1VQNV

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqnV00
3CMAV 1VQOV 1VQ6V 3G4SV 1VQ5V 3CCSV 1W2BU 3G6EV 3CPWU 3CCVV 1K73W 4WFBV 3I56V 1YHQV 2QA4V 1K9MW 1YJ9V 1QVGU 4WFAV 1JJ2U 3G71V 3CCRV 1YIJV 1YITV 1NJIW 1KD1W 1VQ4V 1VQLV 3CCEV 3CC2V 3CD6V 1YJWV 3CCMV 2D3OW 1Q86W 1M90W 3CXCU 4WF9V 1VQKV 1QVFU 1K8AW 2QEXV 1KC8W 3CMEV 1S72V 3OW2U 3CCUV 3CCJV 1Q7YW 1R73A 1VQ8V 1VQNV 2OTJV 1N8RW 4WCEV 3CC7V 1YJNV 3CC4V 3I55V 2OTLV 3CCQV 1VQ9V 1VQMV 1YI2V 1VQPV 1Q81W 1KQSU 1Q82W 3CCLV 1M1KW 1VQ7V 5DM6V
chains in the Genus database with same CATH superfamily
4R6ZA 1BQZA 2W6IG 2IH3C 4JPRA 3U11A 3ETQA 3EVKA 3L72H 5KHGA 5E79Z 3ABLC 4BIUA 4DXWA 4X62B 2XOKG 4MW3A 1GRJA 4IGGA 3ASNB 3APOA 2HKOA 2QKSA 5CBGA 1JR9A 1S5HC 1WAZA 2KKWA 1K3EA 1Q5OA 1K73W 3LUTB 4X1YB 3ASOC 2ZE5A 4MVRA 2CTQA 3BA8A 3K9AA 5JCOA 1ORQC 3R66A 3ZN0A 3ZRVA 4B3SB 3K08A 3J80N 4DR6O 2LQTA 1R73A 1S5JA 3N27A 1RM1B 1WPBA 1N33O 1EBOA 1PL0A 4BW5A 5FNVA 2P7TC 2ZIMA 2FB5A 1FFXA 1JVMA 2AZ2A 2F1MA 5H2FZ 4UB6Z 3CC2V 4GKJO 1EN6A 3ZIAG 2CTPA 3OR7C 3OEHG 4JI5O 4XDJA 3H9VA 3OMNB 1MZFA 5FL7G 3SPIA 4JI2B 3K5LA 1Q82W 1JOYA 4NYKA 1H2SB 4PD4F 4J80A 4LH7A 4NXNO 4DR3O 1U96A 1KKDA 1M90W 2ADQB 3T2MA 3ZRWB 4EB6A 3LSSA 3RYCA 1AR4A 1H8HG 4O4JA 4DV7O 3FB7C 3ZX6A 5L3DA 2XASA 5CBFA 1QNMA 1R3KC 3RFRA 1BSMA 1KD1W 1N0JA 3A0HZ 4KHPB 3OEEG 3UO3A 3J81N 3QO5A 4YY3B 2PUSA 1V55C 1OJHA 1JX9A 4GT1A 4TSFG 4JZGA 1AI7A 5IT9N 3ABTA 1KQSU 3T4DA 2L35A 2W0FC 5LYJA 3E22B 1LUWA 2QJ1A 4ZI7A 1NTKH 4PA9A 1YITV 1AR1B 3K58A 3CCEV 4Q6GA 2GDSA 3JAWA 1OCZC 1K92A 2ZNJA 4BR6A 3I55V 4JI6O 3CRAA 2DYSC 3BA9A 2YIDA 3SJQC 4DV6O 2X0LA 1UPGA 2IJKA 5K1XA 4RQEA 1HNWO 4G27B 4LF9O 3SPCA 1HWYA 1ROPA 1OCRC 2E74B 4ZOLA 2P22C 1ENVA 5AG2A 4NR1A 4ZHQB 4B08A 1DK1A 4UXNA 4G2KA 5CN0A 5CBHA 3WG7C 1ZL8B 3H1HH 4PHZA 2PYLA 4TQFA 5LA6B 1MSDA 2ZNIA 3SYAA 1YCIA 1FXKA 4H13B 5J2TA 5CA1A 2HJFC 1F4MA 3RBZA 3G80A 5EBMC 2Q73A 3AG2C 3T1YB 1FXKB 5J9PC 1TUEB 1WNSA 1R6KA 3WG7B 1XUQA 2Q68A 1FFXB 1O9HA 2ZXWC 2UXCB 1QLNA 2RN9A 4LFAO 2E3CA 2EULA 4YHHB 4DW0A 1H8EG 4QIWF 4I9QA 2YS8A 2QTOA 1K33A 1CP9A 1M4UA 5CMUA 4I4TB 1NBMG 4GX0A 5H6QA 4WFFA 1HNZB 3VQWA 1PP9H 5IE9A 2JS5A 3AG7A 3HKCB 3Q4HB 1AR5A 2BOBC 1W0KG 3STZC 1DF5A 1GM9A 4NXMO 1F23A 3CCVV 4RUEA 1R6TA 5LMUO 3JCUZ 4I55A 1S0VA 3D8CA 3AG4B 1Q86W 1QVFU 4LFCO 1YXBA 3UM7A 3AG1B 1MG1A 3W7WA 1G4YB 4IIJA 4J11A 3H01A 1HNWB 3D36C 2OTJV 3HKEA 3P3NA 5J2UA 2RDCA 1AI4A 2FL4A 2Q7HA 3JASB 3OTOO 4DR3B 3F5WC 5DECA 3CRCA 1UFIA 3ABKC 4WFHA 2UU9B 2ILMA 1Q6HA 4FLVA 3ZRXA 1AROP 5IYZB 2AGAA 2Q8VA 4JTAB 4LCUC 5BR8B 3B8MA 3AK1A 4TV9A 1QU7A 4X1KA 1IBLO 4NXMB 4P9OA 4TV9B 1OZ0A 4DV1B 3RVZA 4K3AA 2YIAA 4FMTA 5F2VO 1M57B 1BHBA 2EIJB 2UXDO 2ZR2A 3AK2A 1TA8A 2BOCC 3CB2A 1R3IC 3TXSA 4DV5B 3BPZA 5B1BC 1KMIZ 5LHGA 3LSUA 1THZA 2LW7A 4TT3G 5LHIA 4YXWG 5ITZA 1Z2GA 3ML0A 3KCXA 1N36B 4DR1B 1XOUA 5D5QA 3HKDB 4MTFA 3CPWU 4JGSA 4DV0O 5CA0A 4H33A 1R3JC 5FPRA 1RSOA 2EIMC 1Z5VA 1BT8A 1ZL8A 4PELA 1Y76A 4PDMA 1Y76B 2KG7B 4LF4O 5J2TB 5DM6V 1WPXA 2QTSA 4EEQA 2OIEA 2PF4E 4I7ZB 2G38A 3K5NA 1IBKB 2MK3A 4JYCA 1ZSPA 4MVQA 2HG5C 4DUYO 3ASNC 3JALA 1PNKA 3WB2A 1P4RA 2EJRA 5IJ9A 1OHHG 5LBQA 3JATB 3SPHA 3G4SV 2IU0A 2ZR3A 3JAKB 1MZEA 4TQDA 1M57C 1OCCC 1YIJV 2EJ7A 4EFEA 4OPHA 1GO3F 2JGUA 2YXYA 5JCOC 4FFBA 4LC1A 3CP1A 3CRQA 2E75B 3B77A 3JD1A 4FZ0A 2PY5A 4K0KO 1K7DA 5KLVH 1Y67A 4I0XB 2LP7A 4HNAA 3R65A 2A79B 3E8HA 5IWAO 2EINB 4GKJB 3M8AA 4PA6A 2Q4PA 4HNAB 4FVMA 5KAIZ 4B3MO 2EZPA 4IHJA 3FYIB 5DN6G 2Y0IA 1BS3A 2GUZB 4X20B 1CPYA 4JI2O 5H6RA 1Q81W 2Z3YA 5LL6Y 1JA8A 1SRYA 3I56V 4XDKA 4NTXA 3JD4A 3G71V 1PNMA 3W7TA 2HLDG 4XBFA 4FFKA 2P90A 1EN4A 3B8NA 5LP6C 2P4KA 3OT7A 1I94B 3W7SA 1XHZA 3E2EA 5EIBD 5IY5B 1PKXA 1RPOA 2E76B 1BZKA 2CAZC 4KL1A 4BAYA 3W7XA 2F23A 2CTWA 3K3WA 2ZXWB 1SQGA 2DYRC 2UU9O 1Y74B 5L3EA 3HR0A 2DYRB 3W7UA 1FPOA 1SESA 1K97A 4FIPC 2XTAA 4JI3B 4JI8O 3IFXA 5KX5A 3EHBB 1N34B 4J7ZA 2JVDA 3CC4V 3RYFA 2LGWA 4ZI7B 3OFNG 2ITDC 1Y4MA 2YC0A 3CMAV 1VQOV 2K9PA 3D3QA 3HPLC 4JI5B 4K0KB 4UCVA 3SJBC 4LF7O 1M5IA 5KHIA 4LF4B 4I50B 3JD2A 3S3XA 4AI8A 2Q5ZA 2IW5A 3OTFA 3THOA 2IJIA 2RQ6A 5LP6B 2QWQB 4UB8Z 1YTFD 4FM0A 3CX5F 3JD0A 1IBMB 3J7AU 1Q6IA 2AW9A 4B7KA 2WLLB 1P7GA 1LNQA 2HHHB 2M6YA 4MVOA 4DR7O 3RVYA 1QR9A 2D2CB 1IBLB 2AZ0A 2WLIA 3ZRSA 1V55B 4JI4B 3T1HO 2X6CA 4DUZB 1PPJH 4CZZA 4DR6B 2XUMA 1MSWD 4LNUB 4LF5O 4F6EA 1G6UA 4JZ2A 4DW1A 4X9QA 5JQGB 1VQ9V 2VQFO 1PM9A 1VIBA 3QO8A 4H0LB 1YF2A 2H94A 3U10A 2UXDB 2UXBO 1DGSA 1FAFA 3MHHC 4BWAA 4R50A 2HR3A 1XEQA 4TUYA 2F93B 1WB8A 1WJZA 2YI9A 4KUMA 3ZMZA 4DV1O 1PL4A 3H1KH 1MMMA 4IYIA 3T4ZA 3N2GB 1IVSA 1HR0B 3F5TA 2KQXA 1K5QA 5KHHA 5JJNB 3ZHSA 4Z1MG 5LGUA 1M56C 5HFLA 1IXBA 2YIBD 4HZ3A 2W0XA 5EZYA 3VOUA 5LMUB 5KUMA 1K4DC 2JGDA 3QG5A 4MVZA 4K8ZA 2DWDC 4B3MB 4A5UB 1FJGO 1H38A 2VQEO 2F66C 1SA0B 1HNXO 4B3RO 4PDVA 4MTGA 4RAIA 1FFTB 4JF3A 4LF8O 2GV9A 4L8JA 4ASUG 5EK0A 5C8YA 1I0HA 5EBWC 2A7WA 1YJWV 1TAEA 3EXAA 4R8CA 4LF6O 2YEVB 4X64B 3ZHUA 5KHKA 2V4DA 1OCZB 5L3GA 4DUYB 5IJ0B 3IC7A 1AI6A 3E86A 4DR5O 1GN2A 1Z5WA 3AG3B 4JI0B 3CSXA 4OPAA 1L0NH 4YHHO 1XBLA 2Y69C 4MVMA 1VQ5V 4C7UA 3DSQA 2QKCA 4RQFA 1MABG 4PA3A 4I5SA 4I4TA 3ICXA 3HKEB 2LFRA 3JARA 2ZQMA 1F7YA 4TV8B 5GTIZ 2Z0AA 1K8AW 5D5PA 4UCSA 4UCRA 3FB8C 1XNQO 3A8TA 3JCZA 1NR1A 3DC6A 4UFZA 3E22A 4JI1O 3A0BZ 3FYEB 5CA3A 2F4VB 3JAMN 