1VQNV

The structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title An induced-fit mechanism to promote peptide bond formation and exclude hydrolysis of peptidyl-tRNA.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1vqnV00
3G4SV 2QEXV 4WFAV 1VQOV 1VQLV 1VQPV 1VQMV 1KQSU 1JJ2U 1VQ9V 3CCLV 3CCVV 1W2BU 1Q81W 2D3OW 1VQ8V 1YJ9V 3CCSV 2OTLV 1VQ5V 1Q86W 1VQNV 5DM6V 3CMAV 3CCEV 3OW2U 1K9MW 1VQ6V 3G6EV 3CC2V 3CC7V 1QVGU 1VQ7V 4WFBV 4WF9V 3CCRV 1YIJV 1YJWV 1VQ4V 2OTJV 3I55V 1QVFU 1KD1W 1NJIW 1KC8W 1M1KW 3CD6V 1Q7YW 3CPWU 1YITV 1YHQV 3CCJV 3CCQV 1VQKV 3CC4V 3CXCU 3CCMV 3I56V 1N8RW 1K8AW 1M90W 1S72V 1YJNV 4WCEV 1R73A 3CCUV 3G71V 1K73W 3CMEV 2QA4V 1YI2V 1Q82W
chains in the Genus database with same CATH superfamily
1OCCC 2Q68A 3VBBA 2Z5UA 3CCLV 1H2SB 1E1RG 1E79G 2YI9A 4F6EA 3ABUA 1QR8A 3APQA 4FLTA 3OMNB 4A5UB 3IC9A 4WFBV 3W7XA 4BWAA 1YVWA 4E2LA 2EZOA 2F23A 4CC6A 3UT5A 5KHGA 3L70H 3RVYA 5IJ0B 1KMIZ 1AR4A 4FK5C 4K35A 1MG1A 2PY5A 1LR1A 3VQWA 1XL6A 3CC2V 4YJ2A 1VQ7V 3I5DA 4J9YB 1WB7A 1ZAUA 3CRMA 4DV0B 2XAJA 5J9PC 1OCOC 2JDIG 4YY3O 1QU7A 3DTUB 5EC1C 1TGOA 2H94A 3QG5A 4MVZA 4O4HA 1YXBA 4LF5O 5DM6V 2LJ2A 2JS3A 5ITZB 2O57A 2AHYA 2OTJV 4LF5B 3CXHF 5GTHZ 4U7OA 1AVMA 1P7BA 1PNMA 3BAAA 4X20A 5KHKA 3WG7B 2HFEC 1VF5B 4CH6A 1AR5A 1AJNA 5IYZB 2V4DA 2R9RB 1FXHA 5JH7A 1NBMG 3K5LA 5IYBO 3LDDA 4MW3A 5D5PA 5BXZA 1P4RA 3SDLA 1DLBA 5EIBC 1UFIA 2L35A 2E5LO 3AEIA 4TV9A 2DWEC 4I5SA 1ZWIC 4LF4O 2E5LB 2XASA 2QDOA 2OIGA 1YJ9V 4LF4B 2Q0AA 2GV9A 2OCHA 2EILB 4XDKA 5JJNB 1JFFB 1ROPA 2ZIMA 1OCCB 5LHHA 2ZM6O 3QO5A 2KG7B 1SKVA 2ZIOA 2GHYA 2DWDC 3SYOA 2ZM6B 4I55A 4G2KA 4TUYB 3RYCA 4DR3O 2XTAA 2YI8A 2WA3A 4GX2A 3CRAA 4BW5A 2RNBA 1Q8IA 4LWSB 2E74B 2OTLV 4DR3B 3NXSA 3IFXA 1QVGU 2QE7G 4UXNA 2IBZH 3FX7A 5LOVA 5KHHA 1XILA 4I0XB 1EZJA 5EZYA 3E8FA 3M8AA 5JQGB 1YIJV 4I7ZB 4JI2O 3LSSA 2LO1A 1LUWA 4FJCC 2AHZA 4FFBA 2Q5ZA 4JI2B 2EIMC 1EN5A 1K9MW 5LHGA 3CSXA 4PDRA 4U3JA 5H9CA 3GVMA 2Q8VA 3HR0A 1URFA 1KD1W 4DV7O 1NJIW 2HG5C 1DTOA 3ASOC 3CP1A 3CD6V 5KMGA 4IL6Z 3WFVA 2PZSA 4DV7B 4WCEV 4ZOLA 1IZ3A 1WN7A 4JI0O 3JAKA 1MSDA 2JEUA 2Y0PA 3X2QB 1AR1B 4JI0B 2GUZA 3CYOA 1WP7A 3K9SA 1H2NA 2UUBB 2G38A 3FKSG 4AI8A 1EN4A 1XHXA 4BW9A 1MZFA 3L74H 2IH3C 3ZS8C 3G71V 1KKDA 1R3IC 2WLHA 2OT5A 4I50B 1VQLV 1TA8A 1GN6A 3J80N 4DR7O 3E86A 4WFEA 3JARB 2Q69A 3B4SA 1GKFA 3A0HZ 4DR7B 1I08A 1AJQA 5HFMA 1EN6A 5H5NA 3AG4C 4AILC 5CA1A 4LF8O 3W7TA 1PV0A 2C2AA 1F51A 4LF8B 3ZEDA 4O4IA 2UXNA 1WLEA 5LMNO 1SQVH 4LF6O 4XDJA 4CS3A 4O4HB 1H8EG 4Z1VA 3JAWA 5LMNB 4LF6B 3ETEA 1VQ8V 2JK5C 4O2AA 1K5SA 3OM3B 2F4VO 2F1MA 1RFYA 2F4VB 2QWPB 1K5QA 1Q3EA 1QVFU 5CB4A 1NTMH 3K04A 5K1XA 2CDYA 1FFXA 2P7TC 4P9PA 2RDCA 5GONA 1B04A 1L1FA 2GTSA 1NVPD 4JASA 1AI6A 2UUAO 3W7SA 4GKKO 3ASOB 2AZ2A 2OWOA 1KYOF 2UUAB 4OPHA 4GKKB 3OUSA 3I55V 4KP4A 3CJHB 2QWNB 3JCZA 3FD9A 4K8ZA 1Y74A 2ZXWB 3AG3C 2LGQA 2ZCEA 1QQCA 2WLMA 3TGUH 4ICGA 4W4KA 3K79A 1I5YA 2A9HA 3Q4HB 4X66O 3EVKA 4R6ZA 1NKDA 5B1AC 4JI8O 4X66B 3STZC 3JD2A 1SA0B 4RAIA 5KUKA 4U3FH 4JI8B 1QBZA 4UVAA 3ZRSA 2DYRC 2Q4PA 2BSKA 1M9NA 3ABMC 4BR6A 4X1IB 3RYHA 4ZIBA 1YF2A 2DYSC 3BEHA 1LUVA 4Q20A 3SJCC 2CTQA 5CMUA 1BCCH 3TK1A 5LGTA 3E22A 1FXKA 3B09A 4BAYA 3EXAA 3U10A 4FFBB 3ABKC 1IXMA 2ZR2A 3CX5F 2BTQB 4JV5O 3CB2A 2CH7A 3KG2A 1Y76A 3AG2C 4JV5B 4DUYO 4IYIA 3IJ4A 1KU9A 4PA3A 4DUYB 1VQNV 2RN9A 2JGUA 3IC7A 2WLLA 3JD0A 1SZXA 1X4TA 4JZ2A 3P3PA 3GB7C 1GN2A 3FYIB 3AG1C 3RGBA 2QGNA 5KAFZ 4ZI7B 4EEQA 1ZTEA 4XBFA 1Z5VA 4JI7O 3VQVA 1XREA 4IIJA 3B40A 4JI7B 4CH5A 5KAIZ 4NVPA 2ZT9B 1M1KW 1R3LC 4NKGB 5B1OA 4JTCB 1XEQA 3AK1A 1FAFA 2BOCC 1Y66A 2D2CB 5KHIA 2Q67A 2UUCO 2R70A 5K1PA 2EIKC 2WLIB 3PJSK 2KSDA 1MSWD 2R9AA 4D6TH 3RWRD 4GYCB 1Q86W 4DK1A 1TUBB 1FXKC 3HKCB 2ZKOA 2WA4A 4YJ3A 2RCVA 3APOA 1N0JA 2NN4A 3KCYA 4PJ0Z 4TV8A 4IHJA 4DUZO 4HBNA 2WAMA 1TVKB 1RM1C 4DUZB 4X65O 3H1KH 4LH6A 3LDCA 1MABG 5L3FA 4X65B 3IGAC 3JALA 3K0GA 3A0BZ 1IURA 1AI7A 1R6TA 1PKXA 5DEDA 1NVPB 3H1HH 1OCRC 3ZRWB 3FB5C 2ZQMA 1IVSA 3CCUV 4MTXA 3WB2A 1ZX3A 5CB4B 1S77D 4WFGA 1WP8A 4B3MO 1FFXB 4B3SO 2IM9A 2AW9A 3G80A 4B3MB 3JASB 2QKAA 1MA1A 4B3SB 4X89A 2LP7A 1GN4A 3T1HO 1M90W 4FMTA 3UO2A 1CXZB 1DF5A 5AG2A 3T1HB 2E3CA 4KUMA 1VQ9V 3LDEA 3UCSC 3OAAG 1AI5A 4LP8A 5EBLC 4H33A 1E1QG 2R72A 4LNUB 2LW1A 4FLZA 3HKEA 3ASNB 1ORQC 1K8AW 2OYQA 3SJAC 4IGGA 4X1KB 4FZ0A 2HVKC 1XI1A 3BCCH 1SERA 2BOBC 2YDEA 2GSMB 1S3JA 3OD4A 2EULA 4AQYO 4X62O 3F5TA 1JQ0A 5C8YB 2H3OA 4AQYB 4X62B 5A2QN 1YITV 4X8AA 4MTGA 2UXCO 1OCZC 3DSQA 3ZIAG 1BHAA 3ZHVA 1PNKA 4I9QA 5LGUA 4WBNA 2UXCB 3R66A 5KHJA 5J2TA 1QR9A 2PTMA 3RT3C 2BE3A 4H37A 5IDJA 3TETA 1HR0O 4EB6B 1WA8A 1BQZA 1XNRO 1WJZA 2Q7GA 4FVMA 1HR0B 3ZHRA 1RM1B 5EK0A 4Z2WA 3VOUA 3CC4V 1XNRB 1NR7A 4JYCA 4JYBA 5IWAO 3WU2Z 4R7CA 2X6BA 3G67A 5LA6A 2W0XA 1PL4A 2OCCC 4K3AA 5IWAB 2Q6AA 2JIZG 1M57B 1XHZA 2PI5A 4K8XA 2F93B 1I0HA 1B3QA 3K08A 4IIJB 1V55B 3DGEA 3JYCA 2QM8A 4Q6GA 5EIBD 1JR9A 4DR6O 4PI0A 4X1YA 1VIBA 4DR6B 1M56B 4YY3B 1GAXA 3HKDA 