;  4DV5 B;  1GM8 A;  4DR3 B;  2V4D A;  1VMG A;  1PD3 A;  4U7O A;  4LF5 O;  3D3I A;  2UXD B;  1NKD A;  4PDM A;  5EYP A;  2QM7 A;  1YEW A;  2P6J A;  1B3Q A;  3OW2 U;  1FFX B;  2WA3 A;  3HKB A;  3UT5 B;  3HKC A;  1VQP V;  5JVD A;  1E79 G;  4MTX A;  4WFE A;  2GSM B;  4DW1 A;  4PDV A;  1R3I C;  1MG1 A;  3ZHR A;  1S3J A;  2CH7 B;  4O4H A;  2UXC O;  1NT2 B;  3ABM B;  3J7A U;  1M57 B;  2ZDI A;  1PL0 A;  2JS5 A;  3OT7 A;  3JD3 A;  3N2K B;  2D2C B;  4PD4 F;  5JCO A;  2ZKO A;  2DQ3 A;  5KX5 B;  5FL7 G;  4J9Z B;  2V7Q G;  2YXH A;  3F7V C;  3FB7 C;  4DR1 B;  1Z5W A;  1L8D A;  1DTO A;  2H3O A;  1COW G;  3RVZ A;  2CTW A;  3APO A;  2HHH B;  3ZCC A;  2XAG A;  2Q0A A;  2R9R B;  2WLI B;  4DV7 B;  1M56 C;  4NXN B;  3ZRW A;  2PY5 A;  1SKV A;  5L3B A;  3H01 A;  1S72 V;  2F93 B;  3WG7 C;  2L35 A;  4B7K A;  5AG2 A;  1N8R W;  5TIS Z;  4Z2W A;  4JI6 B;  4X66 O;  1VF5 B;  4B3M B;  4HNA B;  1PKX A;  1X59 A;  4NKG B;  3E8H A;  3QO8 A;  1N34 B;  2A0L A;  5DEC A;  3FX7 A;  1NS1 A;  1EN4 A;  1AJQ A;  2F4V O;  3JAK B;  3K06 A;  4DV6 O;  2EX3 A;  1VQO V;  1VP7 A;  2HVJ C;  2YS8 A;  1GM9 A;  4FLT A;  3JAS A;  1AR1 B;  1AR4 A;  2B1G A;  3CCJ V;  3AG1 B;  1Y6X A;  2LGW A;  4GKJ O;  4UXN A;  3CJH A;  1SC5 B;  4ICG A;  2YXL A;  5JQG B;  2E74 B;  1KMI Z;  2DN9 A;  2UXD O;  3I56 V;  3H1J H;  3K5N A;  1SZX A;  3SR2 C;  3AG1 C;  2E76 B;  1V55 C;  4LP8 A;  2LFS A;  4JI4 O;  1S76 D;  2DWD C;  1H38 A;  4DR1 O;  2E5L O;  4DR5 B;  2ZQM A;  4JV5 O;  4DUY O;  3Q4H A;  2DYS B;  1G1X B;  2EIJ C;  1Q3E A;  4HAM A;  2CDY A;  2B9Z A;  4JV5 B;  4IGG A;  3B2E E;  2JVD A;  2QWO B;  1O9H A;  5L3E A;  3TJT A;  1WPB A;  2EIJ B;  1K97 A;  1WP8 A;  1B04 A;  3OAA G;  2WA4 A;  3AK2 A;  1M93 A;  1ZAU A;  1WP7 A;  1AI4 A;  2OTL V;  3EVK A;  5CN0 A;  1WLE A;  4X62 O;  5F2V O;  4DV3 O;  4LF8 O;  3P3P A;  2A9H A;  4LF4 B;  4F6E A;  1AI6 A;  4CS4 A;  3IC9 A;  3MHS C;  2ZE8 A;  3M8A A;  3B8M A;  1NTK H;  1S5L Z;  3BPZ A;  1BE3 H;  1GRJ A;  3ETE A;  2WLH A;  2IJH A;  4YIO A;  2GDS A;  2CTR A;  1Q5O A;  3LSQ A;  2LP7 A;  3OEH G;  4X65 B;  1XL6 A;  5CA1 A;  2ZD9 A;  3OMA B;  1DF5 A;  4H44 B;  4LF9 O;  3ABL B;  4I0X B;  3X2Q C;  4FJC C;  2OCH A;  4NXM O;  3ZRW B;  1SQQ H;  1WJZ A;  1N36 B;  1K9M W;  1S77 D;  1K7D A;  5CA1 B;  3SPC A;  4DR4 O;  3R66 A;  4X20 B;  2KQX A;  3W7S A;  4I4T A;  2WLN A;  3P32 A;  1H2L A;  4YIP A;  1BHB A;  1FXK A;  2YUA A;  4NYK A;  4MVR A;  4QE7 A;  4IIJ A;  4FM0 A;  2F4V B;  2WSS G;  4DV4 O;  1GTO A;  2EIL B;  3FAV A;  4G2K A;  1Y76 A;  1GAX A;  3DXR A;  3RYH A;  1TUB B;  3JD0 A;  4UCV A;  4I50 A;  5A2Q N;  3H9V A;  5H5N A;  4AHC A;  3HPL C;  5JJJ B;  1SA0 A;  1Y67 A;  3H1I H;  1FFX A;  2ZR2 A;  2JGD B;  4PA6 A;  4DUY B;  1WAZ A;  1IBK O;  5JVD B;  1Y76 B;  2Q69 A;  1BMF G;  4BIO