4O2AB 4JTDB 3JYCA 3QNEA 4O2BA 2N05A 3B40A 3N2KA 5E1AC 3CEIA 3HB3B 4AQYB 3MHSC 5IYBO 2M7WA 4DV2B 4YIOA 4ZIBA 3CCJV 4JI8B 4FLYA 2IM9A 2PTMA 1VF5B 5CB4B 1VQPV 5EC2C 1L1FA 2BSKA 1EZJA 4GYCB 2QWOB 1YHQV 2E5LO 1JCHA 2QKAA 4B7EA 2A3QA 4LF9B 4J42A 4LF7B 3FFQA 2NR5A 2QEXV 2PI4A 1NTZH 3L9DA 2WPDG 1Q3EA 4GX5A 3OR6C 4ZHQA 4TWKA 3SDLA 2YUAA 2LW1A 4J7KA 3E89A 1KECA 2BTQA 2VRZA 3APQA 1P7BA 2Q67A 3VQXA 5LA6A 2LJ2A 1NH2D 1OCRB 4PV1B 1KP3A 2JDIG 2A06H 4DR2O 4JAUA 3CMEV 4DV2O 5EC1C 2XAGA 2IH1C 2WA4A 5B3SC 1AVMA 3SYQA 4FLUA 3PN1A 3ASOB 5LGTA 4UVCA 1D2DA 2VWKA 2AHZA 4CH5A 1SF9A 1RSOB 4DV4O 1I5YA 1N34O 1VF6A 2XNDG 3KCYA 4BIZA 4U3FH 4DV5O 4MSWC 4DV7B 5DEDA 4DR7B 2ZDIA 3FB5C 4BW9A 3L70H 1GN4A 3H1IH 4WFAV 2DOSA 3AG3C 3MDSA 3WFVA 1URFA 2RJZA 3CYOA 3BAAA 2Q0OC 4B3TB 1XHXA 2YEVA 5C93A 1MNGA 2P6JA 1V54C 3JALB 1DF4A 5JH7A 4FLTA 1G1XB 4X66B 3RYCB 1COWG 2HFEC 4O4JB 1SQXH 4GKKO 2QWRB 1RP3B 4QNHB 1JJ2U 2UXXA 2ADPA 2A9HA 1W59A 2NLJC 2DQ0A 4TV8A 4PI2A 4J7JA 1R6NA 3OE7G 3K06A 3CWBH 3CJHB 4JI6B 2YDEA 1OCCB 1XMOO 3CJHA 1SZTA 2YXLA 3ZMVA 4RUFA 1XL6A 2DYSB 1LR1A 2CH7A 5B66Z 3BFRA 4O2BB 1XI1A 3M7MX 4I55B 2N04A 1S72V 2ZIOA 1HNXB 4B3RB 5JVDB 1VMGA 1A32A 4I9WA 1NT2B 2P67A 3STLC 1ZX3A 1Y66A 1VQ7V 4DV6B 5B1AB 3JASA 2Y69B 2EIKC 4OX9B 3O9OA 3ETGA 3TETA 2X6BA 1GH6A 4WFEA 3CD6V 1GN3A 4G28B 4OX9O 2ARHA 1JQ0A 2JEUA 4JYAO 4DR4O 1Y6XA 3G67A 1HR0O 3CCQV 4JYYA 4FLZA 2ZD9A 3OUSA 4UUJC 3RYHB 4JV5B 5LXTA 4DYLA 3OGCC 2XAQA 3K03A 3CCRV 1YEWA 1IXMA 2WWWA 4JAAA 4JASA 3CCMV 4X1YA 2FMLA 3SJCC 2PI5A 2KG7A 3OW2U 1B3QA 1SETA 1S76D 4FM2A 3B4SA 2P06A 4Q20A 1YVWA 4ABMA 2CGOA 3FAVB 3GB7C 1M56B 1NQTA 3BEHA 1W2BU 4H37A 3HKDA 4GX1A 5LGNA 4OGQB 1GTOA 3LDDA 1M93A 2L6LA 2DQ3A 1N4CA 2JIZG 1JFFA 1YZBA 4UCOA 4JI0O 2QE7G 2VQEB 1XNRB 1JFFB 2Z5UA 1VQ6V 5K1PA 3P30A 3TK1A 3ABKB 3P3PA 3K0DA 1QVGU 2FYUH 3ZBHA 1WN7A 1DTOA 1AJNA 3TGUH 3UCSC 3ZMUA 5KUKA 2ATKC 4X1IB 1KC8W 1TGOA 3SJAC 1I08A 4N23A 4K8XA 4I50A 3CCUV 3K9SA 1Q43A 1ZUQA 3AG4C 3ZRWA 5KAFZ 3M99B 4YJ2B 2NN4A 4O4LB 1NU1H 2EX3A 4PA7A 1GN6A 3JAKA 1AI5A 4O4LA 3T1CA 1PD3A 2CTRA 2WA3A 1H2NA 4X20A 2D3OW 4PDRA 3SPJA 2QDOA 2ZE8A 4CH6A 2OT5A 1BHAA 2UXCO 1J5EB 3GWKC 3RN4A 1SQBH 4IIJB 1N36O 1J95A 1KB9F 4LF8B 4X89A 3QTCA 5B5EZ 3UQ8A 4X65O 2ZM6O 4TOIA 5L3BA 5FNVB 2ODMA 3KZIZ 4IHJB 4DR5B 3S3WA 4PJ0Z 3ETDA 1VQMV 2EINC 2WAMA 4NXNB 3HKBA 4FJCC 4LFAB 2KSDA 1LUVA 1XMOB 3DGEA 2MW2B 1IBKO 3CRRA 2VWJA 1SC5B 1R1BA 2DN9A 5A2QN 1GKFA 2CE4A 4DV4B 1S3JA 3PJSK 1KYOF 4FLXA 3ABUA 3TCUA 4JI7B 3L74H 1D5AA 2B1GA 3JARB 4ZOLB 2Y4TA 1EN5A 5GW7A 1XQ8A 2ETNA 2JEXA 2WSSG 1ZLZA 3ABMC 1QLEC 2GSMB 2PYJA 3CC7V 4JI4O 2XT9A 3F7YC 5JJJB 2O57A 2FTKA 2P4VA 2WLJA 5IY5C 2HVJC 1IURA 3L75H 2UUAB 4CC5A 3P32A 4FM1A 1Y74A 2RNBA 3G6BA 3K0GA 1Q6UA 3IC9A 3CXCU 5L3FA 2UXBB 1EFRG 3B2EE 5CB4A 4IL6Z 4O4IB 4E4EA 1WLEA 4U3JB 2QWPB 1EM1A 4DV3O 4P30A 2OTLV 4YIPA 2UUCO 1M1KW 2R9RB 3RYFB 1SZXA 1NVPD 2P5OA 4MTOA 1CEZA 3K04A 5IYZA 1NKDA 4PI0A 1XL4A 1QCEA 5EBLC 3SYCA 4QE7A 2Q7EA 2K1EA 2QM7A 2AHYA 2R9IA 4LWSB 2QGNA 3VQYA 3ZMSA 2OCHA 2QM4A 2F43G 2EBOA 2ZE6A 4UCTA 5LMNO 5FLXN 5B1BB 3OM3B 4DK1A 1JMKC 4LBEC 3RW0A 1NH2B 2Q9LA 4GKKB 2EILC 1VF7A 3RYIA 2RCVA 2QA4V 4LFCB 2CUGA 5L3CA 2XAHA 4XDLA 5LOVB 1N32B 4DR2B 2GTAA 5LOVA 3T1YO 3K5OA 5IDJA 1YI2V 5CA0B 3FB6C 2GTSA 3ZS8C 1RFYA 1L8DA 2FKXA 2B9ZA 1HP8A 2N74A 4MS2A 4PDLA 1VQ4V 1WP7A 1BQ0A 1H2GA 3RT3C 2C2AA 4JAVA 5IWAB 1BE3H 1QBZA 1FJGB 1IBMO 5FPOA 1SERA 4KHPO 2LGQA 1WA8A 2VQFB 1SQFA 4KXRA 4LFBO 1QR8A 3OMIB 2WLNA 2ZE7A 3HKBB 1NJIW 4NTWA 2QWNB 3QVNA 3JSNA 2R70A 1RM1C 4W4LA 4WF9V 5IJ9B 1H2KA 1DLBA 2XAJA 1B06A 1QQCA 3FD9A 1Q7YW 4AQYO 3OTOB 3ETEA 3LDCA 2EIMB 1NZ6A 3C3TA 3CE2A 3JSLA 1KBHA 3ZJZA 4GUNA 2XHBA 2CGNA 5B1AC 3H1JH 4B3SO 2HJDA 4JI3O 2Q7GA 3CXHF 1D5NA 5JWPA 5C8YB 4NVPA 3SYOA 4HAMA 1KUQA 2W6JG 4NKGB 2ITCC 5JJEB 1NS1A 1US6A 4Z2WA 5LYJB 4AILC 2YXHA 3OMAB 3VBBA 2WLKA 1L0LH 2EIJC 3D3IA 2PZSA 4X65B 1SQPH 5BMVB 1S77D 3DXRA 2R72A 1TUBA 4UV9A 4W4KA 4GCZA 3X2QC 1VQNV 4KFMA 1TUBB 2Q69A 1NTMH 2LFSA 3SGIA 3ZN1A 4WFGA 5LP6A 4JYBA 3FX7A 1AILA 3L73H 3JATA 3TXQA 1HNZO 3ZCCA 1V54B 3LSQA 5GTHZ 4DO2A 3K59A 2OWOA 4CS4A 2UUAO 2DE0X 3N2KB 5KA5A 3RYHA 1MOFA 4IYHA 4JI7O 3IGAC 1PNLA 4D7SA 2Q0AA 2IJJA 1I5XA 4LNUA 3U0ZA 3CCLV 5JVDA 4FFBB 2YICA 3K5MA 4X8AA 1KP2A 3JD3A 1YTFB 1AP6A 4EKWA 4CH3A 1K5SA 1FS0G 3FAVA 2YIBA 1ZWIC 1AB3A 4OXSA 5GONA 4DR4B 1IDSA 3BY6A 4FK5C 3N2GA 2HHHO 1CXZB 4N21A 5KX5B 2WLMA 4ICGA 5LXTB 4FLWA 3ZHQA 1UJWB 1B04A 2OCCC 4UCUA 4U7NA 1SKVA 5BR8O 4DUZO 1GAXA 2IU3A 1QHTA 5KA6A 2JGDB 1GK9A 1YSCA 1V9PA 1XMQB 2EILB 1FKAO 4GLXA 4CH4A 2WLHA 1FXKC 3IAYA 4EB6B 2RMKB 1I94O 3HKCA 1GMGA 4O4HA 5EIBC 1U97A 1AJPA 5JH7B 5EYPA 3AG1C 1F4NA 4YJ2A 2JJ1G 2ZCEA 5EYPB 3LNNA 1OCOB 4QJFB 1AJQA 2BE3A 5H9CA 5IJ0A 2Y4UA 3OAAG 2AXTZ 2WLIB 4DV0B 4BIOA 2H3OA 2UXNA 3C90A 5KHJA 4MT8A 3WB1A 4K35A 1VQKV 3CS5A 1E1RG 4D7TA 2Q6AA 1KU9A 5BZBA 4KP4A 1XNRO 5LMNB 2X7RB 3Q4HA 4YJ3A 4YJ3B 4TUYB 3LNMB 1YJ9V 3KKYA 3TJTA 1GM7A 1YDXA 5A9GA 4LP8A 1WP8A 3AK3A 1BGYH 1QLEB 2V1DA 5BMVA 4X1KB 2H8PC 3DXRB 4L87A 3GWOA 2UUCB 3KG2A 3IJ4A 1H2LA 4JI1B 4GZRB 2CDYA 2JRIA 1J5EO 5EZYB 1XILA 2F4VO 2ZKOA 4MTXA 4J9ZB 4NTYA 2WLLA 2F95B 3AG2B 3UKMA 3RWRD 5H5NA 2CH7B 3X2QB 4P2ZA 1SA0A 4JV5O 4MVUA 4X66O 3OGIB 1VF6C 2B5UA 3JAWB 4CC6A 1FYJA 1HW7A 1N33B 3A2FA 1VP7A 4HBNA 