5B66Z 2EIJC 3OEEG 3QO7A 1Q6UA 5LP6B 1K34A 2Y69C 5B3SB 3UM7A 4F4LA 2BCCH 2F95B 2QJ1A 4PHZA 2M6YA 4PI2A 4YJ3B 3QNEA 1W2BU 1N34O 4HNAA 2YS8A 4J7JA 4TV8B 4IHJB 2QKSA 2LW7A 2ILMA 1VQ4V 2UU9O 3K5MA 1YSCA 2QKCA 1PNLA 5JVDB 2YEVA 2JEXA 3C3TA 4DW1A 5IY5C 3H1JH 2NNUA 1D2DA 3F5WC 2F66C 2PYLA 3L71H 5EBWC 2QWRB 1QNMA 2W6JG 2P6JA 2HHHO 4I4TA 2Q73A 5B1NA 4JZGA 4NTWA 1VP7A 4NTXA 2HHHB 4NTYA 3CRRA 3A8TA 4FZ1A 1TUEB 1U96A 2ZE5A 2WWWA 2HJFC 1HP8A 4G28B 2UXBO 5DECA 3FFQA 4W4LA 2P4KA 1R1BA 3ZJZA 2UXBB 3CCEV 3SPIA 4ZHQA 4JI6O 5FPOA 1Q6HA 3M7MX 5LL6Y 2V7QG 2Z3YA 4JI6B 1EZVH 4J7KA 4MVSA 3TXQA 3OR7C 3S3XA 4DV6O 2YIAA 2OCCB 4CBCA 1P49A 4FLVA 1K33A 3NR7A 1VQOV 1BZKA 4DV6B 3T4DA 5HFLA 2YC0A 5BMVA 2ADQB 4DYLA 1F7YA 3OUFA 2V1DA 2WSSG 4IT5A 1FJGO 4DK0A 1K97A 5IJ9A 4TQDA 4UUJC 4P9OA 1FJGB 2GTAA 1OCOB 1HNWO 3E89A 3OGCC 2QSAA 2WLJA 3A0RA 2N05A 1HNWB 3N2GA 1P84F 4D7SA 1GM8A 1I94O 4P30A 1O9GA 1KQSU 2XNDG 3T2MA 1G4YB 2VWJA 2NLJC 2QTOA 2RQ6A 1I94B 5CA0A 1XMQO 4ABMA 1ZL8A 4MS2A 3O65A 5KX5B 1T5EA 1MNGA 1K7DA 3P30A 1U97A 1N33O 3T4ZA 3P32A 4WBNB 5EYPA 1N33B 2DJVA 5LYJA 1FFTB 3BABA 1S5JA 3VQXA 4EFBA 3K5OA 1HW7A 3SPGA 4UCUA 5FNVA 4DV4O 2A7WA 3OR6C 4HAMA 2Y4UA 3UT5B 4DV4B 5IY5B 3TCUA 3CCJV 2CTPA 3B2EE 4DXWA 4J7ZA 1ENVA 3E8BA 1R3KC 2XHBA 5L3BA 4FFKA 3N27A 2IW5A 4YJ2B 4PELA 1YCIA 3F7YC 4EKWA 4JI1O 2XAFA 4BIOA 2DE0X 3H1IH 3CS5A 4JI1B 3RFRA 2EX3A 1QLEC 3QTCA 2XAGA 5LBQA 2QM4A 4WFFA 1H2GA 3OFNG 1NR1A 2ITDC 2B1GA 4UFZA 2HJDA 4MVOA 4X20B 4WF9V 1QHTA 4UV8A 3BRCA 4JYAO 3MD0A 2PF4E 1KP2A 4JYAB 3BFRA 2EIMB 2Z0AA 5JH7B 1ZSPA 4PA4A 4QPJA 2YEVB 1K4CC 3K03A 2XAQA 3AK2A 3L72H 3E35A 3ZN1A 1YJWV 4KHPO 1RSOA 4QE9A 4TV9B 4KHPB 1WAZA 4QJFB 4JAVA 4QPKA 2IH1C 1BS3A 1AB3A 2ZD9A 3SYAA 2YIBA 4I4TB 3K58A 1D5NA 2ZE8A 1QCEA 4K0KO 1HNZO 2B9ZA 4K0KB 1HNZB 4LF7O 3WB0A 4I55B 3ZHQA 3RYIA 1M93A 3RYCB 5B1BC 3OEHG 5LXTA 4TT3G 1L8DA 4PA7A 1S5LZ 4L87A 3VQYA 4ZKIA 1S0VA 1MZEA 4O4JA 3ABLC 5LOVB 4FLYA 1V54C 5EZYB 2CTWA 5GW7A 1SQGA 4GZRB 3DC5A 4EFEA 3DXRA 4RO2A 5BMVB 3AG4B 4MW8A 2QEXV 4U3JB 1VQMV 1X59A 2P67A 1SC5B 2VQFO 4JI4O 2LFRA 4UVCA 5KMGB 1WPXA 3GWOA 3FAVA 2QWQB 3KKYA 2CK3G 2VQFB 1GN3A 1F4MA 4GX0A 4ZOLB 3JAKB 1WNSA 2JVDA 1F23A 1WPBA 4UVBA 3CCQV 2CUGA 1I5XA 2M7WA 2GUZB 2AZ0A 1S72V 1KECA 1FXVA 4U7NA 2FL4A 1IBKO 2Q9LA 3ZMSA 3S3WA 4RUEA 2ZE6A 3KZIZ 1IBKB 3CCVV 5L3GA 2HEPA 5EYPB 2RJZA 1COWG 1NTKH 3BVOA 3CRQA 3P3NA 3U11A 5LYJB 5IJ0A 2XAHA 4HYOA 1GO3F 4E4EA 1H2KA 4JAUA 1KC8W 2Y0IA 3MAQA 2EINC 4N23A 5KA6A 2IJJA 3CCMV 3T1CA 2H8PC 3ZHTA 4MVRA 2EBOA 3M99B 5KA5A 4LBEC 2UUCB 3E83A 3JD1A 2HP8A 1SRYA 3G6EV 4JAAA 5E1AC 5TISZ 3RW0A 1R6KA 1SETA 1FS0G 5FLXN 3AG3B 5H2FZ 1EFRG 2KKWA 5CA1B 3HKBA 1HNXO 3ZN0A 1AJPA 3QO8A 3OTFA 1XNQO 4DV2O 4O4LA 1HNXB 4UCVA 5B1AB 4O4IB 4DV2B 2KQXA 4O2BA 4UCSA 1SQBH 3ZMTA 1BMFG 4DRXA 4UCTA 5JJEB 2YXHA 4BIUA 2DYRB 3JAWB 3ABMB 4O2AB 1GM7A 2DYSB 3L9DA 3JD4A 4CC5A 5DN6G 4YHHO 1VF6A 1IX9A 1HDJA 4LFCO 3LSQA 2CAZC 4YHHB 4JI5O 1BGYH 3ABKB 4LFCB 2UXXA 2JRIA 4JI5B 5GONB 2E75B 1FPOA 3AG2B 3BPZA 1ZLZA 5L3EA 5JCOA 3SYPA 3D8CA 4B08A 1JFFA 2R9IA 4LCUC 1RSOB 2KG7A 2PYJA 4TQFA 3SPHA 2K9PA 2MW2B 4TUYA 3OW2U 2ITCC 1XMOO 3OMAB 3D36A 4X88A 3C3SA 1Y74B 3AG1B 4B7EA 1DF4A 1SS3A 4LWSA 2DQ0A 1US6A 2X6CA 2CTRA 4G27B 3SYCA 4PD4F 3TJTA 5IE9A 1Z5WA 3W7UA 4ZBMA 4I0XA 4PV1B 3WG7C 4AHCA 1JJ2U 2B1IA 3RYIB 5JQGA 5BY1A 2EINB 5BZBA 2BSKB 2FKXA 3RYHB 4GX5A 2EIKB 4MTOA 1N8RW 2A06H 4MVUA 1AILA 3K9AA 1JJOA 1W59A 4D7TA 1VF6C 1Y4MA 3K59A 3AK3A 1YEWA 3E22B 1FXKB 4L8JA 1H2LA 3CHXA 1SQFA 1OHHG 1SESA 4GX1A 4CS2A 1CPYA 2CH7B 2P5OA 1Y67A 2CGNA 3ETGA 1S76D 1Y76B 1NT2B 1NTZH 2FTKA 5JCOC 2DQ3A 2EILC 4KFMA 1JCHA 3FB7C 3FAVB 3SPCA 2PUSA 5EBMC 4J42A 1QLNA 2WLLB 1XOUA 2X7RB 2WLKA 3D36C 5F2VO 1JVMA 4I50A 1GM9A 4NR1A 1OCRB 4UV9A 1BQ0A 1KB9F 3TXSA 1KUQA 2EJRA 3JARA 3C90A 3B8MA 2YICA 3THOA 1SQQH 4OGQB 1AROP 2CE4A 4DV0O 1A32A 2PI4A 1EM1A 3ML0A 1YHQV 5FL7G 2P06A 5IT9N 1JX9A 5LMUO 3CMEV 5E79Z 4JTAB 4LR3A 5LMUB 1VQPV 3UQ8A 1Q81W 4J80A 4F6RA 3BY6A 3L73H 4X64O 3X2QC 1H2MA 3HKBB 1N34B 4QIWF 1BE3H 1N4CA 1UPGA 4X64B 3RBZA 1AP6A 1VF7A 3E8HA 4O4LB 1W0KG 2UU9B 4J11A 2IJIA 4O2BB 2YIDA 5D5QA 3OTOO 2QA4V 3UO3A 3JALB 1PP9H 2X0LA 2N74A 3SJQC 1YZBA 2E76B 4DRXB 3OTOB 3ZCCA 2HLDG 2BTOA 1RP3B 3E2EA 1RPRA 1KBHA 3JSNA 1M5IA 1R3JC 2HKOA 4UB6Z 1OCZB 2QR4A 1P7GA 4CS4A 4FM1A 4MT8A 1J95A 2FB5A 5FPRA 2ZNIA 2GBOA 3QVNA 3JD3A 4B3TO 4DV5O 3CJHA 3FB8C 5L3CA 2VWKA 4B3TB 4DV5B 2IU3A 4MTFA 1VQ5V 4RUFA 4CH4A 2P90A 2Y4TA 4BIZA 3L75H 4PA9A 1H38A 4OPAA 3Q4HA 2Q0OC 1VQKV 3AG7A 5H6QA 1SA0A 1PM9A 1L0NH 1NU1H 2YXYA 1XL4A 1S5HC 4QGPA 1IBLO 4X1IA 3HKEB 3SJBC 2EJ7A 3FYEB 2GDSA 4DV3O 1IBLB 3BA8A 3J7AU 4JPRA 3JAMN 1MMMA 1YTFB 2VS0A 4DV3B 5CBGA 4KXRA 3ZX6A 1LNQA 3ZRXA 2EIJB 2BTQA 1B6QA 2Y69B 4FPPA 4ASUG 1Q43A 1THZA 3U0ZA 3H1LH 3OT7A 4LF9O 1XMQB 1JOYA 3PN1A 4LH7A 2B5UA 2JGDA 3CRCA 3LNNA 4LF9B 2W6IG 5J2TB 1IBMO 1WA8B 1H8HG 1XDCA 1VEWA 1IBMB 2ZXWC 2UUBO 1JPXA 3N2KA 4ZI7A 2EZPA 5B5EZ 4MVMA 2QWOB 1M4UA 