A;  5LL6 Y;  2QKA A;  2EIN C;  3AG3 C;  5IDJ A;  4JI0 O;  3CEI A;  1Q86 W;  2JGU A;  1Q81 W;  4U3J B;  4DR7 O;  1UPG A;  2ZM6 B;  1WPX A;  4B08 A;  5DM6 V;  2YIB A;  3LDD A;  1K73 W;  2DYS C;  2PTM A;  4U3J A;  1K4D C;  1IX9 A;  4TUY B;  2YI8 A;  1DK1 A;  2LJ2 A;  1KB9 F;  1R73 A;  1HR0 B;  3OFN G;  3C3S A;  4ZHQ B;  3AK3 A;  4LFB O;  4A5U B;  1XNQ O;  2LFR A;  1VQ7 V;  2ZIM A;  4JYY A;  1IDS A;  2BTQ B;  4O2A B;  4J41 A;  4TUY A;  3E22 A;  4C7U A;  4MW3 A;  2F23 A;  3N2G B;  1MMM A;  2ZNI A;  3N27 A;  1AI7 A;  1OZ0 A;  4DK1 A;  4E4E A;  4B3S O;  3RYI A;  4O2A A;  2RMK B;  2RDC A;  5LGN A;  4X1I A;  2AGA A;  1YF2 A;  3G4S V;  3QVN A;  2ZNJ A;  3OEE G;  4FFB B;  4GX1 A;  2E3C A;  2GV9 A;  5JH7 A;  4FZ0 A;  1VF6 A;  1M90 W;  1QVF U;  1H2M A;  1D5A A;  1TAE A;  1P84 F;  4I0X A;  5IJ0 A;  4JI1 O;  5B1A C;  1JX9 A;  1W0J G;  4MVM A;  3L73 H;  4J7K A;  2QWP B;  3SYQ A;  3S3X A;  4DR5 O;  2HFE C;  4GT1 A;  4MTF A;  5JH7 B;  4KHP B;  3OMN B;  3VQX A;  4JI8 B;  5B1A B;  2X6A A;  1MSD A;  1H2K A;  5IJ0 B;  2YC0 A;  4I4T B;  5LXT B;  1LR1 A;  1L0L H;  2AZ2 A;  1KBH A;  3JCU Z;  1ZX3 A;  2HJF C;  2F1M A;  4JI8 O;  2EJ7 A;  2X7R B;  3CPW U;  1GN2 A;  1YJW V;  3K59 A;  4ZI7 B;  3ZHS A;  2XAQ A;  2XAJ A;  4X88 A;  3QF7 A;  4DR6 O;  2PUS A;  2K1E A;  1N0J A;  5LP6 C;  3TXQ A;  1R6T A;  2V1D A;  4MSW C;  5KLV H;  2EUL A;  4NTW A;  2E5L B;  3NXS A;  5B1O A;  4X1Y A;  2LQT A;  5KHH A;  1IBM B;  4JYA O;  4JI2 B;  4UCS A;  3CC4 V;  1R3J C;  5LBQ A;  3K08 A;  3E83 A;  2OT5 A;  3ETQ A;  4QJF B;  4YHH B;  4TOI A;  2QWR B;  4P30 A;  4B3S B;  1H2N A;  4AI8 A;  1N33 O;  2Y48 A;  1H8E G;  3UO3 A;  1ORQ C;  1CXZ B;  2UXX A;  4LWS A;  2CH7 A;  4O4H B;  1VQ5 V;  4PJ0 Z;  3ZHT A;  1VQL V;  1L1F A;  3U11 A;  1S0V A;  5FLX N;  5L3C A;  4DR4 B;  2JK5 C;  4F6R B;  5KUM A;  1I7F A;  1YTF D;  1GN3 A;  3T1H O;  3BA8 A;  3LUT B;  3QTC A;  3KCY A;  1FKA O;  3SJB C;  2JEX A;  5FPO A;  1PM9 A;  2IJK A;  5CBH A;  1QQC A;  3D8C A;  3ZX6 A;  4MVU A;  4DV4 B;  5KA5 A;  2EIM C;  3ASN B;  4DRX B;  2HJD A;  4QNH B;  5EZY A;  4UCU A;  4U7N A;  3CSX A;  1S5J A;  1SET A;  4L8J A;  1AVM A;  2DQ0 A;  3QO7 A;  2RN9 A;  5EIB C;  4ZOL B;  2RQ6 A;  3OD4 A;  1QLN A;  4HYO A;  3H1H H;  1WB7 A;  3K0G A;  5DN6 G;  1BL8 A;  3BCC H;  1JQ0 A;  1M1K W;  1TUB A;  2BCC H;  2QEX V;  3B40 A;  2BTO A;  1J95 A;  4GLX A;  3UQ8 A;  3THO A;  5L3G A;  1KD1 W;  4ZOL A;  1XOU A;  4CH5 A;  2UUC B;  2QE7 G;  1G4Y B;  3K0D A;  5JWP A;  3ZIA G;  3ASO B;  3ICX A;  3JAS B;  4GCZ A;  5LMN B;  1EN5 A;  1O9G A;  2BSK A;  3E86 A;  1NR7 A;  2UU9 O;  5IJ9 B;  3NR7 A;  4X89 A;  3SDL A;  2R9A A;  4DR2 O;  3L75 H;  3CXH F;  4NVP A;  3ASO C;  4MT8 A;  2YXY A;  3KZI Z;  1AR5 A;  3LSU A;  1VQ6 V;  1S5H C;  2IM9 A;  1R1B A;  4B3T