1XMQO 1K9MW 3E35A 3VQVA 2YSUB 2ZDIC 1FD9A 3GVMA 3NR7A 2BTQB 1SQVH 1TVKB 1VQLV 2ZINA 3A0RA 4F6RA 1KKCA 1ZAUA 1TVKA 5CA1B 4LF6B 1YJNV 4QE9A 3DC5A 1K34A 2JS3A 4ZBMA 4Z1VA 5HFMA 5GONB 4WFBV 3QF7A 1NI8A 4DR1O 3QO7A 1NVPB 1H2MA 4U3JA 3I5DA 3C3SA 2OYQA 4LF5B 4FZ1A 2A0LA 2GBOA 3MAQA 4F4LA 4LFBB 4O2AA 2QM8A 4MW8A 1B6QA 1OV9A 4QPKA 2JK5C 3BHPA 1Q8IA 4LWSA 2JJ2G 5KMGB 1BCCH 1SS3A 4O4HB 1E1QG 1X4TA 2BSKB 4QPJA 3SR2C 3RYIB 4I0XA 4GX2A 2OIGA 3BRCA 3CCSV 1JJOA 4RWUA 2QSAA 1SQQH 3ZEDA 1FXHA 2HP8A 4P9PA 2Y48A 3UO2A 3ZHTA 4D6TH 1P49A 2E5LB 1GM8A 4RO2A 2GUZA 5JQGA 3ABMB 5B1NA 1VQ8V 3NXSA 4X1IA 1N8RW 3L71H 2UUBB 1XREA 4CBCA 3ABLB 2PGGA 4JTCB 3BABA 1X59A 4R7CA 3LDEA 4LR3A 2QR4A 2ZM6B 2XAFA 3E8BA 3D36A 2BTOA 2DWEC 3OUFA 1WA8B 4WBNB 3AEIA 4FPPA 4QGPA 4WBNA 1W0JG 2DJVA 4MVSA 2LO1A 3K57A 3F7VC 4U7OA 1NR7A 3E8FA 3RGBA 4J9YB 4CS3A 1N0NA 5J2UB 3CRMA 5TISZ 2B1IA 1ZTEA 1G8MA 1XDCA 2ZT9B 3ZHRA 4J10A 2Y0PA 3BVOA 1FXVA 4JYAB 2IBZH 3SPGA 2OCCB 4X88A 3OD4A 1O9GA 4CS2A 1MA1A 1M9NA 1E79G 4UVAA 3WU2Z 2EIKB 1P84F 1R3LC 4B3TO 4LH6A 1F51A 3O65A 4X64O 1WB7A 5IYDO 5B3SB 2EZOA 3H1LH 1K4CC 4AHCA 4YY3O 3BCCH 1XNQB 2YI8A 4F6RB 3FKSG 4E2LA 4WCEV 3T1HB 3SYPA 2R9AA 1PV0A 5ITZB 2IJHA 4UV8A 2HEPA 3G6EV 4PA4A 4ZKIA 3CHXA 5BY1A 5LHHA 1T5EA 2GHYA 3ZMTA 5B1OA 1Q90D 1OCOC 5IYCO 4O4IA 1RPRA 3E83A 4DV3B 2VS0A 3UT5A 3MD0A 4DK0A 3UT5B 1BL8A 4EFBA 3B09A 2NNUA 2UUBO 4H44B 4J41A 1I7FA 3EFFK 3E8GA 5BXZA 4NB5A 4HYOA 1IZ3A 4DRXA 1JPXA 2CK3G 1EZVH 1HDJA 3ZHVA 4X62O 2DW4A 4IT5A 4DRXB 4UVBA 2HVKC 1N32O 5KMGA 1IX9A 3WB0A 1BMFG 2X6AA 2V7QG 1VEWA 2DMXA 1AP5A 3K79A 3DTUB 2KB1A 2BCCH 1VARA 1S5LZ
chains in the Genus database with same CATH topology
4R6ZA 3JD1A 3B77A 2W6IG 1K7DA 1SZTA 2IH3C 4JPRA 3ZMVA 2LP7A 4BIUA 3ABLC 4RUFA 1XL6A 3R65A 2A79B 2DYSB 3E8HA 2EINB 4DXWA 3ZCCA 2XOKG 1V54B 3LSQA 4DO2A 4PA6A 4MW3A 2EZPA 3ASNB 3FYIB 1S72V 5DN6G 5KA5A 1MOFA 2HKOA 1CPYA 2QKSA 3IGAC 5CBGA 4I9WA 1PNLA 1S5HC 2P67A 5H6RA 1K3EA 3STLC 1Q81W 2Z3YA 2IJJA 1I5XA 1Y66A 3CCLV 1VQ7V 5B1AB 1SRYA 1K73W 3LUTB 4X8AA 2Y69B 2EIKC 3ASOC 1KP2A 3JD3A 3I56V 4MVRA 4XDKA 3ETGA 3JD4A 2X6BA 3TETA 3G71V 4WFEA 3K9AA 3ZN0A 1ORQC 3CD6V 1PNMA 3W7TA 3ZRVA 4G28B 1YTFB 1JQ0A 2HLDG 4XBFA 4EKWA 3K08A 2P90A 3B8NA 1K5SA 2JEUA 1FS0G 1R73A 1RM1B 1EBOA 1ZWIC 3CCQV 1PL0A 4OXSA 2ZD9A 4BW5A 3OUSA 4UUJC 3W7SA 2P7TC 3E2EA 3BY6A 5IY5B 3OGCC 1PKXA 1RPOA 4FK5C 2XAQA 1JVMA 4N21A 3K03A 2WLMA 3CCRV 1IXMA 2WWWA 1UJWB 3CC2V 4JASA 3ZIAG 4BAYA 3CCMV 2OCCC 3OR7C 3OEHG 3W7XA 2PI5A 4U7NA 4XDJA 3OW2U 3K3WA 3OMNB 1SETA 1S76D 2ZXWB 5FL7G 3SPIA 2IU3A 4Q20A 5KA6A 1GK9A 1Q82W 2DYRC 1JOYA 3GB7C 1M56B 1NQTA 1YSCA 3BEHA 1W2BU 2EILB 5L3EA 4H37A 2WLHA 2DYRB 3W7UA 4GX1A 1FXKC 5LGNA 1SESA 1K97A 4FIPC 1KKDA 1GTOA 1GMGA 3LDDA 1M90W 3T2MA 2DQ3A 3IFXA 3ZRWB 3EHBB 1AJPA 2JIZG 3LSSA 3AG1C 1F4NA 3CC4V 1H8HG 2QE7G 2JJ1G 3OFNG 3FB7C 2ITDC 1Y4MA 1OCOB 5L3DA 2XASA 1AJQA 4QJFB 5CBFA 5H9CA 2Z5UA 3CMAV 1VQOV 3P30A 1VQ6V 3TK1A 3ABKB 3OAAG 2WLIB 3HPLC 1R3KC 3K0DA 1QVGU 2UXNA 1KD1W 1DTOA 1AJNA 4MT8A 3ZMUA 5KUKA 2ATKC 3JD2A 1VQKV 2IW5A 1E1RG 2IJIA 1KC8W 3OEEG 4N23A 2Q6AA 1YTFD 3CCUV 3QO5A 3JD0A 1V55C 5BZBA 1JX9A 3AG4C 4GT1A 4KP4A 3ZRWA 4TSFG 1AI7A 3ABTA 2X7RB 1KQSU 3T4DA 2W0FC 2WLLB 1LNQA 3M99B 4MVOA 3LNMB 4PA7A 3RVYA 4PA9A 1YJ9V 1QR9A 1YITV 1AI5A 1GM7A 1AR1B 3T1CA 1PD3A 4LP8A 3CCEV 2WLIA 3ZRSA 1V55B 2D3OW 4PDRA 2X6CA 4CZZA 1QLEB 2V1DA 3SPJA 1OCZC 1MSWD 1K92A 2OT5A 2H8PC 1BHAA 4L87A 3GWOA 3KG2A 3I55V 1VQ9V 1J95A 2DYSC 3QO8A 2H94A 3SJQC 2X0LA 4MTXA 4J9ZB 2WLLA 3MHHC 4X89A 4R50A 3AG2B 3UKMA 2IJKA 2HR3A 4RQEA 3X2QB 5L3BA 4P2ZA 4MVUA 4KUMA 4G27B 3ZMZA 3SPCA 1HWYA 1ROPA 3ETDA 1OCRC 2B5UA 3T4ZA 1VQMV 2EINC 1ENVA 1K5QA 2WAMA 4FJCC 4Z1MG 5LGUA 4UXNA 1M56C 4G2KA 5HFLA 5CN0A 3E35A 1K9MW 5CBHA 3WG7C 2YSUB 2ZDIC 3DGEA 1VQLV 4HZ3A 3A0RA 3VOUA 5KUMA 1K4DC 1GKFA 4MVZA 3SYAA 1S3JA 2DWDC 3PJSK 1FXKA 1YJNV 2HJFC 1F4MA 4QE9A 3RBZA 1K34A 5EBMC 3AG2C 1H38A 3ABUA 1FXKB 3TCUA 5J9PC 1TUEB 1R6KA 3WG7B 4ZBMA 4PDVA 4MTGA 4RAIA 1FFTB 2B1GA 4JF3A 5HFMA 4WFBV 2Q68A 4ASUG 5EK0A 3QO7A 1NVPB 5EBWC 2ZXWC 5GW7A 1YJWV 4R8CA 2A0LA 2YEVB 2JEXA 2WSSG 1QLNA 3ABMC 1OCZB 5L3GA 1QLEC 2GSMB 3IC7A 4F4LA 3CC7V 1AI6A 1H8EG 2QM8A 4MW8A 3E86A 4QIWF 3AG3B 1B6QA 2QTOA 3F7YC 4MVMA 2Y69C 2JK5C 1K33A 4QPKA 1VQ5V 2FTKA 2WLJA 1CP9A 5CMUA 2HVJC 5IY5C 1NBMG 4GX0A 4RQFA 1MABG 5H6QA 2JJ2G 4WFFA 3P32A 4PA3A 4I5SA 3K0GA 2LFRA 2ZQMA 3CXCU 1K8AW 5L3FA 1EFRG 3FB8C 1E1QG 1WLEA 2BOBC 3JCZA 1NR1A 1W0KG 4QPJA 3STZC 1DF5A 1GM9A 4P30A 2OTLV 4GX2A 1M1KW 2R9RB 1F23A 3FYEB 5CA3A 1NVPD 3CCSV 4MTOA 1CEZA 3K04A 4JTDB 3CCVV 4RUEA 1NKDA 3JYCA 1XL4A 3QNEA 1QCEA 1FXHA 4P9PA 5EBLC 4QE7A 3SYCA 1S0VA 2K1EA 2Y48A 5E1AC 3AG4B 2QM7A 3HB3B 2AHYA 2R9IA 2M7WA 3MHSC 5IYBO 1Q86W 1QVFU 1GM8A 4RO2A 3UM7A 3AG1B 1MG1A 3W7WA 1G4YB 3ABMB 5B1NA 3ZMSA 3H01A 2OTJV 1VQ8V 3CCJV 2F43G 3NXSA 2EBOA 1N8RW 5B1BB 1AI4A 4CBCA 1VQPV 3OM3B 3ABLB 4JTCB 3F5WC 4LBEC 5EC2C 1L1FA 3RW0A 1NH2B 1EZJA 2EILC 3LDEA 4R7CA 3ABKC 4WFHA 1YHQV 2QA4V 1JCHA 5L3CA 2XAFA 3E8BA 3D36A 3ZRXA 1AROP 2DWEC 3OUFA 4JTAB 2QEXV 2XAHA 4XDLA 4LCUC 2PI4A 3AEIA 3B8MA 4FPPA 2WPDG 4GX5A 3OR6C 1W0JG 4MVSA 4TWKA 5IDJA 1YI2V 3FB6C 1OZ0A 4P9OA 3F7VC 4U7OA 3E8FA 1NR7A 3E89A 4FMTA 4J9YB 1M57B 3RVZA 1KECA 1BHBA 2EIJB 1P7BA 2B1IA 2Q67A 2ZR2A 1G8MA 