3RYFA 1DGSA 2OIEA 1BL8A 5LA6B 2ZR3A 1FD9A 5CA3A 1XUQA 4RQEA 2XOKG 3DC6A 1G8MA 3K0DA 1G1XB 4QNHB 1KKCA 3ZHSA 2F43G 1HWYA 2WLIA 3WB1A 2Q7HA 2XT9A 1BT8A 4YXWG 4NXMO 3LSUA 3ZRVA 4X1YB 1TUBA 5LGNA 3HKCA 2ZDIA 3I56V 4NXMB 3HKDB 3R65A 4C7UA 5CBFA 1NH2D 4FIPC 4UCOA 1UJWB 3CCSV 1TAEA 1TVKA 1BSMA 2LFSA 3MHHC 3W7WA 4J9ZB 1FYJA 4B3RO 4QE7A 4FLUA 2DOSA 4YIPA 3BA9A 3OGIB 3CE2A 4RWUA 4B3RB 4F6RB 2ETNA 4HNAB 3SPJA 1JMKC 1NI8A 3KCXA 3GWKC 4UB8Z 4LFBO 1IDSA 3H01A 3ZRWA 2RMKB 2XUMA 2W0FC 4LFBB 3B77A 1OV9A 1N0NA 2ZINA 3CC7V 1KP3A 4CH3A 1Z2GA 3LNMB 2A0LA 4I9WA 4GCZA 1VARA 5JJJB 4IYHA 2ODMA 4MSWC 3RVZA 3JASA 4PDMA 3ZMZA 4GUNA 5IYCO 1B06A 2P22C 1PPJH 3RN4A 3JATA 2QTSA 4UCRA 3UKMA 1Q7YW 2ZDIC 3JCUZ 4LF7B 4LNUA 5CBHA 2YIBD 2IJKA 4ZHQB 1GTOA 3D3QA 3ETQA 2UXDO 4P2ZA 1SF9A 2ZNJA 3ABTA 2K1EA 4X1KA 2UXDB 4GLXA 5BR8O 1Y6XA 5KUMA 3A2FA 1D5AA 5BR8B 4GKJO 4JYYA 1R73A 4OX9O 4FM2A 5C8YA 1R6NA 4WFAV 4GKJB 5IJ9B 4OX9B 1QLEB 1L0LH 5J2UA 4PDLA 2X6AA 3EFFK 4JI4B 3N2GB 4N21A 3K5NA 4NYKA 2AXTZ 4DR5O 4EB6A 5CA0B 4DR2O 1ZL8B 4DR5B 2MK3A 4HZ3A 3O9OA 4DR2B 3CEIA 1VQ6V 1OJHA 2JGDB 2YUAA 4J41A 1CEZA 1EBOA 2WLNA 4FLWA 2JS5A 1FKAO 1YDXA 3IAYA 4GT1A 1SQXH 4DV1O 2A3QA 3J81N 4LC1A 1VMGA 2Q7EA 3K3WA 4DV1B 3JSLA 2VRZA 3N2KB 3D3IA 5JWPA 1K73W 4H13B 5FNVB 4X9QA 3ASNC 3OE7G 1NZ6A 3H9VA 3RYFB 3LUTB 2LQTA 1GK9A 4DO2A 2FMLA 5A9GA 2P4VA 4KL1A 3MDSA 1NH2B 4JTDB 2ADPA 2HVJC 3SYQA 5LP6A 1PL0A 5ITZA 2DMXA 3SGIA 4FLXA 5IYDO 4MVQA 2VQEO 2D3OW 4R50A 4DW0A 1XNQB 1F4NA 2VQEB 1SQPH 2YXLA 2ZE7A 4JI3O 1AP5A 3CCRV 4DR4O 5B1BB 5GTIZ 1O9HA 3ETDA 1J5EO 2IU0A 1N36O 1N32O 1SZTA 4JI3B 1NQTA 5IYZA 4DR4B 3OMIB 1K3EA 4H0LB 3SR2C 1J5EB 1N32B 1N36B 4H44B 4Z1MG 3ABLB 2IJHA 4WFHA 5JVDA 3K06A 1K4DC 4NXNO 1V54B 5CN0A 3MHSC 2YSUB 3ZHUA 2Y48A 4LFAO 3BHPA 4NXNB 1CP9A 4TOIA 2LGWA 1Q5OA 3FB6C 4B7KA 1Q6IA 2WPDG 4LFAB 4YIOA 1XBLA 5LHIA 1AI4A 1M57C 1YI2V 4JGSA 1WB8A 2JJ1G 1V55C 4PA6A 3ZMVA 1M56C 2AGAA 4CZZA 4JF3A 1OZ0A 5C93A 3QF7A 5LP6C 1XMOB 3ZBHA 3G6BA 1GMGA 2DW4A 4RQFA 5KLVH 5B3SC 4FM0A 1I7FA 5EC2C 3JATB 3G4SV 2N04A 3T1YO 2JJ2G 1BHBA 3EHBB 4NB5A 1V9PA 1W0JG 5L3DA 3T1YB 2NR5A 3CMAV 1XQ8A 3STLC 4OXSA 3ICXA 3CWBH 1G6UA 2DN9A 5LXTB 3K57A 4DR1O 4J10A 1ZUQA 3HPLC 3F7VC 1DK1A 4DR1B 3CXCU 1PD3A 4R8CA 4O4JB 1YJNV 3E8GA 2HR3A 1YTFD 4PDVA 1Q90D 4TWKA 2QM7A 3B8NA 4XDLA 1MOFA 3DXRB 2KB1A 2ATKC 5H6RA 1NS1A 2ARHA 1JA8A 2A79B 2FYUH 1GH6A 4TSFG 3CPWU 2PGGA 2CGOA 1GRJA 5KX5A 2L6LA 3HB3B 1RPOA 3ZMUA 1K92A 5J2UB 1IXBA 1Q82W
chains in the Genus database with same CATH topology
1OCCC 2EIMB 2Q68A 3VBBA 2Z5UA 2EIKC 2WLIB 3PJSK 1MSWD 1XL4A 1S5HC 3CCLV 1E1RG 1E79G 4PA4A 3ABUA 4QPJA 1QR8A 2YEVB 1Q86W 1K4CC 3K03A 2XAQA 1FXKC 3OMNB 3E35A 3ZN1A 4WFBV 3FYEB 1YJWV 3W7XA 4QE9A 4JPRA 4E2LA 2EZOA 1YTFB 5CBGA 4QJFB 4JAVA 4QPKA 2IH1C 2ZD9A 2WAMA 3SYAA 1RM1C 3RVYA 1LNQA 3ZRXA 2EIJB 4FK5C 3LDCA 1B6QA 1MABG 5L3FA 1QCEA 2Y69B 1MG1A 4FPPA 4ASUG 1THZA 3IGAC 3K0GA 1XL6A 3CC2V 1VQ7V 1AI7A 1JOYA 1PKXA 4J9YB 2B5UA 1NVPB 1OCRC 2W6IG 3ZRWB 5B1BC 3FB5C 3OEHG 2XAJA 2ZQMA 4TT3G 4PA7A 5J9PC 3CCUV 1OCOC 4MTXA 2JDIG 3DTUB 5EC1C 4L87A 2H94A 1H8HG 2ZXWC 4ZKIA 1S0VA 1JPXA 3ABLC 4MVZA 1S77D 4WFGA 2EZPA 5DM6V 1V54C 4MVMA 2AHYA 2OTJV 4U7OA 5GW7A 4X89A 1P7BA 2LP7A 1PNMA 4RO2A 1BL8A 1M90W 4FMTA 3WG7B 2ZR3A 3AG4B 5CA3A 4RQEA 2HFEC 1DF5A 2XOKG 4MW8A 2QEXV 1G8MA 4KUMA 3K0DA 1VQMV 1VQ9V 3LDEA 2P67A 3OAAG 1AI5A 1AJNA 2LFRA 4QNHB 4LP8A 4UVCA 2R9RB 4H33A 1WPXA 3GWOA 5EBLC 2F43G 1E1QG 2WLIA 1HWYA 2CK3G 1FXHA 1F4MA 4GX0A 1NBMG 4YXWG 1F23A 5IYBO 3LDDA 4UVBA 3ZRVA 5LGNA 3CCQV 4MW3A 1I5XA 2M7WA 3ASNB 2ZDIA 1ORQC 3I56V 1K8AW 1P4RA 1S72V 1DLBA 1KECA 1FXVA 4U7NA 3AEIA 3R65A 3ZMSA 2DWEC 5CBFA 4I5SA 1ZWIC 2HVKC 4RUEA 1NH2D 4FIPC 2XASA 3CCVV 5L3GA 1SERA 1UJWB 2BOBC 1YJ9V 3CCSV 2GSMB 1COWG 1S3JA 2LFSA 3MHHC 2XAHA 3W7WA 4J9ZB 4HYOA 1GO3F 1JQ0A 2EILB 4JAUA 4XDKA 1ROPA 1KC8W 4QE7A 1OCCB 5LHHA 1YITV 2EINC 3QO5A 4N23A 5KA6A 4X8AA 2IJJA 4MTGA 3CCMV 1OCZC 3T1CA 2GHYA 2DWDC 3SPJA 3SYOA 2H8PC 3ZIAG 1BHAA 1PNKA 4G2KA 4MVRA 5LGUA 2EBOA 3H01A 3ZRWA 3M99B 5KA5A 1QR9A 4GX2A 4LBEC 4BW5A 3E83A 3JD1A 2W0FC 2OTLV 4H37A 5IDJA 3B77A 3NXSA 3IFXA 1SRYA 3G6EV 5E1AC 3TETA 3CC7V 1KP3A 2QE7G 1QVGU 4UXNA 3RW0A 1R6KA 3LNMB 1SETA 2A0LA 4I9WA 1FS0G 1RM1B 5EK0A 3AG3B 4GCZA 3VOUA 1EFRG 3CC4V 1EZJA 3E8FA 1NR7A 3ZN0A 4JYCA 1AJPA 3QO8A 4MSWC 3RVZA 1YIJV 3LSSA 4FJCC 4JYBA 4PDMA 2AHZA 4R7CA 3ZMZA 2X6BA 5B1AB 2EIMC 2OCCC 5IYCO 1K9MW 5LHGA 3ZMTA 2Q6AA 2JIZG 4PDRA 1BMFG 5H9CA 1M57B 4BIUA 2DYRB 1KD1W 1NJIW 2PI5A 2HG5C 3ABMB 3UKMA 1DTOA 3ASOC 3CP1A 1Q7YW 3CD6V 2ZDIC 3WFVA 1GM7A 2DYSB 5CBHA 3JD4A 4WCEV 3K08A 1V55B 3DGEA 3JYCA 2QM8A 5DN6G 2IJKA 1GTOA 2JEUA 3X2QB 1AR1B 3CYOA 1M56B 4P2ZA 3LSQA 3ABTA 2K1EA 2EIJC 3OEEG 3QO7A 3ABKB 1K34A 2UXXA 2Y69C 5B3SB 3FKSG 5KUMA 3AG2B 5L3EA 3UM7A 4F4LA 2IH3C 1R73A 3SYPA 3G71V 1KKDA 1R3IC 1R6NA 2WLHA 2OT5A 2R9IA 4LCUC 4WFAV 1VQLV 3QNEA 1W2BU 1QLEB 3SPHA 2QKSA 3OW2U 3E86A 4WFEA 2ITCC 4PDLA 2Q69A 