B;  3G67 A;  4DV0 O;  4GYC B;  4LCU C;  3HKB B;  1DGS A;  4I9W A;  3K3W A;  4N23 A;  1NU1 H;  2MK3 A;  4GZR B;  4NB5 A;  2QM8 A;  3SJA C;  4ZHQ A;  1YJ9 V;  2AHY A;  1XNR B;  4N21 A;  3BAA A;  3UKM A;  5LHG A;  4DV6 B;  1IBL O;  4KFM A;  4UV8 A;  4DR2 B;  1XMO O;  4TQD A;  3W7X A;  5KA6 A;  5LOV B;  3ZS8 C;  5KX5 A;  1VEW A;  2NN4 A;  2YID A;  4H33 A;  4X62 B;  2QTS A;  3BVO A;  4YJ3 B;  2VS0 A;  1XL4 A;  3CCM V;  3JAL A;  1SES A;  3SYO A;  3JYC A;  2R72 A;  1XDC A;  4YJ3 A;  2ADP A;  4X20 A;  3IC7 A;  3K58 A;  3UM7 A;  5IWA O;  1HNZ B;  3W7T A;  2EZP A;  4K0K B;  1XUQ A;  4WBN A;  4OX9 B;  2P06 A;  2XAS A;  2BOB C;  4WFB V;  1BZK A;  3G6B A;  2PYJ A;  3SYA A;  4IIJ B;  5KMG A;  2OCC C;  4OPH A;  3CRA A;  4LFC B;  1B6Q A;  1HNW O;  3OE7 G;  4PEL A;  4JI0 B;  1K4C C;  1OHH G;  2CGN A;  1KU9 A;  3KCX A;  3E8B A;  1YDX A;  4Q6G A;  1WB8 A;  3B77 A;  4PI2 A;  4JF3 A;  4R6Z A;  2FTK A;  5L3F A;  2ZXW B;  4GX5 A;  1IBM O;  4JYA B;  5IY5 B;  2YDE A;  4J11 A;  3CCU V;  1I94 O;  3T2M A;  3APQ A;  3CRM A;  2P4V A;  2FB5 A;  3DC5 A;  1BQZ A;  2C2A A;  5JJN B;  1N33 B;  3DC6 A;  1GKF A;  1SS3 A;  2UUA B;  1QR9 A;  2DW4 A;  5IY5 C;  4DR7 B;  2H94 A;  4CH6 A;  5KUK A;  2F95 B;  4LNU B;  1AJN A;  2XTA A;  4LH7 A;  3JAW A;  3AG2 C;  4JGS A;  3QNE A;  4QIW F;  5ITZ A;  2UU9 B;  4XDJ A;  5LGU A;  1EZJ A;  2X6B A;  2HVK C;  1F23 A;  1OCR C;  2QGN A;  2Q4P A;  3ZMU A;  2KSD A;  3JAR A;  5FNV B;  1RPR A;  2M7W A;  4BAY A;  1CEZ A;  2GUZ B;  4JAU A;  3OR6 C;  1YHQ V;  1OCC C;  1SZT A;  1NI8 A;  2UUA O;  4FZ1 A;  2HEP A;  1RP3 B;  2A7W A;  4H0L B;  2ZT9 B;  4IL6 Z;  1FS0 G;  1XNR O;  2IJJ A;  1YCI A;  3OGC C;  1VF7 A;  3RYI B;  3WB0 A;  3AG4 B;  2ZE6 A;  2DYR C;  2ITC C;  1Q43 A;  3E8F A;  4QPK A;  3L72 H;  5EC1 C;  3ZMS A;  1RM1 B;  2Y4T A;  3HR0 A;  1Z5V A;  4ASU G;  2GTA A;  2VWJ A;  1Q82 W;  1WNS A;  3TET A;  3FKS G;  2QM4 A;  4NXM B;  2QKC A;  2DYR B;  1JVM A;  4MVO A;  5FPR A;  4CH3 A;  1XBL A;  4O2B A;  3CX5 F;  2QA4 V;  4R7C A;  1QCE A;  1NH2 B;  3D3Q A;  2ADQ B;  4JYC A;  1BQ0 A;  1LUW A;  3F7Y C;  1NH2 D;  2XAH A;  1M9N A;  4LR3 A;  3PN1 A;  5C8Y B;  1OCZ C;  3ETD A;  3FFQ A;  2QKS A;  4UVC A;  4I55 B;  4KL1 A;  3A8T A;  3T4D A;  2PF4 E;  2ZE7 A;  4K8Z A;  2JJ1 G;  1V54 B;  3RBZ A;  2QWQ B;  4JI7 O;  4WFG A;  4LFB B;  3LSS A;  3BAB A;  3E35 A;  2W0F C;  4LF5 B;  4EEQ A;  1KC8 W;  1KKD A;  4K35 A;  1AI5 A;  3BRC A;  5CB4 A;  3RYC A;  5KAF Z;  5LYJ B;  4JPR A;  1M56 B;  1R3L C;  1PV0 A;  2AXT Z;  4X1Y B;  1XI1 A;  3PJS K;  4BIU A;  1F4M A;  3E8G A;  1IXB A;  1XHX A;  3R65 A;  4K3A A;  3CWB H;  2Q8V A;  3CRQ A;  1KYO F;  1PNM A;  5IYB O;  3IFX A;  4PI0 A;  1SF9 A;  1SRY A;  3JSL A;  1W0K G;  4UVB A;  2EIK B;  4YY3 B;  3C90 A;  3JCZ A;  5B1B B;  2Z3Y