2BOCC 4MS2A 4PDLA 1VQ4V 1NH2D 1R3IC 1OCRB 1H2GA 1KP3A 2C2AA 4JAVA 2JDIG 5B1BC 1QBZA 5LHGA 1FXVA 1THZA 4JAUA 4TT3G 5LHIA 4YXWG 3CMEV 5EC1C 1SERA 3ML0A 2XAGA 3SPGA 2OCCB 2IH1C 4X88A 5B3SC 1M9NA 3SYQA 1E79G 4UVAA 1QR8A 3OMIB 2EIKB 3ASOB 1R3LC 4MTFA 5LGTA 4UVCA 4JGSA 3CPWU 1F51A 2WLNA 4H33A 5IYDO 1R3JC 1NJIW 5B3SB 2EIMC 2EZOA 1K4CC 1RM1C 4WF9V 2AHZA 1DLBA 2XAJA 1I5YA 4PELA 3FKSG 4E2LA 2XNDG 1Q7YW 4WCEV 4PDMA 3SYPA 3ETEA 3LDCA 2EIMB 4BIZA 4MSWC 2IJHA 4UV8A 3ZJZA 5DM6V 1WPXA 3G6EV 4PA4A 5B1AC 2ZDIA 4ZKIA 5LHHA 3FB5C 2GHYA 3ZMTA 5B1OA 4WFAV 1OCOC 3AG3C 5IYCO 3WFVA 1RPRA 3CYOA 3E83A 2MK3A 4JYCA 4MVQA 3SYOA 2HG5C 4HAMA 3ASNC 3MD0A 1PNKA 2W6JG 2YEVA 2ITCC 5C93A 1P4RA 1BL8A 2EJRA 2P6JA 1V54C 1DF4A 1OHHG 2NNUA 5LBQA 3OMAB 3SPHA 3EFFK 3G4SV 3E8GA 2WLKA 2ZR3A 1COWG 2IU0A 4HYOA 2HFEC 3VBBA 1JPXA 2EIJC 3D3IA 1M57C 2CK3G 4QNHB 1OCCC 1YIJV 1JJ2U 2UXXA 2DW4A 4UVBA 1GO3F 2A9HA 1S77D 2HVKC 2NLJC 4UV9A 2DQ0A 1BMFG 4GCZA 3X2QC 2X6AA 1VQNV 2V7QG 4KFMA 1R6NA 2Q69A 3OE7G 3K06A 2LFSA 3K79A 3DTUB 3ZN1A 2KB1A 4WFGA 4JYBA 4LC1A 1OCCB 3CP1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA V;  1VQO V;  1VQ6 V;  3G4S V;  1VQ5 V;  3CCS V;  1W2B U;  3G6E V;  3CPW U;  3CCV V;  1K73 W;  4WFB V;  3I56 V;  1YHQ V;  2QA4 V;  1K9M W;  1YJ9 V;  1QVG U;  4WFA V;  1JJ2 U;  3G71 V;  3CCR V;  1YIJ V;  1YIT V;  1NJI W;  1KD1 W;  1VQ4 V;  1VQL V;  3CCE V;  3CC2 V;  3CD6 V;  1YJW V;  3CCM V;  2D3O W;  1Q86 W;  1M90 W;  3CXC U;  4WF9 V;  1VQK V;  1QVF U;  1K8A W;  2QEX V;  1KC8 W;  3CME V;  1S72 V;  3OW2 U;  3CCU V;  3CCJ V;  1Q7Y W;  1R73 A;  1VQ8 V;  1VQN V;  2OTJ V;  1N8R W;  4WCE V;  3CC7 V;  1YJN V;  3CC4 V;  3I55 V;  2OTL V;  3CCQ V;  1VQ9 V;  1VQM V;  1YI2 V;  1VQP V;  1Q81 W;  1KQS U;  1Q82 W;  3CCL V;  1M1K W;  1VQ7 V;  5DM6 V; 
#chains in the Genus database with same CATH topology
 4R6Z A;  1BQZ A;  2W6I G;  2IH3 C;  4JPR A;  3U11 A;  3ETQ A;  3EVK A;  3L72 H;  5KHG A;  5E79 Z;  3ABL C;  4BIU A;  4DXW A;  4X62 B;  2XOK G;  4MW3 A;  1GRJ A;  4IGG A;  3ASN B;  3APO A;  2HKO A;  2QKS A;  5CBG A;  1JR9 A;  1S5H C;  1WAZ A;  2KKW A;  1K3E A;  1Q5O A;  1K73 W;  3LUT B;  4X1Y B;  3ASO C;  2ZE5 A;  4MVR A;  2CTQ A;  3BA8 A;  3K9A A;  5JCO A;  1ORQ C;  3R66 A;  3ZN0 A;  3ZRV A;  4B3S B;  3K08 A;  3J80 N;  4DR6 O;  2LQT A;  1R73 A;  1S5J A;  3N27 A;  1RM1 B;  1WPB A;  1N33 O;  1EBO A;  1PL0 A;  4BW5 A;  5FNV A;  2P7T C;  2ZIM A;  2FB5 A;  1FFX A;  1JVM A;  2AZ2 A;  2F1M A;  5H2F Z;  4UB6 Z;  3CC2 V;  4GKJ O;  1EN6 A;  3ZIA G;  2CTP A;  3OR7 C;  3OEH G;  4JI5 O;  4XDJ A;  3H9V A;  3OMN B;  1MZF A;  5FL7 G;  3SPI A;  4JI2 B;  3K5L A;  1Q82 W;  1JOY A;  4NYK A;  1H2S B;  4PD4 F;  4J80 A;  4LH7 A;  4NXN O;  4DR3 O;  1U96 A;  1KKD A;  1M90 W;  2ADQ B;  3T2M A;  3ZRW B;  4EB6 A;  3LSS A;  3RYC A;  1AR4 A;  1H8H G;  4O4J A;  4DV7 O;  3FB7 C;  3ZX6 A;  5L3D A;  2XAS A;  5CBF A;  1QNM A;  1R3K C;  3RFR A;  1BSM A;  1KD1 W;  1N0J A;  3A0H Z;  4KHP B;  3OEE G;  3UO3 A;  3J81 N;  3QO5 A;  4YY3 B;  2PUS A;  1V55 C;  1OJH A;  1JX9 A;  4GT1 A;  4TSF G;  4JZG A;  1AI7 A;  5IT9 N;  3ABT A;  1KQS U;  3T4D A;  2L35 A;  2W0F C;  5LYJ A;  3E22 B;  1LUW A;  2QJ1 A;  4ZI7 A;  1NTK H;  4PA9 A;  1YIT V;  1AR1 B;  3K58 A;  3CCE V;  4Q6G A;  2GDS A;  3JAW A;  1OCZ C;  1K92 A;  2ZNJ A;  4BR6 A;  3I55 V;  4JI6 O;  3CRA A;  2DYS C;  3BA9 A;  2YID A;  3SJQ C;  4DV6 O;  2X0L A;  1UPG A;  2IJK A;  5K1X A;  4RQE A;  1HNW O;  4G27 B;  4LF9 O;  3SPC A;  1HWY A;  1ROP A;  1OCR C;  2E74 B;  4ZOL A;  2P22 C;  1ENV A;  5AG2 A;  4NR1 A;  4ZHQ B;  4B08 A;  1DK1 A;  4UXN A;  4G2K A;  5CN0 A;  5CBH A;  3WG7 C;  1ZL8 B;  3H1H H;  4PHZ A;  2PYL A;  4TQF A;  5LA6 B;  1MSD A;  2ZNI A;  3SYA A;  1YCI A;  1FXK A;  4H13 B;  5J2T A;  5CA1 A;  2HJF C;  1F4M A;  3RBZ A;  3G80 A;  5EBM C;  2Q73 A;  3AG2 C;  3T1Y B;  1FXK B;  5J9P C;  1TUE B;  1WNS A;  1R6K A;  3WG7 B;  1XUQ A;  2Q68 A;  1FFX B;  1O9H A;  2ZXW C;  2UXC B;  1QLN A;  2RN9 A;  4LFA O;  2E3C A;  2EUL A;  4YHH B;  4DW0 A;  1H8E G;  4QIW F;  4I9Q A;  2YS8 A;  2QTO A;  1K33 A;  1CP9 A;  1M4U A;  5CMU A;  4I4T B;  1NBM G;  4GX0 A;  5H6Q A;  4WFF A;  1HNZ B;  3VQW A;  1PP9 H;  5IE9 A;  2JS5 A;  3AG7 A;  3HKC B;  3Q4H B;  1AR5 A;  2BOB C;  1W0K G;  3STZ C;  1DF5 A;  1GM9 A;  4NXM O;  1F23 A;  3CCV V;  4RUE A;  1R6T A;  5LMU O;  3JCU Z;  4I55 A;  1S0V A;  3D8C A;  3AG4 B;  1Q86 W;  1QVF U;  4LFC O;  1YXB A;  3UM7 A;  3AG1 B;  1MG1 A;  3W7W A;  1G4Y B;  4IIJ A;  4J11 A;  3H01 A;  1HNW B;  3D36 C;  2OTJ V;  3HKE A;  3P3N A;  5J2U A;  2RDC A;  1AI4 A;  2FL4 A;  2Q7H A;  3JAS B;  3OTO O;  4DR3 B;  3F5W C;  5DEC A;  3CRC A;  1UFI A;  3ABK C;  4WFH A;  2UU9 B;  2ILM A;  1Q6H A;  4FLV A;  3ZRX A;  1ARO P;  5IYZ B;  2AGA A;  2Q8V A;  4JTA B;  4LCU C;  5BR8 B;  3B8M A;  3AK1 A;  4TV9 A;  1QU7 A;  4X1K A;  1IBL O;  4NXM B;  4P9O A;  4TV9 B;  1OZ0 A;  4DV1 B;  3RVZ A;  4K3A A;  2YIA A;  4FMT A;  5F2V O;  1M57 B;  1BHB A;  2EIJ B;  2UXD O;  2ZR2 A;  3AK2 A;  1TA8 A;  2BOC C;  3CB2 A;  1R3I C;  3TXS A;  4DV5 B;  3BPZ A;  5B1B C;  1KMI Z;  5LHG A;  3LSU A;  1THZ A;  2LW7 A;  4TT3 G;  5LHI A;  4YXW G;  5ITZ A;  1Z2G A;  3ML0 A;  3KCX A;  1N36 B;  4DR1 B;  1XOU A;  5D5Q A;  3HKD B;  