2X6AA 3D36A 3EFFK 3OMAB 4X88A 1VQ4V 1GKFA 3AG1B 4N21A 1DF4A 1YSCA 1PNLA 2DQ0A 2JEXA 2YEVA 2X6CA 4G27B 3SYCA 1AJQA 5HFMA 5IY5C 3W7UA 2NNUA 3F5WC 2MK3A 4HZ3A 4ZBMA 3WG7C 1VQ6V 1JJ2U 3AG4C 5EBWC 2B1IA 3W7TA 2W6JG 1CEZA 1EBOA 2P6JA 2C2AA 2WLNA 2EINB 1F51A 5BZBA 4GT1A 5B1NA 2UXNA 1WLEA 4LC1A 4GX5A 3K3WA 4XDJA 2EIKB 4MTOA 1N8RW 4MVUA 1TUEB 1H8EG 3K9AA 3D3IA 1K73W 1Y4MA 2WWWA 3ETEA 2JK5C 1VQ8V 3ASNC 1K5SA 3OM3B 3OE7G 2HJFC 4G28B 1FXKB 3ZJZA 3LUTB 3CCEV 3SPIA 1K5QA 1OHHG 1SESA 4GX1A 1CPYA 1GK9A 4DO2A 3ETGA 1S76D 1QVFU 2V7QG 2Z3YA 3K04A 1NH2B 4MVSA 2FTKA 4JTDB 2HVJC 3SYQA 3OR7C 2DQ3A 2EILC 1PL0A 2P7TC 4KFMA 4P9PA 1JCHA 2OCCB 3FB7C 4CBCA 1L1FA 3SPCA 1K33A 1VQOV 5EBMC 1NVPD 5IYDO 4MVQA 3T4DA 1QLNA 4JASA 5HFLA 2D3OW 2WLLB 1AI6A 4R50A 3W7SA 3ASOB 1F4NA 2V1DA 2X7RB 3OUFA 2WLKA 2WSSG 1JVMA 1GM9A 1K97A 1OCRB 3CCRV 4UV9A 5B1BB 3ETDA 3OUSA 4UUJC 3I55V 4P9OA 2IU0A 4KP4A 1SZTA 1OCOB 1NQTA 2EJRA 3OMIB 3E89A 1K3EA 3JCZA 3OGCC 2WLJA 3A0RA 3B8MA 2ZXWB 3AG3C 3ABLB 1GM8A 4Z1MG 2IJHA 4WFHA 4P30A 3K06A 1K4DC 2WLMA 1V54B 5CN0A 2XNDG 3T2MA 1G4YB 1KQSU 2NLJC 2QTOA 3MHSC 3K79A 2YSUB 1I5YA 2Y48A 2A9HA 4MS2A 1CP9A 1AROP 4R6ZA 1NKDA 1K7DA 5B1AC 3P30A 3FB6C 2WPDG 3T4ZA 3P32A 2PI4A 3STZC 3JD2A 4RAIA 5LHIA 3ML0A 5KUKA 1YHQV 5FL7G 1QBZA 1AI4A 1M57C 1FFTB 1JX9A 4UVAA 3ZRSA 2DYRC 1M9NA 3ABMC 3CMEV 1YI2V 4JTAB 2DYSC 3BEHA 4JGSA 3SPGA 1VQPV 4Q20A 1Q81W 2JJ1G 1V55C 4PA6A 3BY6A 5CMUA 3X2QC 3TK1A 3ZMVA 3OR6C 1M56C 5LGTA 1FXKA 4QIWF 4HAMA 4CZZA 4BAYA 4JF3A 1OZ0A 3RBZA 5IY5B 5C93A 3ABKC 3E8HA 3TCUA 1IXMA 3CCJV 1W0KG 2ZR2A 1GMGA 2DW4A 4RQFA 5B3SC 4DXWA 2IJIA 3KG2A 1ENVA 2QA4V 3E8BA 1R3KC 5EC2C 5L3BA 3AG2C 3G4SV 2IW5A 2X0LA 3SJQC 4PELA 2JJ2G 1BHBA 3EHBB 3F7YC 4EKWA 3ZCCA 2XAFA 4PA3A 1W0JG 2HLDG 5L3DA 1VQNV 3CMAV 3E2EA 3STLC 1RPRA 4OXSA 1R3JC 2HKOA 1QLEC 1OCZB 3IC7A 2WLLA 3JD0A 3HPLC 3F7VC 3GB7C 4MT8A 2XAGA 1J95A 3FYIB 3CXCU 1PD3A 3AG1C 4R8CA 5LBQA 1YJNV 3E8GA 2HR3A 4WFFA 3JD3A 1H2GA 3OFNG 4XBFA 3FB8C 1YTFD 1NR1A 5L3CA 4PDVA 4TWKA 2ITDC 2B1GA 2QM7A 3B8NA 2IU3A 4MTFA 4XDLA 4RUFA 1VQ5V 1MOFA 4MVOA 2KB1A 2ATKC 2P90A 5H6RA 4BIZA 4WF9V 2A79B 4UV8A 1M1KW 1R3LC 4TSFG 4PA9A 3CPWU 1H38A 5B1OA 4JTCB 1VQKV 3MD0A 2BOCC 3HB3B 1Y66A 1RPOA 1KP2A 3ZMUA 1K92A 2Q67A 5H6QA 1Q82W
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S V;  2QEX V;  4WFA V;  1VQO V;  1VQL V;  1VQP V;  1VQM V;  1KQS U;  1JJ2 U;  1VQ9 V;  3CCL V;  3CCV V;  1W2B U;  1Q81 W;  2D3O W;  1VQ8 V;  1YJ9 V;  3CCS V;  2OTL V;  1VQ5 V;  1Q86 W;  1VQN V;  5DM6 V;  3CMA V;  3CCE V;  3OW2 U;  1K9M W;  1VQ6 V;  3G6E V;  3CC2 V;  3CC7 V;  1QVG U;  1VQ7 V;  4WFB V;  4WF9 V;  3CCR V;  1YIJ V;  1YJW V;  1VQ4 V;  2OTJ V;  3I55 V;  1QVF U;  1KD1 W;  1NJI W;  1KC8 W;  1M1K W;  3CD6 V;  1Q7Y W;  3CPW U;  1YIT V;  1YHQ V;  3CCJ V;  3CCQ V;  1VQK V;  3CC4 V;  3CXC U;  3CCM V;  3I56 V;  1N8R W;  1K8A W;  1M90 W;  1S72 V;  1YJN V;  4WCE V;  1R73 A;  3CCU V;  3G71 V;  1K73 W;  3CME V;  2QA4 V;  1YI2 V;  1Q82 W; 
#chains in the Genus database with same CATH topology
 1OCC C;  2Q68 A;  3VBB A;  2Z5U A;  3CCL V;  1H2S B;  1E1R G;  1E79 G;  2YI9 A;  4F6E A;  3ABU A;  1QR8 A;  3APQ A;  4FLT A;  3OMN B;  4A5U B;  3IC9 A;  4WFB V;  3W7X A;  4BWA A;  1YVW A;  4E2L A;  2EZO A;  2F23 A;  4CC6 A;  3UT5 A;  5KHG A;  3L70 H;  3RVY A;  5IJ0 B;  1KMI Z;  1AR4 A;  4FK5 C;  4K35 A;  1MG1 A;  2PY5 A;  1LR1 A;  3VQW A;  1XL6 A;  3CC2 V;  4YJ2 A;  1VQ7 V;  3I5D A;  4J9Y B;  1WB7 A;  1ZAU A;  3CRM A;  4DV0 B;  2XAJ A;  5J9P C;  1OCO C;  2JDI G;  4YY3 O;  1QU7 A;  3DTU B;  5EC1 C;  1TGO A;  2H94 A;  3QG5 A;  4MVZ A;  4O4H A;  1YXB A;  4LF5 O;  5DM6 V;  2LJ2 A;  2JS3 A;  5ITZ B;  2O57 A;  2AHY A;  2OTJ V;  4LF5 B;  3CXH F;  5GTH Z;  4U7O A;  1AVM A;  1P7B A;  1PNM A;  3BAA A;  4X20 A;  5KHK A;  3WG7 B;  2HFE C;  1VF5 B;  4CH6 A;  1AR5 A;  1AJN A;  5IYZ B;  2V4D A;  2R9R B;  1FXH A;  5JH7 A;  1NBM G;  3K5L A;  5IYB O;  3LDD A;  4MW3 A;  5D5P A;  5BXZ A;  1P4R A;  3SDL A;  1DLB A;  5EIB C;  1UFI A;  2L35 A;  2E5L O;  3AEI A;  4TV9 A;  2DWE C;  4I5S A;  1ZWI C;  4LF4 O;  2E5L B;  2XAS A;  2QDO A;  2OIG A;  1YJ9 V;  4LF4 B;  2Q0A A;  2GV9 A;  2OCH A;  2EIL B;  4XDK A;  5JJN B;  1JFF B;  1ROP A;  2ZIM A;  1OCC B;  5LHH A;  2ZM6 O;  3QO5 A;  2KG7 B;  1SKV A;  2ZIO A;  2GHY A;  2DWD C;  3SYO A;  2ZM6 B;  4I55 A;  4G2K A;  4TUY B;  3RYC A;  4DR3 O;  2XTA A;  2YI8 A;  2WA3 A;  4GX2 A;  3CRA A;  4BW5 A;  2RNB A;  1Q8I A;  4LWS B;  2E74 B;  2OTL V;  4DR3 B;  3NXS A;  3IFX A;  1QVG U;  2QE7 G;  4UXN A;  2IBZ H;  3FX7 A;  5LOV A;  5KHH A;  1XIL A;  4I0X B;  1EZJ A;  5EZY A;  3E8F A;  3M8A A;  5JQG B;  1YIJ V;  4I7Z B;  4JI2 O;  3LSS A;  2LO1 A;  1LUW A;  4FJC C;  2AHZ A;  4FFB A;  2Q5Z A;  4JI2 B;  2EIM C;  1EN5 A;  1K9M W;  5LHG A;  3CSX A;  4PDR A;  4U3J A;  5H9C A;  3GVM A;  2Q8V A;  3HR0 A;  1URF A;  1KD1 W;  4DV7 O;  1NJI W;  2HG5 C;  1DTO A;  3ASO C;  3CP1 