A;  4LNU A;  1TVK A;  1U97 A;  2Y69 C;  3VQV A;  2OYQ A;  3L71 H;  3ZMV A;  2JJ2 G;  3CRR A;  2EIK C;  3TXS A;  5CMU A;  1VQ4 V;  4DUZ B;  1OCR B;  2ZIO A;  3JAT B;  1R6K A;  3H1K H;  2NR5 A;  5H6R A;  4MVQ A;  5LA6 B;  2IH1 C;  4PDR A;  2Q73 A;  1ENV A;  3ZMZ A;  1AP6 A;  2P67 A;  3K57 A;  3UO2 A;  5K1P A;  1NTZ H;  4O4L B;  4CC6 A;  1I0H A;  1KQS U;  2ZCE A;  2WPD G;  4TV9 A;  5B3S B;  3E22 B;  2KKW A;  1QNM A;  3AG4 C;  2DMX A;  3MD0 A;  3TCU A;  3N2G A;  3GVM A;  4TSF G;  3MAQ A;  2WLK A;  4FMT A;  4O4L A;  5GW7 A;  3ZMT A;  1QBZ A;  4O4J B;  3CMA V;  3BA9 A;  5EBM C;  2Q7G A;  3ABM C;  4CBC A;  1EM1 A;  4ZKI A;  1Q8I A;  4JTC B;  1Q6H A;  4GUN A;  4X64 O;  3RYH B;  4UB6 Z;  2MW2 B;  5J2T A;  5BMV B;  3ZJZ A;  1A32 A;  1FD9 A;  2FYU H;  1I94 B;  4FLU A;  3D36 A;  1FJG B;  4DV3 B;  4LF8 B;  3G6E V;  2ETN A;  2QR4 A;  4X66 B;  1NVP D;  4JI6 O;  5HFM A;  3ABU A;  3W7W A;  4DV1 B;  4EKW A;  1N32 B;  4FLZ A;  3DTU B;  3LNM B;  4QGP A;  2WAM A;  1V54 C;  1KP3 A;  1RPO A;  3K03 A;  3L74 H;  1YVW A;  5D5P A;  2RJZ A;  1VQM V;  2OTJ V;  1I08 A;  1ZSP A;  2CAZ C;  4UCO A;  3X2Q B;  1QLE B;  4ZI7 A;  5C93 A;  4FLV A;  1T5E A;  3ZBH A;  5EYP B;  3IAY A;  1FXV A;  3CCE V;  4AQY O;  4YJ2 A;  4ZBM A;  3BEH A;  4BW9 A;  2DE0 X;  3VOU A;  1JR9 A;  4I7Z B;  5K1X A;  3K5M A;  1EBO A;  2A79 B;  1NZ6 A;  2GHY A;  1N32 O;  3F5T A;  5LOV A;  4JI1 B;  4LF7 O;  3ETG A;  1HDJ A;  2YI9 A;  5CA3 A;  5J2U B;  3WG7 B;  2HKO A;  2BTQ A;  3ZRX A;  2ATK C;  1KP2 A;  4RWU A;  4NR1 A;  4NTY A;  4KHP O;  3TGU H;  4LF7 B;  1QVG U;  3N2K A;  4U3F H;  2EIL C;  3A0H Z;  1BGY H;  4IYH A;  4DV7 O;  3S3W A;  2IW5 A;  2WLL B;  3JAT A;  2ZDI C;  4LFA O;  1XQ8 A;  3GB7 C;  1H2S B;  3DGE A;  1CPY A;  2LGQ A;  4DV2 B;  2RCV A;  1MZF A;  3MDS A;  3AG3 B;  3OR7 C;  2YIB D;  2WLL A;  1IXM A;  1TGO A;  2XAF A;  1K34 A;  1OJH A;  4O4I B;  1AIL A;  1P49 A;  3L9D A;  2P5O A;  3OGI B;  3A2F A;  1VIB A;  1XHZ A;  1GK9 A;  3FB6 C;  4L87 A;  4WFH A;  1MZE A;  2LW7 A;  1DF4 A;  1GO3 F;  4JI2 O;  2VQF O;  4NTX A;  5EZY B;  4D7S A;  1B06 A;  4LF6 B;  1EZV H;  1OCO B;  2NNU A;  2Q67 A;  3ZRV A;  3AG7 A;  5LGT A;  3SGI A;  1JCH A;  3MHH C;  1N0N A;  1LUV A;  2JIZ G;  1J5E B;  1KUQ A;  1OCO C;  1PL4 A;  2X6C A;  3IJ4 A;  2N05 A;  3T1Y O;  2ZIN A;  1YIT V;  1OV9 A;  2CK3 G;  1X4T A;  4J7J A;  4GX0 A;  3OMI B;  2Q0O C;  5H9C A;  1FPO A;  4D6T H;  4IHJ B;  2JS3 A;  2N04 A;  4RQE A;  2H8P C;  3HKD A;  1E1Q G;  1Q6U A;  1SQF A;  3JAR B;  4MS2 A;  3JD4 A;  4Z1M G;  2XUM A;  2AW9 A;  2GUZ A;  2BSK B;  1VQ8 V;  1D2D A;  1TA8 A;  3HKD B;  5BY1 A;  1MAB G;  5EBW C;  1XMQ O;  1FJG O;  3RVY A;  1K8A W;  1UFI A;  1HR0 O;  3Q4H B;  2QSA A;  3W7U A;  1NTM H;  4UUJ C;  1NVP B;  5KAI Z;  4W4K A;  4AQY B;  