4MTF A;  3CPW U;  4JGS A;  4DV0 O;  5CA0 A;  4H33 A;  1R3J C;  5FPR A;  1RSO A;  2EIM C;  1Z5V A;  1BT8 A;  1ZL8 A;  4PEL A;  1Y76 A;  4PDM A;  1Y76 B;  2KG7 B;  4LF4 O;  5J2T B;  5DM6 V;  1WPX A;  2QTS A;  4EEQ A;  2OIE A;  2PF4 E;  4I7Z B;  2G38 A;  3K5N A;  1IBK B;  2MK3 A;  4JYC A;  1ZSP A;  4MVQ A;  2HG5 C;  4DUY O;  3ASN C;  3JAL A;  1PNK A;  3WB2 A;  1P4R A;  2EJR A;  5IJ9 A;  1OHH G;  5LBQ A;  3JAT B;  3SPH A;  3G4S V;  2IU0 A;  2ZR3 A;  3JAK B;  1MZE A;  4TQD A;  1M57 C;  1OCC C;  1YIJ V;  2EJ7 A;  4EFE A;  4OPH A;  1GO3 F;  2JGU A;  2YXY A;  5JCO C;  4FFB A;  4LC1 A;  3CP1 A;  3CRQ A;  2E75 B;  3B77 A;  3JD1 A;  4FZ0 A;  2PY5 A;  4K0K O;  1K7D A;  5KLV H;  1Y67 A;  4I0X B;  2LP7 A;  4HNA A;  3R65 A;  2A79 B;  3E8H A;  5IWA O;  2EIN B;  4GKJ B;  3M8A A;  4PA6 A;  2Q4P A;  4HNA B;  4FVM A;  5KAI Z;  4B3M O;  2EZP A;  4IHJ A;  3FYI B;  5DN6 G;  2Y0I A;  1BS3 A;  2GUZ B;  4X20 B;  1CPY A;  4JI2 O;  5H6R A;  1Q81 W;  2Z3Y A;  5LL6 Y;  1JA8 A;  1SRY A;  3I56 V;  4XDK A;  4NTX A;  3JD4 A;  3G71 V;  1PNM A;  3W7T A;  2HLD G;  4XBF A;  4FFK A;  2P90 A;  1EN4 A;  3B8N A;  5LP6 C;  2P4K A;  3OT7 A;  1I94 B;  3W7S A;  1XHZ A;  3E2E A;  5EIB D;  5IY5 B;  1PKX A;  1RPO A;  2E76 B;  1BZK A;  2CAZ C;  4KL1 A;  4BAY A;  3W7X A;  2F23 A;  2CTW A;  3K3W A;  2ZXW B;  1SQG A;  2DYR C;  2UU9 O;  1Y74 B;  5L3E A;  3HR0 A;  2DYR B;  3W7U A;  1FPO A;  1SES A;  1K97 A;  4FIP C;  2XTA A;  4JI3 B;  4JI8 O;  3IFX A;  5KX5 A;  3EHB B;  1N34 B;  4J7Z A;  2JVD A;  3CC4 V;  3RYF A;  2LGW A;  4ZI7 B;  3OFN G;  2ITD C;  1Y4M A;  2YC0 A;  3CMA V;  1VQO V;  2K9P A;  3D3Q A;  3HPL C;  4JI5 B;  4K0K B;  4UCV A;  3SJB C;  4LF7 O;  1M5I A;  5KHI A;  4LF4 B;  4I50 B;  3JD2 A;  3S3X A;  4AI8 A;  2Q5Z A;  2IW5 A;  3OTF A;  3THO A;  2IJI A;  2RQ6 A;  5LP6 B;  2QWQ B;  4UB8 Z;  1YTF D;  4FM0 A;  3CX5 F;  3JD0 A;  1IBM B;  3J7A U;  1Q6I A;  2AW9 A;  4B7K A;  2WLL B;  1P7G A;  1LNQ A;  2HHH B;  2M6Y A;  4MVO A;  4DR7 O;  3RVY A;  1QR9 A;  2D2C B;  1IBL B;  2AZ0 A;  2WLI A;  3ZRS A;  1V55 B;  4JI4 B;  3T1H O;  2X6C A;  4DUZ B;  1PPJ H;  4CZZ A;  4DR6 B;  2XUM A;  1MSW D;  4LNU B;  4LF5 O;  4F6E A;  1G6U A;  4JZ2 A;  4DW1 A;  4X9Q A;  5JQG B;  1VQ9 V;  2VQF O;  1PM9 A;  1VIB A;  3QO8 A;  4H0L B;  1YF2 A;  2H94 A;  3U10 A;  2UXD B;  2UXB O;  1DGS A;  1FAF A;  3MHH C;  4BWA A;  4R50 A;  2HR3 A;  1XEQ A;  4TUY A;  2F93 B;  1WB8 A;  1WJZ A;  2YI9 A;  4KUM A;  3ZMZ A;  4DV1 O;  1PL4 A;  3H1K H;  1MMM A;  4IYI A;  3T4Z A;  3N2G B;  1IVS A;  1HR0 B;  3F5T A;  2KQX A;  1K5Q A;  5KHH A;  5JJN B;  3ZHS A;  4Z1M G;  5LGU A;  1M56 C;  5HFL A;  1IXB A;  2YIB D;  4HZ3 A;  2W0X A;  5EZY A;  3VOU A;  5LMU B;  5KUM A;  1K4D C;  2JGD A;  3QG5 A;  4MVZ A;  4K8Z A;  2DWD C;  4B3M B;  4A5U B;  1FJG O;  1H38 A;  2VQE O;  2F66 C;  1SA0 B;  1HNX O;  4B3R O;  4PDV A;  4MTG A;  4RAI A;  1FFT B;  4JF3 A;  4LF8 O;  2GV9 A;  4L8J A;  4ASU G;  5EK0 A;  5C8Y A;  1I0H A;  5EBW C;  2A7W A;  1YJW V;  1TAE A;  3EXA A;  4R8C A;  4LF6 O;  2YEV B;  4X64 B;  3ZHU A;  5KHK A;  2V4D A;  1OCZ B;  5L3G A;  4DUY B;  5IJ0 B;  3IC7 A;  1AI6 A;  3E86 A;  4DR5 O;  1GN2 A;  1Z5W A;  3AG3 B;  4JI0 B;  3CSX A;  4OPA A;  1L0N H;  4YHH O;  1XBL A;  2Y69 C;  4MVM A;  1VQ5 V;  4C7U A;  3DSQ A;  2QKC A;  4RQF A;  1MAB G;  4PA3 A;  4I5S A;  4I4T A;  3ICX A;  3HKE B;  2LFR A;  3JAR A;  2ZQM A;  1F7Y A;  4TV8 B;  5GTI Z;  2Z0A A;  1K8A W;  5D5P A;  4UCS A;  4UCR A;  3FB8 C;  1XNQ O;  3A8T A;  3JCZ A;  1NR1 A;  3DC6 A;  4UFZ A;  3E22 A;  4JI1 O;  3A0B Z;  3FYE B;  5CA3 A;  2F4V B;  3JAM N;  4O2A B;  4JTD B;  3JYC A;  3QNE A;  4O2B A;  2N05 A;  3B40 A;  3N2K A;  5E1A C;  3CEI A;  3HB3 B;  4AQY B;  3MHS C;  5IYB O;  2M7W A;  4DV2 B;  4YIO A;  4ZIB A;  3CCJ V;  4JI8 B;  4FLY A;  2IM9 A;  2PTM A;  1VF5 B;  5CB4 B;  1VQP V;  5EC2 C;  1L1F A;  2BSK A;  1EZJ A;  4GYC B;  2QWO B;  1YHQ V;  2E5L O;  1JCH A;  2QKA A;  4B7E A;  2A3Q A;  4LF9 B;  4J42 A;  4LF7 B;  3FFQ A;  2NR5 A;  2QEX V;  2PI4 A;  1NTZ H;  3L9D A;  2WPD G;  1Q3E A;  4GX5 A;  3OR6 C;  4ZHQ A;  4TWK A;  3SDL A;  2YUA A;  2LW1 A;  4J7K A;  3E89 A;  1KEC A;  2BTQ A;  2VRZ A;  3APQ A;  1P7B A;  2Q67 A;  3VQX A;  5LA6 A;  2LJ2 A;  1NH2 D;  1OCR B;  4PV1 B;  1KP3 A;  2JDI G;  2A06 H;  4DR2 O;  4JAU A;  3CME V;  4DV2 O;  5EC1 C;  2XAG A;  2IH1 C;  2WA4 A;  5B3S C;  1AVM A;  3SYQ A;  4FLU A;  3PN1 A;  3ASO B;  5LGT A;  4UVC A;  1D2D A;  2VWK A;  2AHZ A;  4CH5 A;  1SF9 A;  1RSO B;  4DV4 O;  1I5Y A;  1N34 O;  1VF6 A;  2XND G;  3KCY A;  4BIZ A;  4U3F H;  4DV5 O;  4MSW C;  4DV7 B;  5DED A;  4DR7 B;  2ZDI A;  3FB5 C;  4BW9 A;  3L70 H;  1GN4 A;  3H1I H;  4WFA V;  2DOS A;  3AG3 C;  3MDS A;  3WFV A;  1URF A;  2RJZ A;  3CYO A;  3BAA A;  2Q0O C;  4B3T B;  1XHX A;  2YEV A;  5C93 A;  1MNG A;  2P6J A;  1V54 C;  3JAL B;  1DF4 A;  5JH7 A;  4FLT A;  1G1X B;  4X66 B;  3RYC B;  1COW G;  2HFE C;  4O4J B;  1SQX H;  4GKK O;  2QWR B;  1RP3 B;  4QNH B;  1JJ2 U;  2UXX A;  2ADP A;  2A9H A;  1W59 A;  2NLJ C;  2DQ0 A;  4TV8 A;  4PI2 A;  4J7J A;  1R6N A;  3OE7 G;  3K06 A;  3CWB H;  3CJH B;  4JI6 B;  2YDE A;  1OCC B;  1XMO O;  3CJH A;  1SZT A;  2YXL A;  3ZMV A;  4RUF A;  1XL6 A;  2DYS B;  1LR1 A;  2CH7 