A;  3CD6 V;  5KMG A;  4IL6 Z;  3WFV A;  2PZS A;  4DV7 B;  4WCE V;  4ZOL A;  1IZ3 A;  1WN7 A;  4JI0 O;  3JAK A;  1MSD A;  2JEU A;  2Y0P A;  3X2Q B;  1AR1 B;  4JI0 B;  2GUZ A;  3CYO A;  1WP7 A;  3K9S A;  1H2N A;  2UUB B;  2G38 A;  3FKS G;  4AI8 A;  1EN4 A;  1XHX A;  4BW9 A;  1MZF A;  3L74 H;  2IH3 C;  3ZS8 C;  3G71 V;  1KKD A;  1R3I C;  2WLH A;  2OT5 A;  4I50 B;  1VQL V;  1TA8 A;  1GN6 A;  3J80 N;  4DR7 O;  3E86 A;  4WFE A;  3JAR B;  2Q69 A;  3B4S A;  1GKF A;  3A0H Z;  4DR7 B;  1I08 A;  1AJQ A;  5HFM A;  1EN6 A;  5H5N A;  3AG4 C;  4AIL C;  5CA1 A;  4LF8 O;  3W7T A;  1PV0 A;  2C2A A;  1F51 A;  4LF8 B;  3ZED A;  4O4I A;  2UXN A;  1WLE A;  5LMN O;  1SQV H;  4LF6 O;  4XDJ A;  4CS3 A;  4O4H B;  1H8E G;  4Z1V A;  3JAW A;  5LMN B;  4LF6 B;  3ETE A;  1VQ8 V;  2JK5 C;  4O2A A;  1K5S A;  3OM3 B;  2F4V O;  2F1M A;  1RFY A;  2F4V B;  2QWP B;  1K5Q A;  1Q3E A;  1QVF U;  5CB4 A;  1NTM H;  3K04 A;  5K1X A;  2CDY A;  1FFX A;  2P7T C;  4P9P A;  2RDC A;  5GON A;  1B04 A;  1L1F A;  2GTS A;  1NVP D;  4JAS A;  1AI6 A;  2UUA O;  3W7S A;  4GKK O;  3ASO B;  2AZ2 A;  2OWO A;  1KYO F;  2UUA B;  4OPH A;  4GKK B;  3OUS A;  3I55 V;  4KP4 A;  3CJH B;  2QWN B;  3JCZ A;  3FD9 A;  4K8Z A;  1Y74 A;  2ZXW B;  3AG3 C;  2LGQ A;  2ZCE A;  1QQC A;  2WLM A;  3TGU H;  4ICG A;  4W4K A;  3K79 A;  1I5Y A;  2A9H A;  3Q4H B;  4X66 O;  3EVK A;  4R6Z A;  1NKD A;  5B1A C;  4JI8 O;  4X66 B;  3STZ C;  3JD2 A;  1SA0 B;  4RAI A;  5KUK A;  4U3F H;  4JI8 B;  1QBZ A;  4UVA A;  3ZRS A;  2DYR C;  2Q4P A;  2BSK A;  1M9N A;  3ABM C;  4BR6 A;  4X1I B;  3RYH A;  4ZIB A;  1YF2 A;  2DYS C;  3BEH A;  1LUV A;  4Q20 A;  3SJC C;  2CTQ A;  5CMU A;  1BCC H;  3TK1 A;  5LGT A;  3E22 A;  1FXK A;  3B09 A;  4BAY A;  3EXA A;  3U10 A;  4FFB B;  3ABK C;  1IXM A;  2ZR2 A;  3CX5 F;  2BTQ B;  4JV5 O;  3CB2 A;  2CH7 A;  3KG2 A;  1Y76 A;  3AG2 C;  4JV5 B;  4DUY O;  4IYI A;  3IJ4 A;  1KU9 A;  4PA3 A;  4DUY B;  1VQN V;  2RN9 A;  2JGU A;  3IC7 A;  2WLL A;  3JD0 A;  1SZX A;  1X4T A;  4JZ2 A;  3P3P A;  3GB7 C;  1GN2 A;  3FYI B;  3AG1 C;  3RGB A;  2QGN A;  5KAF Z;  4ZI7 B;  4EEQ A;  1ZTE A;  4XBF A;  1Z5V A;  4JI7 O;  3VQV A;  1XRE A;  4IIJ A;  3B40 A;  4JI7 B;  4CH5 A;  5KAI Z;  4NVP A;  2ZT9 B;  1M1K W;  1R3L C;  4NKG B;  5B1O A;  4JTC B;  1XEQ A;  3AK1 A;  1FAF A;  2BOC C;  1Y66 A;  2D2C B;  5KHI A;  2Q67 A;  2UUC O;  2R70 A;  5K1P A;  2EIK C;  2WLI B;  3PJS K;  2KSD A;  1MSW D;  2R9A A;  4D6T H;  3RWR D;  4GYC B;  1Q86 W;  4DK1 A;  1TUB B;  1FXK C;  3HKC B;  2ZKO A;  2WA4 A;  4YJ3 A;  2RCV A;  3APO A;  1N0J A;  2NN4 A;  3KCY A;  4PJ0 Z;  4TV8 A;  4IHJ A;  4DUZ O;  4HBN A;  2WAM A;  1TVK B;  1RM1 C;  4DUZ B;  4X65 O;  3H1K H;  4LH6 A;  3LDC A;  1MAB G;  5L3F A;  4X65 B;  3IGA C;  3JAL A;  3K0G A;  3A0B Z;  1IUR A;  1AI7 A;  1R6T A;  1PKX A;  5DED A;  1NVP B;  3H1H H;  1OCR C;  3ZRW B;  3FB5 C;  2ZQM A;  1IVS A;  3CCU V;  4MTX A;  3WB2 A;  1ZX3 A;  5CB4 B;  1S77 D;  4WFG A;  1WP8 A;  4B3M O;  1FFX B;  4B3S O;  2IM9 A;  2AW9 A;  3G80 A;  4B3M B;  3JAS B;  2QKA A;  1MA1 A;  4B3S B;  4X89 A;  2LP7 A;  1GN4 A;  3T1H O;  1M90 W;  4FMT A;  3UO2 A;  1CXZ B;  1DF5 A;  5AG2 A;  3T1H B;  2E3C A;  4KUM A;  1VQ9 V;  3LDE A;  3UCS C;  3OAA G;  1AI5 A;  4LP8 A;  5EBL C;  4H33 A;  1E1Q G;  2R72 A;  4LNU B;  2LW1 A;  4FLZ A;  3HKE A;  3ASN B;  1ORQ C;  1K8A W;  2OYQ A;  3SJA C;  4IGG A;  4X1K B;  4FZ0 A;  2HVK C;  1XI1 A;  3BCC H;  1SER A;  2BOB C;  2YDE A;  2GSM B;  1S3J A;  3OD4 A;  2EUL A;  4AQY O;  4X62 O;  3F5T A;  1JQ0 A;  5C8Y B;  2H3O A;  4AQY B;  4X62 B;  5A2Q N;  1YIT V;  4X8A A;  4MTG A;  2UXC O;  1OCZ C;  3DSQ A;  3ZIA G;  1BHA A;  3ZHV A;  1PNK A;  4I9Q A;  5LGU A;  4WBN A;  2UXC B;  3R66 A;  5KHJ A;  5J2T A;  1QR9 A;  2PTM A;  3RT3 C;  2BE3 A;  4H37 A;  5IDJ A;  3TET A;  1HR0 O;  4EB6 B;  1WA8 A;  1BQZ A;  1XNR O;  1WJZ A;  2Q7G A;  4FVM A;  1HR0 B;  3ZHR A;  1RM1 B;  5EK0 A;  4Z2W A;  3VOU A;  3CC4 V;  1XNR B;  1NR7 A;  4JYC A;  4JYB A;  5IWA O;  3WU2 Z;  4R7C A;  2X6B A;  3G67 A;  5LA6 A;  2W0X A;  1PL4 A;  2OCC C;  4K3A A;  5IWA B;  2Q6A A;  2JIZ G;  1M57 B;  1XHZ A;  2PI5 A;  4K8X A;  2F93 B;  1I0H A;  1B3Q A;  3K08 A;  4IIJ B;  1V55 B;  3DGE A;  3JYC A;  2QM8 A;  4Q6G A;  5EIB D;  1JR9 A;  4DR6 O;  4PI0 A;  4X1Y A;  1VIB A;  4DR6 B;  1M56 B;  4YY3 B;  1GAX A;  3HKD A;  5B66 Z;  2EIJ C;  3OEE G;  3QO7 A;  1Q6U A;  5LP6 B;  1K34 A;  2Y69 C;  5B3S B;  3UM7 A;  4F4L A;  2BCC H;  2F95 B;  2QJ1 A;  4PHZ A;  2M6Y A;  4PI2 A;  4YJ3 B;  3QNE A;  1W2B U;  1N34 O;  4HNA A;  2YS8 A;  4J7J A;  4TV8 B;  4IHJ B;  2QKS A;  2LW7 A;  2ILM A;  1VQ4 V;  2UU9 O;  3K5M A;  1YSC A;  2QKC A;  1PNL A;  5JVD B;  2YEV A;  2JEX A;  3C3T A;  4DW1 A;  5IY5 C;  3H1J H;  2NNU A;  1D2D A;  3F5W C;  2F66 C;  2PYL A;  3L71 H;  5EBW C;  2QWR B;  1QNM A;  2W6J G;  2P6J A;  2HHH O;  4I4T A;  2Q73 A;  5B1N A;  4JZG A;  4NTW A;  1VP7 A;  