4OXS A;  4DV5 O;  2F43 G;  3G71 V;  4MW8 A;  1I5Y A;  1NR1 A;  1RSO B;  2ODM A;  3ABL C;  2HLD G;  2OIG A;  2ARH A;  5EK0 A;  1DLB A;  4JZG A;  1BT8 A;  3F5W C;  3HB3 B;  3WB1 A;  2NLJ C;  3J81 N;  3BFR A;  4LFC O;  4DRX A;  2VQE B;  5LMN O;  1ZL8 A;  1Y74 A;  2A3Q A;  4QE9 A;  1HP8 A;  3KG2 A;  4H37 A;  1XEQ A;  3QO5 A;  3CB2 A;  3SPJ A;  3OTF A;  1SQV H;  4FIP C;  4JAA A;  1IUR A;  3ABK C;  1P7B A;  5LP6 B;  2Y0P A;  5C8Y A;  4FK5 C;  3T1C A;  4R8C A;  1US6 A;  4JTD B;  5EC2 C;  4RUE A;  5HFL A;  1K5S A;  4X1I B;  4PA4 A;  1Y66 A;  1VF6 C;  1JJO A;  3HKE B;  2CTP A;  4O4I A;  1V55 B;  5BMV A;  4FPP A;  1ZLZ A;  2W0X A;  4K0K O;  4FFB A;  4FM1 A;  1URF A;  5CB4 B;  1MNG A;  4DUZ O;  2ZR3 A;  3SJQ C;  3OTO B;  1QR8 A;  1ZTE A;  2EJR A;  5CBF A;  3CP1 A;  3EXA A;  3FB5 C;  3JD1 A;  2A06 H;  5IT9 N;  2X0L A;  1IVS A;  3O65 A;  4D7T A;  4PV1 B;  1IBL B;  5KHG A;  2ZM6 O;  4IHJ A;  1N4C A;  4JTA B;  4X9Q A;  2OWO A;  3RFR A;  4RQF A;  1SQX H;  3RWR D;  4P9O A;  1GMG A;  2GBO A;  1MOF A;  4LFA B;  2QWN B;  1RFY A;  2G38 A;  3L70 H;  1ZWI C;  3UT5 A;  1ROP A;  4FLW A;  2UUB O;  4YY3 O;  4LF9 B;  1HNW B;  2PGG A;  4X8A A;  1BSM A;  4JI4 B;  1IZ3 A;  4TQF A;  1K33 A;  1PPJ H;  4IT5 A;  5J9P C;  4FFK A;  4JI3 O;  1IBK B;  3QG5 A;  3RW0 A;  4TV9 B;  3U0Z A;  1WA8 A;  4P9P A;  4OX9 O;  3A0B Z;  2Q68 A;  2B5U A;  5B1N A;  3CME V;  4WFA V;  2PI4 A;  2P4K A;  2UUC O;  2BOC C;  3K9A A;  4MTO A;  1KEC A;  4G28 B;  2YEV B;  1G6U A;  2Y0I A;  4FVM A;  5LA6 A;  3STL C;  5LHH A;  5B66 Z;  3LDC A;  1SQB H;  3ABT A;  2O57 A;  3AK1 A;  4I5S A;  3SPI A;  1J5E O;  2IJI A;  4I9Q A;  1ZL8 B;  2HP8 A;  1FYJ A;  4R50 A;  4DK0 A;  4OGQ B;  5BR8 O;  2KB1 A;  5LP6 A;  2XHB A;  2UXB O;  3ABK B;  4DYL A;  4HNA A;  4DW0 A;  4O4J A;  2IBZ H;  1XIL A;  2B1I A;  3RGB A;  3E89 A;  1LNQ A;  2EIN B;  1YXB A;  4JAS A;  1JOY A;  3I5D A;  2FML A;  4B3T O;  5EBL C;  1NJI W;  2R9I A;  3JAK A;  4E2L A;  4JZ2 A;  4CS2 A;  1XMO B;  5LHI A;  2IU3 A;  4CZZ A;  4JI7 B;  5CBG A;  2QJ1 A;  3STZ C;  3B8N A;  1PNL A;  1HNX B;  4NXN O;  4YJ2 B;  2IH3 C;  1G8M A;  2RNB A;  1YJN V;  3ZN1 A;  4PA3 A;  1XNQ B;  1SQG A;  5FNV A;  2CUG A;  2QTO A;  1XMQ B;  4FLX A;  2HG5 C;  1N36 O;  3CCQ V;  4LBE C;  5EIB D;  1JJ2 U;  3OM3 B;  2AZ0 A;  3C3T A;  4EB6 B;  1RSO A;  2OCC B;  2Q7H A;  1VAR A;  3FAV B;  2Z5U A;  3JAM N;  3RYF B;  3IGA C;  2ILM A;  3GWO A;  4X1K B;  3CCS V;  3ASN C;  1HNZ O;  2JGD A;  1H8H G;  2WLJ A;  3CXC U;  1FXH A;  1GH6 A;  2PYL A;  1JMK C;  3RYF A;  3FYI B;  1BS3 A;  1YZB A;  5IYZ A;  4W4L A;  2Q9L A;  3LNN A;  3GWK C;  4HZ3 A;  1AB3 A;  1WA8 B;  3HKC B;  1U96 A;  1QHT A;  4QPJ A;  5JCO C;  1KKC A;  2F66 C;  2ITD C;  5IYC O;  2UXC B;  3AEI A;  5IYZ B;  5GON B;  5CA0 B;  1BHA A;  