A;  5B66 Z;  3BFR A;  4O2B B;  1XI1 A;  3M7M X;  4I55 B;  2N04 A;  1S72 V;  2ZIO A;  1HNX B;  4B3R B;  5JVD B;  1VMG A;  1A32 A;  4I9W A;  1NT2 B;  2P67 A;  3STL C;  1ZX3 A;  1Y66 A;  1VQ7 V;  4DV6 B;  5B1A B;  3JAS A;  2Y69 B;  2EIK C;  4OX9 B;  3O9O A;  3ETG A;  3TET A;  2X6B A;  1GH6 A;  4WFE A;  3CD6 V;  1GN3 A;  4G28 B;  4OX9 O;  2ARH A;  1JQ0 A;  2JEU A;  4JYA O;  4DR4 O;  1Y6X A;  3G67 A;  1HR0 O;  3CCQ V;  4JYY A;  4FLZ A;  2ZD9 A;  3OUS A;  4UUJ C;  3RYH B;  4JV5 B;  5LXT A;  4DYL A;  3OGC C;  2XAQ A;  3K03 A;  3CCR V;  1YEW A;  1IXM A;  2WWW A;  4JAA A;  4JAS A;  3CCM V;  4X1Y A;  2FML A;  3SJC C;  2PI5 A;  2KG7 A;  3OW2 U;  1B3Q A;  1SET A;  1S76 D;  4FM2 A;  3B4S A;  2P06 A;  4Q20 A;  1YVW A;  4ABM A;  2CGO A;  3FAV B;  3GB7 C;  1M56 B;  1NQT A;  3BEH A;  1W2B U;  4H37 A;  3HKD A;  4GX1 A;  5LGN A;  4OGQ B;  1GTO A;  3LDD A;  1M93 A;  2L6L A;  2DQ3 A;  1N4C A;  2JIZ G;  1JFF A;  1YZB A;  4UCO A;  4JI0 O;  2QE7 G;  2VQE B;  1XNR B;  1JFF B;  2Z5U A;  1VQ6 V;  5K1P A;  3P30 A;  3TK1 A;  3ABK B;  3P3P A;  3K0D A;  1QVG U;  2FYU H;  3ZBH A;  1WN7 A;  1DTO A;  1AJN A;  3TGU H;  3UCS C;  3ZMU A;  5KUK A;  2ATK C;  4X1I B;  1KC8 W;  1TGO A;  3SJA C;  1I08 A;  4N23 A;  4K8X A;  4I50 A;  3CCU V;  3K9S A;  1Q43 A;  1ZUQ A;  3AG4 C;  3ZRW A;  5KAF Z;  3M99 B;  4YJ2 B;  2NN4 A;  4O4L B;  1NU1 H;  2EX3 A;  4PA7 A;  1GN6 A;  3JAK A;  1AI5 A;  4O4L A;  3T1C A;  1PD3 A;  2CTR A;  2WA3 A;  1H2N A;  4X20 A;  2D3O W;  4PDR A;  3SPJ A;  2QDO A;  2ZE8 A;  4CH6 A;  2OT5 A;  1BHA A;  2UXC O;  1J5E B;  3GWK C;  3RN4 A;  1SQB H;  4IIJ B;  1N36 O;  1J95 A;  1KB9 F;  4LF8 B;  4X89 A;  3QTC A;  5B5E Z;  3UQ8 A;  4X65 O;  2ZM6 O;  4TOI A;  5L3B A;  5FNV B;  2ODM A;  3KZI Z;  4IHJ B;  4DR5 B;  3S3W A;  4PJ0 Z;  3ETD A;  1VQM V;  2EIN C;  2WAM A;  4NXN B;  3HKB A;  4FJC C;  4LFA B;  2KSD A;  1LUV A;  1XMO B;  3DGE A;  2MW2 B;  1IBK O;  3CRR A;  2VWJ A;  1SC5 B;  1R1B A;  2DN9 A;  5A2Q N;  1GKF A;  2CE4 A;  4DV4 B;  1S3J A;  3PJS K;  1KYO F;  4FLX A;  3ABU A;  3TCU A;  4JI7 B;  3L74 H;  1D5A A;  2B1G A;  3JAR B;  4ZOL B;  2Y4T A;  1EN5 A;  5GW7 A;  1XQ8 A;  2ETN A;  2JEX A;  2WSS G;  1ZLZ A;  3ABM C;  1QLE C;  2GSM B;  2PYJ A;  3CC7 V;  4JI4 O;  2XT9 A;  3F7Y C;  5JJJ B;  2O57 A;  2FTK A;  2P4V A;  2WLJ A;  5IY5 C;  2HVJ C;  1IUR A;  3L75 H;  2UUA B;  4CC5 A;  3P32 A;  4FM1 A;  1Y74 A;  2RNB A;  3G6B A;  3K0G A;  1Q6U A;  3IC9 A;  3CXC U;  5L3F A;  2UXB B;  1EFR G;  3B2E E;  5CB4 A;  4IL6 Z;  4O4I B;  4E4E A;  1WLE A;  4U3J B;  2QWP B;  1EM1 A;  4DV3 O;  4P30 A;  2OTL V;  4YIP A;  2UUC O;  1M1K W;  2R9R B;  3RYF B;  1SZX A;  1NVP D;  2P5O A;  4MTO A;  1CEZ A;  3K04 A;  5IYZ A;  1NKD A;  4PI0 A;  1XL4 A;  1QCE A;  5EBL C;  3SYC A;  4QE7 A;  2Q7E A;  2K1E A;  2QM7 A;  2AHY A;  2R9I A;  4LWS B;  2QGN A;  3VQY A;  3ZMS A;  2OCH A;  2QM4 A;  2F43 G;  2EBO A;  2ZE6 A;  4UCT A;  5LMN O;  5FLX N;  5B1B B;  3OM3 B;  4DK1 A;  1JMK C;  4LBE C;  3RW0 A;  1NH2 B;  2Q9L A;  4GKK B;  2EIL C;  1VF7 A;  3RYI A;  2RCV A;  2QA4 V;  4LFC B;  2CUG A;  5L3C A;  2XAH A;  4XDL A;  5LOV B;  1N32 B;  4DR2 B;  2GTA A;  5LOV A;  3T1Y O;  3K5O A;  5IDJ A;  1YI2 V;  5CA0 B;  3FB6 C;  2GTS A;  3ZS8 C;  1RFY A;  1L8D A;  2FKX A;  2B9Z A;  1HP8 A;  2N74 A;  4MS2 A;  4PDL A;  1VQ4 V;  1WP7 A;  1BQ0 A;  1H2G A;  3RT3 C;  2C2A A;  4JAV A;  5IWA B;  1BE3 H;  1QBZ A;  1FJG B;  1IBM O;  5FPO A;  1SER A;  4KHP O;  2LGQ A;  1WA8 A;  2VQF B;  1SQF A;  4KXR A;  4LFB O;  1QR8 A;  3OMI B;  2WLN A;  2ZE7 A;  3HKB B;  1NJI W;  4NTW A;  2QWN B;  3QVN A;  3JSN A;  2R70 A;  1RM1 C;  4W4L A;  4WF9 V;  5IJ9 B;  1H2K A;  1DLB A;  2XAJ A;  1B06 A;  1QQC A;  3FD9 A;  1Q7Y W;  4AQY O;  3OTO B;  3ETE A;  3LDC A;  2EIM B;  1NZ6 A;  3C3T A;  3CE2 A;  3JSL A;  1KBH A;  3ZJZ A;  4GUN A;  2XHB A;  2CGN A;  5B1A C;  3H1J H;  4B3S O;  2HJD A;  4JI3 O;  2Q7G A;  3CXH F;  1D5N A;  5JWP A;  5C8Y B;  4NVP A;  3SYO A;  4HAM A;  1KUQ A;  2W6J G;  4NKG B;  2ITC C;  5JJE B;  1NS1 A;  1US6 A;  4Z2W A;  5LYJ B;  4AIL C;  2YXH A;  3OMA B;  3VBB A;  2WLK A;  1L0L H;  2EIJ C;  3D3I A;  2PZS A;  4X65 B;  1SQP H;  5BMV B;  1S77 D;  3DXR A;  2R72 A;  1TUB A;  4UV9 A;  4W4K A;  4GCZ A;  3X2Q C;  1VQN V;  4KFM A;  1TUB B;  2Q69 A;  1NTM H;  2LFS A;  3SGI A;  3ZN1 A;  4WFG A;  5LP6 A;  4JYB A;  3FX7 A;  1AIL A;  3L73 H;  3JAT A;  3TXQ A;  1HNZ O;  3ZCC A;  1V54 B;  3LSQ A;  5GTH Z;  4DO2 A;  3K59 A;  2OWO A;  4CS4 A;  2UUA O;  2DE0 X;  3N2K B;  5KA5 A;  3RYH A;  1MOF A;  4IYH A;  4JI7 O;  3IGA C;  1PNL A;  4D7S A;  2Q0A A;  2IJJ A;  1I5X A;  4LNU A;  3U0Z A;  3CCL V;  5JVD A;  4FFB B;  2YIC A;  3K5M A;  4X8A A;  1KP2 A;  3JD3 A;  1YTF B;  1AP6 A;  4EKW A;  4CH3 A;  1K5S A;  1FS0 G;  3FAV A;  2YIB A;  1ZWI C;  1AB3 A;  4OXS A;  5GON A;  4DR4 B;  1IDS A;  3BY6 A;  4FK5 C;  3N2G A;  2HHH O;  1CXZ B;  4N21 A;  5KX5 B;  2WLM A;  4ICG A;  5LXT B;  4FLW A;  3ZHQ A;  1UJW B;  1B04 A;  2OCC C;  4UCU A;  4U7N A;  1SKV A;  5BR8 O;  4DUZ O;  1GAX A;  2IU3 A;  1QHT A;  5KA6 A;  2JGD B;  1GK9 A;  1YSC A;  1V9P A;  1XMQ B;  2EIL B;  1FKA O;  4GLX A;  4CH4 A;  2WLH A;  1FXK C;  3IAY A;  4EB6 B;  2RMK B;  1I94 O;  3HKC A;  1GMG A;  4O4H A;  