4NTX A;  2HHH B;  4NTY A;  3CRR A;  3A8T A;  4FZ1 A;  1TUE B;  1U96 A;  2ZE5 A;  2WWW A;  2HJF C;  1HP8 A;  4G28 B;  2UXB O;  5DEC A;  3FFQ A;  4W4L A;  2P4K A;  1R1B A;  3ZJZ A;  2UXB B;  3CCE V;  3SPI A;  4ZHQ A;  4JI6 O;  5FPO A;  1Q6H A;  3M7M X;  5LL6 Y;  2V7Q G;  2Z3Y A;  4JI6 B;  1EZV H;  4J7K A;  4MVS A;  3TXQ A;  3OR7 C;  3S3X A;  4DV6 O;  2YIA A;  2OCC B;  4CBC A;  1P49 A;  4FLV A;  1K33 A;  3NR7 A;  1VQO V;  1BZK A;  4DV6 B;  3T4D A;  5HFL A;  2YC0 A;  5BMV A;  2ADQ B;  4DYL A;  1F7Y A;  3OUF A;  2V1D A;  2WSS G;  4IT5 A;  1FJG O;  4DK0 A;  1K97 A;  5IJ9 A;  4TQD A;  4UUJ C;  4P9O A;  1FJG B;  2GTA A;  1OCO B;  1HNW O;  3E89 A;  3OGC C;  2QSA A;  2WLJ A;  3A0R A;  2N05 A;  1HNW B;  3N2G A;  1P84 F;  4D7S A;  1GM8 A;  1I94 O;  4P30 A;  1O9G A;  1KQS U;  2XND G;  3T2M A;  1G4Y B;  2VWJ A;  2NLJ C;  2QTO A;  2RQ6 A;  1I94 B;  5CA0 A;  1XMQ O;  4ABM A;  1ZL8 A;  4MS2 A;  3O65 A;  5KX5 B;  1T5E A;  1MNG A;  1K7D A;  3P30 A;  1U97 A;  1N33 O;  3T4Z A;  3P32 A;  4WBN B;  5EYP A;  1N33 B;  2DJV A;  5LYJ A;  1FFT B;  3BAB A;  1S5J A;  3VQX A;  4EFB A;  3K5O A;  1HW7 A;  3SPG A;  4UCU A;  5FNV A;  4DV4 O;  2A7W A;  3OR6 C;  4HAM A;  2Y4U A;  3UT5 B;  4DV4 B;  5IY5 B;  3TCU A;  3CCJ V;  2CTP A;  3B2E E;  4DXW A;  4J7Z A;  1ENV A;  3E8B A;  1R3K C;  2XHB A;  5L3B A;  4FFK A;  3N27 A;  2IW5 A;  4YJ2 B;  4PEL A;  1YCI A;  3F7Y C;  4EKW A;  4JI1 O;  2XAF A;  4BIO A;  2DE0 X;  3H1I H;  3CS5 A;  4JI1 B;  3RFR A;  2EX3 A;  1QLE C;  3QTC A;  2XAG A;  5LBQ A;  2QM4 A;  4WFF A;  1H2G A;  3OFN G;  1NR1 A;  2ITD C;  2B1G A;  4UFZ A;  2HJD A;  4MVO A;  4X20 B;  4WF9 V;  1QHT A;  4UV8 A;  3BRC A;  4JYA O;  3MD0 A;  2PF4 E;  1KP2 A;  4JYA B;  3BFR A;  2EIM B;  2Z0A A;  5JH7 B;  1ZSP A;  4PA4 A;  4QPJ A;  2YEV B;  1K4C C;  3K03 A;  2XAQ A;  3AK2 A;  3L72 H;  3E35 A;  3ZN1 A;  1YJW V;  4KHP O;  1RSO A;  4QE9 A;  4TV9 B;  4KHP B;  1WAZ A;  4QJF B;  4JAV A;  4QPK A;  2IH1 C;  1BS3 A;  1AB3 A;  2ZD9 A;  3SYA A;  2YIB A;  4I4T B;  3K58 A;  1D5N A;  2ZE8 A;  1QCE A;  4K0K O;  1HNZ O;  2B9Z A;  4K0K B;  1HNZ B;  4LF7 O;  3WB0 A;  4I55 B;  3ZHQ A;  3RYI A;  1M93 A;  3RYC B;  5B1B C;  3OEH G;  5LXT A;  4TT3 G;  1L8D A;  4PA7 A;  1S5L Z;  4L87 A;  3VQY A;  4ZKI A;  1S0V A;  1MZE A;  4O4J A;  3ABL C;  5LOV B;  4FLY A;  1V54 C;  5EZY B;  2CTW A;  5GW7 A;  1SQG A;  4GZR B;  3DC5 A;  4EFE A;  3DXR A;  4RO2 A;  5BMV B;  3AG4 B;  4MW8 A;  2QEX V;  4U3J B;  1VQM V;  1X59 A;  2P67 A;  1SC5 B;  2VQF O;  4JI4 O;  2LFR A;  4UVC A;  5KMG B;  1WPX A;  3GWO A;  3FAV A;  2QWQ B;  3KKY A;  2CK3 G;  2VQF B;  1GN3 A;  1F4M A;  4GX0 A;  4ZOL B;  3JAK B;  1WNS A;  2JVD A;  1F23 A;  1WPB A;  4UVB A;  3CCQ V;  2CUG A;  1I5X A;  2M7W A;  2GUZ B;  2AZ0 A;  1S72 V;  1KEC A;  1FXV A;  4U7N A;  2FL4 A;  1IBK O;  2Q9L A;  3ZMS A;  3S3W A;  4RUE A;  2ZE6 A;  3KZI Z;  1IBK B;  3CCV V;  5L3G A;  2HEP A;  5EYP B;  2RJZ A;  1COW G;  1NTK H;  3BVO A;  3CRQ A;  3P3N A;  3U11 A;  5LYJ B;  5IJ0 A;  2XAH A;  4HYO A;  1GO3 F;  4E4E A;  1H2K A;  4JAU A;  1KC8 W;  2Y0I A;  3MAQ A;  2EIN C;  4N23 A;  5KA6 A;  2IJJ A;  3CCM V;  3T1C A;  2H8P C;  3ZHT A;  4MVR A;  2EBO A;  3M99 B;  5KA5 A;  4LBE C;  2UUC B;  3E83 A;  3JD1 A;  2HP8 A;  1SRY A;  3G6E V;  4JAA A;  5E1A C;  5TIS Z;  3RW0 A;  1R6K A;  1SET A;  1FS0 G;  5FLX N;  3AG3 B;  5H2F Z;  1EFR G;  2KKW A;  5CA1 B;  3HKB A;  1HNX O;  3ZN0 A;  1AJP A;  3QO8 A;  3OTF A;  1XNQ O;  4DV2 O;  4O4L A;  1HNX B;  4UCV A;  5B1A B;  4O4I B;  4DV2 B;  2KQX A;  4O2B A;  4UCS A;  1SQB H;  3ZMT A;  1BMF G;  4DRX A;  4UCT A;  5JJE B;  2YXH A;  4BIU A;  2DYR B;  3JAW B;  3ABM B;  4O2A B;  1GM7 A;  2DYS B;  3L9D A;  3JD4 A;  4CC5 A;  5DN6 G;  4YHH O;  1VF6 A;  1IX9 A;  1HDJ A;  4LFC O;  3LSQ A;  2CAZ C;  4YHH B;  4JI5 O;  1BGY H;  3ABK B;  4LFC B;  2UXX A;  2JRI A;  4JI5 B;  5GON B;  2E75 B;  1FPO A;  3AG2 B;  3BPZ A;  1ZLZ A;  5L3E A;  5JCO A;  3SYP A;  3D8C A;  4B08 A;  1JFF A;  2R9I A;  4LCU C;  1RSO B;  2KG7 A;  2PYJ A;  4TQF A;  3SPH A;  2K9P A;  2MW2 B;  4TUY A;  3OW2 U;  2ITC C;  1XMO O;  3OMA B;  3D36 A;  4X88 A;  3C3S A;  1Y74 B;  3AG1 B;  4B7E A;  1DF4 A;  1SS3 A;  4LWS A;  2DQ0 A;  1US6 A;  2X6C A;  2CTR A;  4G27 B;  3SYC A;  4PD4 F;  3TJT A;  5IE9 A;  1Z5W A;  3W7U A;  4ZBM A;  4I0X A;  4PV1 B;  3WG7 C;  4AHC A;  1JJ2 U;  2B1I A;  3RYI B;  5JQG A;  5BY1 A;  2EIN B;  5BZB A;  2BSK B;  2FKX A;  3RYH B;  4GX5 A;  2EIK B;  4MTO A;  1N8R W;  2A06 H;  4MVU A;  1AIL A;  3K9A A;  1JJO A;  1W59 A;  4D7T A;  1VF6 C;  1Y4M A;  3K59 A;  3AK3 A;  1YEW A;  3E22 B;  1FXK B;  4L8J A;  1H2L A;  3CHX A;  1SQF A;  1OHH G;  1SES A;  4GX1 A;  4CS2 A;  1CPY A;  2CH7 B;  2P5O A;  1Y67 A;  2CGN A;  3ETG A;  1S76 D;  1Y76 B;  1NT2 B;  1NTZ H;  2FTK A;  5JCO C;  2DQ3 A;  2EIL C;  4KFM A;  1JCH A;  3FB7 C;  3FAV B;  3SPC A;  2PUS A;  5EBM C;  4J42 A;  1QLN A;  