2VQF B;  4B3R O;  4CC5 A;  3H1L H;  2ZE5 A;  4FM2 A;  1W2B U;  1QU7 A;  3SPH A;  4J80 A;  4TT3 G;  3OTO O;  4JAV A;  4UVA A;  1OCC B;  1SQP H;  3B4S A;  4BW5 A;  3CD6 V;  3TK1 A;  2HHH O;  3CCR V;  1K5Q A;  2K9P A;  3O9O A;  3A0R A;  4Q20 A;  4CS3 A;  2P90 A;  2XT9 A;  3ZN0 A;  5A9G A;  5KMG B;  4B7E A;  4LH6 A;  2WLI A;  1M4U A;  4PA7 A;  3JD2 A;  4LC1 A;  3WB2 A;  5BXZ A;  1GM7 A;  3SJC C;  2FL4 A;  4F4L A;  3RN4 A;  2PZS A;  4XDK A;  1BCC H;  2VWK A;  2VQE O;  4JI3 B;  1Z2G A;  3K9S A;  3VQY A;  4J10 A;  2DOS A;  3LDE A;  1JPX A;  1Q90 D;  4I50 B;  1TVK B;  3CS5 A;  1SA0 B;  2QDO A;  3WU2 Z;  3ZHV A;  4K8X A;  1HNX O;  4H13 B;  4ABM A;  2UUB B;  1HW7 A;  1WN7 A;  3OUS A;  1AP5 A;  2AHZ A;  3DSQ A;  3CRC A;  5D5Q A;  5IYD O;  1TUE B;  2OIE A;  3JAW B;  2BE3 A;  4KUM A;  5ITZ B;  1XRE A;  1L0N H;  4MTG A;  5JQG A;  4WCE V;  1K92 A;  4BWA A;  4UV9 A;  3CYO A;  4PDL A;  2CE4 A;  2FKX A;  2EIM B;  2HR3 A;  3UCS C;  4B3R B;  4OPA A;  3G80 A;  4ZIB A;  4XDL A;  1VQ9 V;  1Y74 B;  3ZHQ A;  2YEV A;  3ZRS A;  4XBF A;  1K3E A;  2LO1 A;  3K04 A;  1ZUQ A;  4X64 B;  1FAF A;  4GX2 A;  1CP9 A;  1PNK A;  2R70 A;  4KXR A;  1R3K C;  2XOK G;  1THZ A;  4WF9 V;  4DR6 B;  3HKE A;  2CGO A;  4J7Z A;  4DO2 A;  2W6J G;  1MA1 A;  4MVZ A;  2UXN A;  2ZXW C;  3AG2 B;  5KHI A;  4LWS B; 
#chains in the Genus database with same CATH homology
 2H94 A;  5EK0 A;  3W7S A;  1DLB A;  3SYC A;  5KUK A;  2WLN A;  3P32 A;  3F5W C;  2Y69 B;  4KP4 A;  1EFR G;  3M99 B;  2Q6A A;  3E2E A;  1AJN A;  3HB3 B;  1BHB A;  2NLJ C;  1FXK A;  3AG2 C;  1F4N A;  4JGS A;  3QNE A;  4QIW F;  1YTF B;  1R6N A;  4XDJ A;  4MVR A;  4QE7 A;  4RO2 A;  5LGU A;  1EZJ A;  2X6B A;  2HVK C;  2WSS G;  1F23 A;  3CC2 V;  1GTO A;  1OCR C;  2EIL B;  4G2K A;  4RAI A;  3ZMU A;  3I55 V;  4QE9 A;  3KG2 A;  4H37 A;  1RPR A;  2M7W A;  1NBM G;  2YSU B;  3QO5 A;  2IU0 A;  4BAY A;  1CEZ A;  3SPJ A;  3JD0 A;  4JAU A;  4FIP C;  4WFF A;  3OR6 C;  3ABK C;  1P7B A;  1OCC C;  1SZT A;  3HPL C;  1YHQ V;  2PI5 A;  4FK5 C;  2ZR2 A;  1FXK B;  3OUF A;  3T1C A;  4PA6 A;  4R8C A;  2Q69 A;  1BMF G;  4JTD B;  4RUE A;  5EC2 C;  5HFL A;  1FS0 G;  1P4R A;  2EIN C;  3AG3 C;  5IDJ A;  3CCL V;  1K5S A;  1Q7Y W;  1ARO P;  2IJJ A;  3K79 A;  1Y66 A;  4PA4 A;  1Q86 W;  3OGC C;  1YI2 V;  3AG4 B;  1V55 B;  4J9Y B;  4FPP A;  1Q81 W;  2DYR C;  2ITC C;  1E1R G;  5EC1 C;  3E8F A;  4QPK A;  3ZMS A;  1RM1 B;  1HWY A;  1WPX A;  4ASU G;  2ZR3 A;  1Q82 W;  2D3O W;  1VQK V;  5DM6 V;  3SJQ C;  5BZB A;  3FKS G;  3TET A;  1QR8 A;  2EJR A;  2DYR B;  3SPG A;  1JVM A;  5CBF A;  4RUF A;  3LDD A;  4MVO A;  1K73 W;  2DYS C;  1K4D C;  3CP1 A;  2QA4 V;  4R7C A;  1QCE A;  1NH2 B;  1OCZ B;  1R73 A;  3FB5 C;  4MVS A;  3JD1 A;  4JYC A;  3OFN G;  2WLM A;  5L3D A;  3F7Y C;  