5EIB C;  1U97 A;  1AJP A;  5JH7 B;  5EYP A;  3AG1 C;  1F4N A;  4YJ2 A;  2JJ1 G;  2ZCE A;  5EYP B;  3LNN A;  1OCO B;  4QJF B;  1AJQ A;  2BE3 A;  5H9C A;  5IJ0 A;  2Y4U A;  3OAA G;  2AXT Z;  2WLI B;  4DV0 B;  4BIO A;  2H3O A;  2UXN A;  3C90 A;  5KHJ A;  4MT8 A;  3WB1 A;  4K35 A;  1VQK V;  3CS5 A;  1E1R G;  4D7T A;  2Q6A A;  1KU9 A;  5BZB A;  4KP4 A;  1XNR O;  5LMN B;  2X7R B;  3Q4H A;  4YJ3 A;  4YJ3 B;  4TUY B;  3LNM B;  1YJ9 V;  3KKY A;  3TJT A;  1GM7 A;  1YDX A;  5A9G A;  4LP8 A;  1WP8 A;  3AK3 A;  1BGY H;  1QLE B;  2V1D A;  5BMV A;  4X1K B;  2H8P C;  3DXR B;  4L87 A;  3GWO A;  2UUC B;  3KG2 A;  3IJ4 A;  1H2L A;  4JI1 B;  4GZR B;  2CDY A;  2JRI A;  1J5E O;  5EZY B;  1XIL A;  2F4V O;  2ZKO A;  4MTX A;  4J9Z B;  4NTY A;  2WLL A;  2F95 B;  3AG2 B;  3UKM A;  3RWR D;  5H5N A;  2CH7 B;  3X2Q B;  4P2Z A;  1SA0 A;  4JV5 O;  4MVU A;  4X66 O;  3OGI B;  1VF6 C;  2B5U A;  3JAW B;  4CC6 A;  1FYJ A;  1HW7 A;  1N33 B;  3A2F A;  1VP7 A;  4HBN A;  1XMQ O;  1K9M W;  3E35 A;  3VQV A;  2YSU B;  2ZDI C;  1FD9 A;  3GVM A;  3NR7 A;  2BTQ B;  1SQV H;  1TVK B;  1VQL V;  2ZIN A;  3A0R A;  4F6R A;  1KKC A;  1ZAU A;  1TVK A;  5CA1 B;  4LF6 B;  1YJN V;  4QE9 A;  3DC5 A;  1K34 A;  2JS3 A;  4ZBM A;  4Z1V A;  5HFM A;  5GON B;  4WFB V;  3QF7 A;  1NI8 A;  4DR1 O;  3QO7 A;  1NVP B;  1H2M A;  4U3J A;  3I5D A;  3C3S A;  2OYQ A;  4LF5 B;  4FZ1 A;  2A0L A;  2GBO A;  3MAQ A;  4F4L A;  4LFB B;  4O2A A;  2QM8 A;  4MW8 A;  1B6Q A;  1OV9 A;  4QPK A;  2JK5 C;  3BHP A;  1Q8I A;  4LWS A;  2JJ2 G;  5KMG B;  1BCC H;  1SS3 A;  4O4H B;  1E1Q G;  1X4T A;  2BSK B;  4QPJ A;  3SR2 C;  3RYI B;  4I0X A;  4GX2 A;  2OIG A;  3BRC A;  3CCS V;  1JJO A;  4RWU A;  2QSA A;  1SQQ H;  3ZED A;  1FXH A;  2HP8 A;  4P9P A;  2Y48 A;  3UO2 A;  3ZHT A;  4D6T H;  1P49 A;  2E5L B;  1GM8 A;  4RO2 A;  2GUZ A;  5JQG A;  3ABM B;  5B1N A;  1VQ8 V;  3NXS A;  4X1I A;  1N8R W;  3L71 H;  2UUB B;  1XRE A;  4CBC A;  3ABL B;  2PGG A;  4JTC B;  3BAB A;  1X59 A;  4R7C A;  3LDE A;  4LR3 A;  2QR4 A;  2ZM6 B;  2XAF A;  3E8B A;  3D36 A;  2BTO A;  2DWE C;  3OUF A;  1WA8 B;  4WBN B;  3AEI A;  4FPP A;  4QGP A;  4WBN A;  1W0J G;  2DJV A;  4MVS A;  2LO1 A;  3K57 A;  3F7V C;  4U7O A;  1NR7 A;  3E8F A;  3RGB A;  4J9Y B;  4CS3 A;  1N0N A;  5J2U B;  3CRM A;  5TIS Z;  2B1I A;  1ZTE A;  1G8M A;  1XDC A;  2ZT9 B;  3ZHR A;  4J10 A;  2Y0P A;  3BVO A;  1FXV A;  4JYA B;  2IBZ H;  3SPG A;  2OCC B;  4X88 A;  3OD4 A;  1O9G A;  4CS2 A;  1MA1 A;  1M9N A;  1E79 G;  4UVA A;  3WU2 Z;  2EIK B;  1P84 F;  1R3L C;  4B3T O;  4LH6 A;  1F51 A;  3O65 A;  4X64 O;  1WB7 A;  5IYD O;  5B3S B;  2EZO A;  3H1L H;  1K4C C;  4AHC A;  4YY3 O;  3BCC H;  1XNQ B;  2YI8 A;  4F6R B;  3FKS G;  4E2L A;  4WCE V;  3T1H B;  3SYP A;  2R9A A;  1PV0 A;  5ITZ B;  2IJH A;  4UV8 A;  2HEP A;  3G6E V;  4PA4 A;  4ZKI A;  3CHX A;  5BY1 A;  5LHH A;  1T5E A;  2GHY A;  3ZMT A;  5B1O A;  1Q90 D;  1OCO C;  5IYC O;  4O4I A;  1RPR A;  3E83 A;  4DV3 B;  2VS0 A;  3UT5 A;  3MD0 A;  4DK0 A;  3UT5 B;  1BL8 A;  4EFB A;  3B09 A;  2NNU A;  2UUB O;  4H44 B;  4J41 A;  1I7F A;  3EFF K;  3E8G A;  5BXZ A;  4NB5 A;  4HYO A;  1IZ3 A;  4DRX A;  1JPX A;  2CK3 G;  1EZV H;  1HDJ A;  3ZHV A;  4X62 O;  2DW4 A;  4IT5 A;  4DRX B;  4UVB A;  2HVK C;  1N32 O;  5KMG A;  1IX9 A;  3WB0 A;  1BMF G;  2X6A A;  2V7Q G;  1VEW A;  2DMX A;  1AP5 A;  3K79 A;  3DTU B;  2KB1 A;  2BCC H;  1VAR A;  1S5L Z; 
#chains in the Genus database with same CATH homology
 4R6Z A;  3JD1 A;  3B77 A;  2W6I G;  1K7D A;  1SZT A;  2IH3 C;  4JPR A;  3ZMV A;  2LP7 A;  4BIU A;  3ABL C;  4RUF A;  1XL6 A;  3R65 A;  2A79 B;  2DYS B;  3E8H A;  2EIN B;  4DXW A;  3ZCC A;  2XOK G;  1V54 B;  3LSQ A;  4DO2 A;  4PA6 A;  4MW3 A;  2EZP A;  3ASN B;  3FYI B;  1S72 V;  5DN6 G;  5KA5 A;  1MOF A;  2HKO A;  1CPY A;  2QKS A;  3IGA C;  5CBG A;  4I9W A;  1PNL A;  1S5H C;  2P67 A;  5H6R A;  1K3E A;  3STL C;  1Q81 W;  2Z3Y A;  2IJJ A;  1I5X A;  1Y66 A;  3CCL V;  1VQ7 V;  5B1A B;  1SRY A;  1K73 W;  3LUT B;  4X8A A;  2Y69 B;  2EIK C;  3ASO C;  1KP2 A;  3JD3 A;  3I56 V;  4MVR A;  4XDK A;  3ETG A;  3JD4 A;  2X6B A;  3TET A;  3G71 V;  4WFE A;  3K9A A;  3ZN0 A;  1ORQ C;  3CD6 V;  1PNM A;  3W7T A;  3ZRV A;  4G28 B;  1YTF B;  1JQ0 A;  2HLD G;  4XBF A;  4EKW A;  3K08 A;  2P90 A;  3B8N A;  1K5S A;  2JEU A;  1FS0 G;  1R73 A;  1RM1 B;  1EBO A;  1ZWI C;  3CCQ V;  1PL0 A;  4OXS A;  2ZD9 A;  4BW5 A;  3OUS A;  4UUJ C;  3W7S A;  2P7T C;  3E2E A;  3BY6 A;  5IY5 B;  3OGC C;  1PKX A;  1RPO A;  4FK5 C;  2XAQ A;  1JVM A;  4N21 A;  3K03 A;  2WLM A;  3CCR V;  1IXM A;  2WWW A;  1UJW B;  3CC2 V;  4JAS A;  3ZIA G;  4BAY A;  3CCM V;  2OCC C;  3OR7 C;  3OEH G;  3W7X A;  2PI5 A;  4U7N A;  4XDJ A;  3OW2 U;  3K3W A;  3OMN B;  1SET A;  1S76 D;  2ZXW B;  5FL7 G;  3SPI A;  2IU3 A;  4Q20 A;  5KA6 A;  1GK9 A;  1Q82 W;  2DYR C;  1JOY A;  3GB7 C;  1M56 B;  1NQT A;  1YSC A;  3BEH A;  1W2B U;  2EIL B;  5L3E A;  4H37 A;  2WLH A;  2DYR B;  3W7U A;  4GX1 A;  1FXK C;  5LGN A;  1SES A;  1K97 A;  4FIP C;  1KKD A;  1GTO A;  1GMG A;  3LDD A;  1M90 W;  3T2M A;  2DQ3 A;  3IFX A;  3ZRW B;  3EHB B;  1AJP A;  2JIZ G;  3LSS A;  3AG1 C;  1F4N A;  3CC4 V;  1H8H G;  2QE7 G;  2JJ1 G;  3OFN G;  3FB7 C;  2ITD C;  1Y4M A;  