2WLL B;  1XOU A;  2X7R B;  2WLK A;  3D36 C;  5F2V O;  1JVM A;  4I50 A;  1GM9 A;  4NR1 A;  1OCR B;  4UV9 A;  1BQ0 A;  1KB9 F;  3TXS A;  1KUQ A;  2EJR A;  3JAR A;  3C90 A;  3B8M A;  2YIC A;  3THO A;  1SQQ H;  4OGQ B;  1ARO P;  2CE4 A;  4DV0 O;  1A32 A;  2PI4 A;  1EM1 A;  3ML0 A;  1YHQ V;  5FL7 G;  2P06 A;  5IT9 N;  1JX9 A;  5LMU O;  3CME V;  5E79 Z;  4JTA B;  4LR3 A;  5LMU B;  1VQP V;  3UQ8 A;  1Q81 W;  4J80 A;  4F6R A;  3BY6 A;  3L73 H;  4X64 O;  3X2Q C;  1H2M A;  3HKB B;  1N34 B;  4QIW F;  1BE3 H;  1N4C A;  1UPG A;  4X64 B;  3RBZ A;  1AP6 A;  1VF7 A;  3E8H A;  4O4L B;  1W0K G;  2UU9 B;  4J11 A;  2IJI A;  4O2B B;  2YID A;  5D5Q A;  3OTO O;  2QA4 V;  3UO3 A;  3JAL B;  1PP9 H;  2X0L A;  2N74 A;  3SJQ C;  1YZB A;  2E76 B;  4DRX B;  3OTO B;  3ZCC A;  2HLD G;  2BTO A;  1RP3 B;  3E2E A;  1RPR A;  1KBH A;  3JSN A;  1M5I A;  1R3J C;  2HKO A;  4UB6 Z;  1OCZ B;  2QR4 A;  1P7G A;  4CS4 A;  4FM1 A;  4MT8 A;  1J95 A;  2FB5 A;  5FPR A;  2ZNI A;  2GBO A;  3QVN A;  3JD3 A;  4B3T O;  4DV5 O;  3CJH A;  3FB8 C;  5L3C A;  2VWK A;  4B3T B;  4DV5 B;  2IU3 A;  4MTF A;  1VQ5 V;  4RUF A;  4CH4 A;  2P90 A;  2Y4T A;  4BIZ A;  3L75 H;  4PA9 A;  1H38 A;  4OPA A;  3Q4H A;  2Q0O C;  1VQK V;  3AG7 A;  5H6Q A;  1SA0 A;  1PM9 A;  1L0N H;  1NU1 H;  2YXY A;  1XL4 A;  1S5H C;  4QGP A;  1IBL O;  4X1I A;  3HKE B;  3SJB C;  2EJ7 A;  3FYE B;  2GDS A;  4DV3 O;  1IBL B;  3BA8 A;  3J7A U;  4JPR A;  3JAM N;  1MMM A;  1YTF B;  2VS0 A;  4DV3 B;  5CBG A;  4KXR A;  3ZX6 A;  1LNQ A;  3ZRX A;  2EIJ B;  2BTQ A;  1B6Q A;  2Y69 B;  4FPP A;  4ASU G;  1Q43 A;  1THZ A;  3U0Z A;  3H1L H;  3OT7 A;  4LF9 O;  1XMQ B;  1JOY A;  3PN1 A;  4LH7 A;  2B5U A;  2JGD A;  3CRC A;  3LNN A;  4LF9 B;  2W6I G;  5J2T B;  1IBM O;  1WA8 B;  1H8H G;  1XDC A;  1VEW A;  1IBM B;  2ZXW C;  2UUB O;  1JPX A;  3N2K A;  4ZI7 A;  2EZP A;  5B5E Z;  4MVM A;  2QWO B;  1M4U A;  3RYF A;  1DGS A;  2OIE A;  1BL8 A;  5LA6 B;  2ZR3 A;  1FD9 A;  5CA3 A;  1XUQ A;  4RQE A;  2XOK G;  3DC6 A;  1G8M A;  3K0D A;  1G1X B;  4QNH B;  1KKC A;  3ZHS A;  2F43 G;  1HWY A;  2WLI A;  3WB1 A;  2Q7H A;  2XT9 A;  1BT8 A;  4YXW G;  4NXM O;  3LSU A;  3ZRV A;  4X1Y B;  1TUB A;  5LGN A;  3HKC A;  2ZDI A;  3I56 V;  4NXM B;  3HKD B;  3R65 A;  4C7U A;  5CBF A;  1NH2 D;  4FIP C;  4UCO A;  1UJW B;  3CCS V;  1TAE A;  1TVK A;  1BSM A;  2LFS A;  3MHH C;  3W7W A;  4J9Z B;  1FYJ A;  4B3R O;  4QE7 A;  4FLU A;  2DOS A;  4YIP A;  3BA9 A;  3OGI B;  3CE2 A;  4RWU A;  4B3R B;  4F6R B;  2ETN A;  4HNA B;  3SPJ A;  1JMK C;  1NI8 A;  3KCX A;  3GWK C;  4UB8 Z;  4LFB O;  1IDS A;  3H01 A;  3ZRW A;  2RMK B;  2XUM A;  2W0F C;  4LFB B;  3B77 A;  1OV9 A;  1N0N A;  2ZIN A;  3CC7 V;  1KP3 A;  4CH3 A;  1Z2G A;  3LNM B;  2A0L A;  4I9W A;  4GCZ A;  1VAR A;  5JJJ B;  4IYH A;  2ODM A;  4MSW C;  3RVZ A;  3JAS A;  4PDM A;  3ZMZ A;  4GUN A;  5IYC O;  1B06 A;  2P22 C;  1PPJ H;  3RN4 A;  3JAT A;  2QTS A;  4UCR A;  3UKM A;  1Q7Y W;  2ZDI C;  3JCU Z;  4LF7 B;  4LNU A;  5CBH A;  2YIB D;  2IJK A;  4ZHQ B;  1GTO A;  3D3Q A;  3ETQ A;  2UXD O;  4P2Z A;  1SF9 A;  2ZNJ A;  3ABT A;  2K1E A;  4X1K A;  2UXD B;  4GLX A;  5BR8 O;  1Y6X A;  5KUM A;  3A2F A;  1D5A A;  5BR8 B;  4GKJ O;  4JYY A;  1R73 A;  4OX9 O;  4FM2 A;  5C8Y A;  1R6N A;  4WFA V;  4GKJ B;  5IJ9 B;  4OX9 B;  1QLE B;  1L0L H;  5J2U A;  4PDL A;  2X6A A;  3EFF K;  4JI4 B;  3N2G B;  4N21 A;  3K5N A;  4NYK A;  2AXT Z;  4DR5 O;  4EB6 A;  5CA0 B;  4DR2 O;  1ZL8 B;  4DR5 B;  2MK3 A;  4HZ3 A;  3O9O A;  4DR2 B;  3CEI A;  1VQ6 V;  1OJH A;  2JGD B;  2YUA A;  4J41 A;  1CEZ A;  1EBO A;  2WLN A;  4FLW A;  2JS5 A;  1FKA O;  1YDX A;  3IAY A;  4GT1 A;  1SQX H;  4DV1 O;  2A3Q A;  3J81 N;  4LC1 A;  1VMG A;  2Q7E A;  3K3W A;  4DV1 B;  3JSL A;  2VRZ A;  3N2K B;  3D3I A;  5JWP A;  1K73 W;  4H13 B;  5FNV B;  4X9Q A;  3ASN C;  3OE7 G;  1NZ6 A;  3H9V A;  3RYF B;  3LUT B;  2LQT A;  1GK9 A;  4DO2 A;  2FML A;  5A9G A;  2P4V A;  4KL1 A;  3MDS A;  1NH2 B;  4JTD B;  2ADP A;  2HVJ C;  3SYQ A;  5LP6 A;  1PL0 A;  5ITZ A;  2DMX A;  3SGI A;  4FLX A;  5IYD O;  4MVQ A;  2VQE O;  2D3O W;  4R50 A;  4DW0 A;  1XNQ B;  1F4N A;  2VQE B;  1SQP H;  2YXL A;  2ZE7 A;  4JI3 O;  1AP5 A;  3CCR V;  4DR4 O;  5B1B B;  5GTI Z;  1O9H A;  3ETD A;  1J5E O;  2IU0 A;  1N36 O;  1N32 O;  1SZT A;  4JI3 B;  1NQT A;  5IYZ A;  4DR4 B;  3OMI B;  1K3E A;  4H0L B;  3SR2 C;  1J5E B;  1N32 B;  1N36 B;  4H44 B;  4Z1M G;  3ABL B;  2IJH A;  4WFH A;  5JVD A;  3K06 A;  1K4D C;  4NXN O;  1V54 B;  5CN0 A;  3MHS C;  2YSU B;  3ZHU A;  2Y48 A;  4LFA O;  3BHP A;  4NXN B;  1CP9 A;  4TOI A;  2LGW A;  1Q5O A;  3FB6 C;  4B7K A;  1Q6I A;  2WPD G;  4LFA B;  4YIO A;  1XBL A;  5LHI A;  1AI4 A;  1M57 C;  1YI2 V;  4JGS A;  1WB8 A;  2JJ1 G;  1V55 C;  4PA6 A;  3ZMV A;  1M56 C;  2AGA A;  4CZZ A;  4JF3 A;  1OZ0 A;  5C93 A;  3QF7 A;  5LP6 C;  1XMO B;  3ZBH A;  3G6B A;  1GMG A;  2DW4 A;  4RQF A;  5KLV H;  5B3S C;  4FM0 A;  1I7F A;  5EC2 C;  3JAT B;  3G4S V;  2N04 A;  3T1Y O;  2JJ2 G;  1BHB A;  3EHB B;  4NB5 A;  1V9P A;  1W0J G;  5L3D A;  3T1Y B;  2NR5 A;  3CMA V;  1XQ8 A;  3STL C;  4OXS A;  3ICX A;  3CWB H;  1G6U A;  2DN9 A;  5LXT B;  3K57 A;  4DR1 O;  4J10 A;  1ZUQ A;  3HPL C;  3F7V C;  1DK1 A;  4DR1 B;  3CXC U;  1PD3 A;  4R8C A;  4O4J B;  1YJN V;  3E8G A;  2HR3 A;  1YTF D;  4PDV A;  1Q90 D;  4TWK A;  2QM7 A;  3B8N A;  4XDL A;  1MOF A;  3DXR B;  2KB1 A;  2ATK C;  5H6R A;  1NS1 A;  2ARH A;  1JA8 A;  2A79 B;  2FYU H;  1GH6 A;  4TSF G;  3CPW U;  2PGG A;  2CGO A;  1GRJ A;  5KX5 A;  2L6L A;  3HB3 B;  1RPO A;  3ZMU A;  1K92 A;  5J2U B;  1IXB A;  1Q82 W; 