1NH2 D;  2LFR A;  2X0L A;  2XAH A;  1VQ7 V;  1M9N A;  3P30 A;  1M57 C;  1FFT B;  1OCZ C;  4PA9 A;  3ETD A;  4MW3 A;  4JTA B;  2QKS A;  3T4Z A;  1UJW B;  1AI7 A;  1OZ0 A;  1F51 A;  4UVC A;  1VQN V;  3T4D A;  4RQF A;  2JJ1 G;  1V54 B;  4JYB A;  3RBZ A;  5LGN A;  4P9O A;  4WFG A;  1SER A;  1GMG A;  1MOF A;  3G4S V;  3LSS A;  5E1A C;  3E35 A;  2W0F C;  1H2G A;  3OEE G;  1ZWI C;  1KC8 W;  1KKD A;  4GX1 A;  1AI5 A;  2XND G;  1ROP A;  3CCV V;  1QLE C;  3BY6 A;  2DWE C;  1M90 W;  4P2Z A;  1QVF U;  4X8A A;  4JPR A;  1M56 B;  1R3L C;  1K33 A;  2EZO A;  5J9P C;  3PJS K;  4BIU A;  5B1A C;  1F4M A;  1I5X A;  3E8G A;  3FYE B;  1JX9 A;  1W0J G;  2JDI G;  4G27 B;  4MVM A;  4BIZ A;  3R65 A;  1NQT A;  3RW0 A;  4P9P A;  2JEU A;  3SYQ A;  1PNM A;  2Q68 A;  5IYB O;  2B5U A;  3VBB A;  2HFE C;  4GT1 A;  4MTF A;  5B1N A;  3IFX A;  3CME V;  4WFA V;  2PI4 A;  3OMN B;  2BOC C;  3K9A A;  4TWK A;  1SRY A;  5B1A B;  2X6A A;  4MTO A;  1W0K G;  4UVB A;  2EIK B;  1KEC A;  4G28 B;  2YEV B;  3EFF K;  3JCZ A;  5B1B B;  2Z3Y A;  4YXW G;  3STL C;  2Y69 C;  5LHH A;  2HJF C;  3SYP A;  3LDC A;  3ABT A;  2X7R B;  3ML0 A;  3ZMV A;  2W6I G;  1AJP A;  2JJ2 G;  4I5S A;  2EIK C;  3SPI A;  3CPW U;  2IJI A;  1YJW V;  5CMU A;  1VQ4 V;  5B1B C;  1MSW D;  5H6Q A;  1OCR B;  2XAQ A;  4R50 A;  2P7T C;  1R6K A;  2XAJ A;  4X88 A;  3CC7 V;  5H6R A;  2KB1 A;  4MVQ A;  3WFV A;  2K1E A;  3EHB B;  2IH1 C;  3ABK B;  4PDR A;  5B3S C;  1YIJ V;  5IY5 C;  2V1D A;  4MSW C;  1FXK C;  1ENV A;  3NXS A;  3ZMZ A;  5B1O A;  1YSC A;  2P67 A;  1Y4M A;  2B1I A;  3E89 A;  2WWW A;  1KQS U;  1LNQ A;  4DXW A;  1R3J C;  2EIN B;  3CC4 V;  2WPD G;  5LBQ A;  3K08 A;  5B3S B;  2EBO A;  3E83 A;  2OT5 A;  3FB8 C;  4JAS A;  4QJF B;  3AG4 C;  4P30 A;  1JOY A;  3MD0 A;  3TCU A;  4TSF G;  2Y48 A;  5EBL C;  1NJI W;  2WLK A;  1H8E G;  2R9I A;  4FMT A;  1RM1 C;  1GM8 A;  4E2L A;  1ORQ C;  2UXX A;  5LHI A;  5GW7 A;  3ZMT A;  1PD3 A;  1QBZ A;  1VQ5 V;  3CMA V;  2IU3 A;  4U7O A;  5EBM C;  4CZZ A;  3D3I A;  1VQL V;  1NKD A;  4PDM A;  1L1F A;  2QM7 A;  5CBG A;  1S0V A;  2P6J A;  5L3C A;  3STZ C;  3B8N A;  3OW2 U;  1PNL A;  2JK5 C;  3ABM C;  5KUM A;  1YTF D;  2IH3 C;  4CBC A;  1G8M A;  4ZKI A;  3LUT B;  1E79 G;  1VQP V;  4MTX A;  4WFE A;  2GSM B;  1YJN V;  3ZN1 A;  4PA3 A;  4PDV A;  4JTC B;  1R3I C;  1MG1 A;  1S3J A;  2JEX A;  5CBH A;  2IJK A;  2QTO A;  3ABM B;  3ZJZ A;  2HG5 C;  1M57 B;  2ZDI A;  3CCQ V;  1PL0 A;  4LBE C;  4MVU A;  3JD3 A;  3D36 A;  1JJ2 U;  3OM3 B;  5KA5 A;  2EIM C;  3ASN B;  3G6E V;  2OCC B;  1NVP D;  2DQ3 A;  4QNH B;  5FL7 G;  5HFM A;  4J9Z B;  2V7Q G;  2Z5U A;  3ABU A;  3W7W A;  4EKW A;  3F7V C;  3FB7 C;  4U7N A;  3DTU B;  3LNM B;  3IGA C;  3GWO A;  3CCS V;  2WAM A;  1DTO A;  1KP3 A;  1V54 C;  1SET A;  1RPO