1OCO B;  5L3D A;  2XAS A;  1AJQ A;  4QJF B;  5CBF A;  5H9C A;  2Z5U A;  3CMA V;  1VQO V;  3P30 A;  1VQ6 V;  3TK1 A;  3ABK B;  3OAA G;  2WLI B;  3HPL C;  1R3K C;  3K0D A;  1QVG U;  2UXN A;  1KD1 W;  1DTO A;  1AJN A;  4MT8 A;  3ZMU A;  5KUK A;  2ATK C;  3JD2 A;  1VQK V;  2IW5 A;  1E1R G;  2IJI A;  1KC8 W;  3OEE G;  4N23 A;  2Q6A A;  1YTF D;  3CCU V;  3QO5 A;  3JD0 A;  1V55 C;  5BZB A;  1JX9 A;  3AG4 C;  4GT1 A;  4KP4 A;  3ZRW A;  4TSF G;  1AI7 A;  3ABT A;  2X7R B;  1KQS U;  3T4D A;  2W0F C;  2WLL B;  1LNQ A;  3M99 B;  4MVO A;  3LNM B;  4PA7 A;  3RVY A;  4PA9 A;  1YJ9 V;  1QR9 A;  1YIT V;  1AI5 A;  1GM7 A;  1AR1 B;  3T1C A;  1PD3 A;  4LP8 A;  3CCE V;  2WLI A;  3ZRS A;  1V55 B;  2D3O W;  4PDR A;  2X6C A;  4CZZ A;  1QLE B;  2V1D A;  3SPJ A;  1OCZ C;  1MSW D;  1K92 A;  2OT5 A;  2H8P C;  1BHA A;  4L87 A;  3GWO A;  3KG2 A;  3I55 V;  1VQ9 V;  1J95 A;  2DYS C;  3QO8 A;  2H94 A;  3SJQ C;  2X0L A;  4MTX A;  4J9Z B;  2WLL A;  3MHH C;  4X89 A;  4R50 A;  3AG2 B;  3UKM A;  2IJK A;  2HR3 A;  4RQE A;  3X2Q B;  5L3B A;  4P2Z A;  4MVU A;  4KUM A;  4G27 B;  3ZMZ A;  3SPC A;  1HWY A;  1ROP A;  3ETD A;  1OCR C;  2B5U A;  3T4Z A;  1VQM V;  2EIN C;  1ENV A;  1K5Q A;  2WAM A;  4FJC C;  4Z1M G;  5LGU A;  4UXN A;  1M56 C;  4G2K A;  5HFL A;  5CN0 A;  3E35 A;  1K9M W;  5CBH A;  3WG7 C;  2YSU B;  2ZDI C;  3DGE A;  1VQL V;  4HZ3 A;  3A0R A;  3VOU A;  5KUM A;  1K4D C;  1GKF A;  4MVZ A;  3SYA A;  1S3J A;  2DWD C;  3PJS K;  1FXK A;  1YJN V;  2HJF C;  1F4M A;  4QE9 A;  3RBZ A;  1K34 A;  5EBM C;  3AG2 C;  1H38 A;  3ABU A;  1FXK B;  3TCU A;  5J9P C;  1TUE B;  1R6K A;  3WG7 B;  4ZBM A;  4PDV A;  4MTG A;  4RAI A;  1FFT B;  2B1G A;  4JF3 A;  5HFM A;  4WFB V;  2Q68 A;  4ASU G;  5EK0 A;  3QO7 A;  1NVP B;  5EBW C;  2ZXW C;  5GW7 A;  1YJW V;  4R8C A;  2A0L A;  2YEV B;  2JEX A;  2WSS G;  1QLN A;  3ABM C;  1OCZ B;  5L3G A;  1QLE C;  2GSM B;  3IC7 A;  4F4L A;  3CC7 V;  1AI6 A;  1H8E G;  2QM8 A;  4MW8 A;  3E86 A;  4QIW F;  3AG3 B;  1B6Q A;  2QTO A;  3F7Y C;  4MVM A;  2Y69 C;  2JK5 C;  1K33 A;  4QPK A;  1VQ5 V;  2FTK A;  2WLJ A;  1CP9 A;  5CMU A;  2HVJ C;  5IY5 C;  1NBM G;  4GX0 A;  4RQF A;  1MAB G;  5H6Q A;  2JJ2 G;  4WFF A;  3P32 A;  4PA3 A;  4I5S A;  3K0G A;  2LFR A;  2ZQM A;  3CXC U;  1K8A W;  5L3F A;  1EFR G;  3FB8 C;  1E1Q G;  1WLE A;  2BOB C;  3JCZ A;  1NR1 A;  1W0K G;  4QPJ A;  3STZ C;  1DF5 A;  1GM9 A;  4P30 A;  2OTL V;  4GX2 A;  1M1K W;  2R9R B;  1F23 A;  3FYE B;  5CA3 A;  1NVP D;  3CCS V;  4MTO A;  1CEZ A;  3K04 A;  4JTD B;  3CCV V;  4RUE A;  1NKD A;  3JYC A;  1XL4 A;  3QNE A;  1QCE A;  1FXH A;  4P9P A;  5EBL C;  4QE7 A;  3SYC A;  1S0V A;  2K1E A;  2Y48 A;  5E1A C;  3AG4 B;  2QM7 A;  3HB3 B;  2AHY A;  2R9I A;  2M7W A;  3MHS C;  5IYB O;  1Q86 W;  1QVF U;  1GM8 A;  4RO2 A;  3UM7 A;  3AG1 B;  1MG1 A;  3W7W A;  1G4Y B;  3ABM B;  5B1N A;  3ZMS A;  3H01 A;  2OTJ V;  1VQ8 V;  3CCJ V;  2F43 G;  3NXS A;  2EBO A;  1N8R W;  5B1B B;  1AI4 A;  4CBC A;  1VQP V;  3OM3 B;  3ABL B;  4JTC B;  3F5W C;  4LBE C;  5EC2 C;  1L1F A;  3RW0 A;  1NH2 B;  1EZJ A;  2EIL C;  3LDE A;  4R7C A;  3ABK C;  4WFH A;  1YHQ V;  2QA4 V;  1JCH A;  5L3C A;  2XAF A;  3E8B A;  3D36 A;  3ZRX A;  1ARO P;  2DWE C;  3OUF A;  4JTA B;  2QEX V;  2XAH A;  4XDL A;  4LCU C;  2PI4 A;  3AEI A;  3B8M A;  4FPP A;  2WPD G;  4GX5 A;  3OR6 C;  1W0J G;  4MVS A;  4TWK A;  5IDJ A;  1YI2 V;  3FB6 C;  1OZ0 A;  4P9O A;  3F7V C;  4U7O A;  3E8F A;  1NR7 A;  3E89 A;  4FMT A;  4J9Y B;  1M57 B;  3RVZ A;  1KEC A;  1BHB A;  2EIJ B;  1P7B A;  2B1I A;  2Q67 A;  2ZR2 A;  1G8M A;  2BOC C;  4MS2 A;  4PDL A;  1VQ4 V;  1NH2 D;  1R3I C;  1OCR B;  1H2G A;  1KP3 A;  2C2A A;  4JAV A;  2JDI G;  5B1B C;  1QBZ A;  5LHG A;  1FXV A;  1THZ A;  4JAU A;  4TT3 G;  5LHI A;  4YXW G;  3CME V;  5EC1 C;  1SER A;  3ML0 A;  2XAG A;  3SPG A;  2OCC B;  2IH1 C;  4X88 A;  5B3S C;  1M9N A;  3SYQ A;  1E79 G;  4UVA A;  1QR8 A;  3OMI B;  2EIK B;  3ASO B;  1R3L C;  4MTF A;  5LGT A;  4UVC A;  4JGS A;  3CPW U;  1F51 A;  2WLN A;  4H33 A;  5IYD O;  1R3J C;  1NJI W;  5B3S B;  2EIM C;  2EZO A;  1K4C C;  1RM1 C;  4WF9 V;  2AHZ A;  1DLB A;  2XAJ A;  1I5Y A;  4PEL A;  3FKS G;  4E2L A;  2XND G;  1Q7Y W;  4WCE V;  4PDM A;  3SYP A;  3ETE A;  3LDC A;  2EIM B;  4BIZ A;  4MSW C;  2IJH A;  4UV8 A;  3ZJZ A;  5DM6 V;  1WPX A;  3G6E V;  4PA4 A;  5B1A C;  2ZDI A;  4ZKI A;  5LHH A;  3FB5 C;  2GHY A;  3ZMT A;  5B1O A;  4WFA V;  1OCO C;  3AG3 C;  5IYC O;  3WFV A;  1RPR A;  3CYO A;  3E83 A;  2MK3 A;  4JYC A;  4MVQ A;  3SYO A;  2HG5 C;  4HAM A;  3ASN C;  3MD0 A;  1PNK A;  2W6J G;  2YEV A;  2ITC C;  5C93 A;  1P4R A;  1BL8 A;  2EJR A;  2P6J A;  1V54 C;  1DF4 A;  1OHH G;  2NNU A;  5LBQ A;  3OMA B;  3SPH A;  3EFF K;  3G4S V;  3E8G A;  2WLK A;  2ZR3 A;  1COW G;  2IU0 A;  4HYO A;  2HFE C;  3VBB A;  1JPX A;  2EIJ C;  3D3I A;  1M57 C;  2CK3 G;  4QNH B;  1OCC C;  1YIJ V;  1JJ2 U;  2UXX A;  2DW4 A;  4UVB A;  1GO3 F;  2A9H A;  1S77 D;  2HVK C;  2NLJ C;  4UV9 A;  2DQ0 A;  1BMF G;  4GCZ A;  3X2Q C;  2X6A A;  1VQN V;  2V7Q G;  4KFM A;  1R6N A;  2Q69 A;  3OE7 G;  3K06 A;  2LFS A;  3K79 A;  3DTU B;  3ZN1 A;  2KB1 A;  4WFG A;  4JYB A;  4LC1 A;  1OCC B;  3CP1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...