A;  3ASN C;  3K03 A;  1COW G;  2DQ0 A;  1H8H G;  3RVZ A;  3QO7 A;  2WLJ A;  1VQM V;  3CXC U;  2OTJ V;  3ZCC A;  1QLN A;  1FXH A;  2XAG A;  4HYO A;  3K0G A;  3FYI B;  3X2Q B;  2R9R B;  5DN6 G;  1QLE B;  1BL8 A;  1JQ0 A;  2WLI B;  5C93 A;  1M1K W;  2QEX V;  1M56 C;  3ZRW A;  1J95 A;  5L3B A;  3H01 A;  1FXV A;  3CCE V;  1S72 V;  3WG7 C;  5L3G A;  4HZ3 A;  1KD1 W;  1N8R W;  4ZBM A;  4QPJ A;  3BEH A;  3VOU A;  2ITD C;  5IYC O;  1PKX A;  1EBO A;  1G4Y B;  2A79 B;  2GHY A;  2QE7 G;  3AEI A;  3E8H A;  3K0D A;  3QO8 A;  2A0L A;  3ETG A;  5CA3 A;  3ZIA G;  3ASO B;  4GCZ A;  3WG7 B;  1BHA A;  2HKO A;  3ZRX A;  2ATK C;  3E86 A;  1KP2 A;  1NR7 A;  4X89 A;  1AJQ A;  1QVG U;  2EIL C;  1W2B U;  3SPH A;  3ASO C;  3K06 A;  4MT8 A;  4TT3 G;  1VQO V;  2HVJ C;  1GM9 A;  2IW5 A;  2WLL B;  2ZDI C;  4JAV A;  4UVA A;  1VQ6 V;  1OCC B;  4BW5 A;  1AR1 B;  1S5H C;  2B1G A;  3CD6 V;  3TK1 A;  3CCJ V;  3CCR V;  3AG1 B;  1K5Q A;  3GB7 C;  4UXN A;  3DGE A;  3A0R A;  4Q20 A;  1CPY A;  2P90 A;  4I9W A;  4LCU C;  4N23 A;  3K3W A;  3ZN0 A;  2MK3 A;  3AG3 B;  2QM8 A;  3OR7 C;  2WLI A;  4PA7 A;  3I56 V;  2WLL A;  3JD2 A;  1IXM A;  4LC1 A;  1YJ9 V;  3AG1 C;  2AHY A;  2XAF A;  1K34 A;  1V55 C;  1GM7 A;  4LP8 A;  4N21 A;  3UKM A;  5LHG A;  4F4L A;  2LFS A;  4KFM A;  4XDK A;  4UV8 A;  1S76 D;  2DWD C;  1H38 A;  1GK9 A;  3FB6 C;  4L87 A;  4WFH A;  3W7X A;  2ZQM A;  5KA6 A;  1DF4 A;  1GO3 F;  4H33 A;  1OCO B;  2DYS B;  2NNU A;  2Q67 A;  3LDE A;  1JPX A;  2EIJ C;  3ZRV A;  4HAM A;  5LGT A;  1JCH A;  1XL4 A;  3MHH C;  3CCM V;  5L3E A;  2JIZ G;  1SES A;  3SYO A;  3OUS A;  2AHZ A;  3JYC A;  1OCO C;  2X6C A;  2EIJ B;  1K97 A;  3OAA G;  3IC7 A;  1YIT V;  3UM7 A;  2CK3 G;  5IYD O;  1TUE B;  3W7T A;  2EZP A;  1AI4 A;  4GX0 A;  2OTL V;  3OMI B;  5H9C A;  5CN0 A;  1WLE A;  4KUM A;  4MTG A;  2A9H A;  4WCE V;  2XAS A;  1K92 A;  2BOB C;  4WFB V;  4UV9 A;  3CYO A;  4PDL A;  1AI6 A;  3SYA A;  2EIM B;  4RQE A;  2HR3 A;  3MHS C;  2OCC C;  2H8P C;  3B8M A;  1E1Q G;  4XDL A;  1VQ9 V;  1B6Q A;  3ETE A;  3OE7 G;  2WLH A;  2YEV A;  4PEL A;  4MS2 A;  3JD4 A;  4Z1M G;  1K4C C;  1OHH G;  2IJH A;  3ZRS A;  4XBF A;  1VQ8 V;  3E8B A;  1K3E A;  3LSQ A;  2LP7 A;  3K04 A;  3B77 A;  3OEH G;  4JF3 A;  1XL6 A;  4R6Z A;  2FTK A;  5L3F A;  1MAB G;  2ZXW B;  2ZD9 A;  3OMA B;  4GX2 A;  5EBW C;  4GX5 A;  1CP9 A;  1PNK A;  3RVY A;  1DF5 A;  1K8A W;  3ABL B;  3X2Q C;  5IY5 B;  3W7U A;  4FJC C;  1R3K C;  3CCU V;  2XOK G;  1THZ A;  4UUJ C;  3T2M A;  3ZRW B;  4WF9 V;  1NVP B;  2C2A A;  4OXS A;  2F43 G;  3G71 V;  1K9M W;  1S77 D;  4DO2 A;  2W6J G;  4MW8 A;  4MVZ A;  1K7D A;  1I5Y A;  2UXN A;  2ZXW C;  1NR1 A;  1GKF A;  3SPC A;  3AG2 B;  1QR9 A;  2DW4 A;  3ABL C;  2HLD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...