#chains in the Genus database with same CATH homology
 1OCC C;  2EIM B;  2Q68 A;  3VBB A;  2Z5U A;  2EIK C;  2WLI B;  3PJS K;  1MSW D;  1XL4 A;  1S5H C;  3CCL V;  1E1R G;  1E79 G;  4PA4 A;  3ABU A;  4QPJ A;  1QR8 A;  2YEV B;  1Q86 W;  1K4C C;  3K03 A;  2XAQ A;  1FXK C;  3OMN B;  3E35 A;  3ZN1 A;  4WFB V;  3FYE B;  1YJW V;  3W7X A;  4QE9 A;  4JPR A;  4E2L A;  2EZO A;  1YTF B;  5CBG A;  4QJF B;  4JAV A;  4QPK A;  2IH1 C;  2ZD9 A;  2WAM A;  3SYA A;  1RM1 C;  3RVY A;  1LNQ A;  3ZRX A;  2EIJ B;  4FK5 C;  3LDC A;  1B6Q A;  1MAB G;  5L3F A;  1QCE A;  2Y69 B;  1MG1 A;  4FPP A;  4ASU G;  1THZ A;  3IGA C;  3K0G A;  1XL6 A;  3CC2 V;  1VQ7 V;  1AI7 A;  1JOY A;  1PKX A;  4J9Y B;  2B5U A;  1NVP B;  1OCR C;  2W6I G;  3ZRW B;  5B1B C;  3FB5 C;  3OEH G;  2XAJ A;  2ZQM A;  4TT3 G;  4PA7 A;  5J9P C;  3CCU V;  1OCO C;  4MTX A;  2JDI G;  3DTU B;  5EC1 C;  4L87 A;  2H94 A;  1H8H G;  2ZXW C;  4ZKI A;  1S0V A;  1JPX A;  3ABL C;  4MVZ A;  1S77 D;  4WFG A;  2EZP A;  5DM6 V;  1V54 C;  4MVM A;  2AHY A;  2OTJ V;  4U7O A;  5GW7 A;  4X89 A;  1P7B A;  2LP7 A;  1PNM A;  4RO2 A;  1BL8 A;  1M90 W;  4FMT A;  3WG7 B;  2ZR3 A;  3AG4 B;  5CA3 A;  4RQE A;  2HFE C;  1DF5 A;  2XOK G;  4MW8 A;  2QEX V;  1G8M A;  4KUM A;  3K0D A;  1VQM V;  1VQ9 V;  3LDE A;  2P67 A;  3OAA G;  1AI5 A;  1AJN A;  2LFR A;  4QNH B;  4LP8 A;  4UVC A;  2R9R B;  4H33 A;  1WPX A;  3GWO A;  5EBL C;  2F43 G;  1E1Q G;  2WLI A;  1HWY A;  2CK3 G;  1FXH A;  1F4M A;  4GX0 A;  1NBM G;  4YXW G;  1F23 A;  5IYB O;  3LDD A;  4UVB A;  3ZRV A;  5LGN A;  3CCQ V;  4MW3 A;  1I5X A;  2M7W A;  3ASN B;  2ZDI A;  1ORQ C;  3I56 V;  1K8A W;  1P4R A;  1S72 V;  1DLB A;  1KEC A;  1FXV A;  4U7N A;  3AEI A;  3R65 A;  3ZMS A;  2DWE C;  5CBF A;  4I5S A;  1ZWI C;  2HVK C;  4RUE A;  1NH2 D;  4FIP C;  2XAS A;  3CCV V;  5L3G A;  1SER A;  1UJW B;  2BOB C;  1YJ9 V;  3CCS V;  2GSM B;  1COW G;  1S3J A;  2LFS A;  3MHH C;  2XAH A;  3W7W A;  4J9Z B;  4HYO A;  1GO3 F;  1JQ0 A;  2EIL B;  4JAU A;  4XDK A;  1ROP A;  1KC8 W;  4QE7 A;  1OCC B;  5LHH A;  1YIT V;  2EIN C;  3QO5 A;  4N23 A;  5KA6 A;  4X8A A;  2IJJ A;  4MTG A;  3CCM V;  1OCZ C;  3T1C A;  2GHY A;  2DWD C;  3SPJ A;  3SYO A;  2H8P C;  3ZIA G;  1BHA A;  1PNK A;  4G2K A;  4MVR A;  5LGU A;  2EBO A;  3H01 A;  3ZRW A;  3M99 B;  5KA5 A;  1QR9 A;  4GX2 A;  4LBE C;  4BW5 A;  3E83 A;  3JD1 A;  2W0F C;  2OTL V;  4H37 A;  5IDJ A;  3B77 A;  3NXS A;  3IFX A;  1SRY A;  3G6E V;  5E1A C;  3TET A;  3CC7 V;  1KP3 A;  2QE7 G;  1QVG U;  4UXN A;  3RW0 A;  1R6K A;  3LNM B;  1SET A;  2A0L A;  4I9W A;  1FS0 G;  1RM1 B;  5EK0 A;  3AG3 B;  4GCZ A;  3VOU A;  1EFR G;  3CC4 V;  1EZJ A;  3E8F A;  1NR7 A;  3ZN0 A;  4JYC A;  1AJP A;  3QO8 A;  4MSW C;  3RVZ A;  1YIJ V;  3LSS A;  4FJC C;  4JYB A;  4PDM A;  2AHZ A;  4R7C A;  3ZMZ A;  2X6B A;  5B1A B;  2EIM C;  2OCC C;  5IYC O;  1K9M W;  5LHG A;  3ZMT A;  2Q6A A;  2JIZ G;  4PDR A;  1BMF G;  5H9C A;  1M57 B;  4BIU A;  2DYR B;  1KD1 W;  1NJI W;  2PI5 A;  2HG5 C;  3ABM B;  3UKM A;  1DTO A;  3ASO C;  3CP1 A;  1Q7Y W;  3CD6 V;  2ZDI C;  3WFV A;  1GM7 A;  2DYS B;  5CBH A;  3JD4 A;  4WCE V;  3K08 A;  1V55 B;  3DGE A;  3JYC A;  2QM8 A;  5DN6 G;  2IJK A;  1GTO A;  2JEU A;  3X2Q B;  1AR1 B;  3CYO A;  1M56 B;  4P2Z A;  3LSQ A;  3ABT A;  2K1E A;  2EIJ C;  3OEE G;  3QO7 A;  3ABK B;  1K34 A;  2UXX A;  2Y69 C;  5B3S B;  3FKS G;  5KUM A;  3AG2 B;  5L3E A;  3UM7 A;  4F4L A;  2IH3 C;  1R73 A;  3SYP A;  3G71 V;  1KKD A;  1R3I C;  1R6N A;  2WLH A;  2OT5 A;  2R9I A;  4LCU C;  4WFA V;  1VQL V;  3QNE A;  1W2B U;  1QLE B;  3SPH A;  2QKS A;  3OW2 U;  3E86 A;  4WFE A;  2ITC C;  4PDL A;  2Q69 A;  2X6A A;  3D36 A;  3EFF K;  3OMA B;  4X88 A;  1VQ4 V;  1GKF A;  3AG1 B;  4N21 A;  1DF4 A;  1YSC A;  1PNL A;  2DQ0 A;  2JEX A;  2YEV A;  2X6C A;  4G27 B;  3SYC A;  1AJQ A;  5HFM A;  5IY5 C;  3W7U A;  2NNU A;  3F5W C;  2MK3 A;  4HZ3 A;  4ZBM A;  3WG7 C;  1VQ6 V;  1JJ2 U;  3AG4 C;  5EBW C;  2B1I A;  3W7T A;  2W6J G;  1CEZ A;  1EBO A;  2P6J A;  2C2A A;  2WLN A;  2EIN B;  1F51 A;  5BZB A;  4GT1 A;  5B1N A;  2UXN A;  1WLE A;  4LC1 A;  4GX5 A;  3K3W A;  4XDJ A;  2EIK B;  4MTO A;  1N8R W;  4MVU A;  1TUE B;  1H8E G;  3K9A A;  3D3I A;  1K73 W;  1Y4M A;  2WWW A;  3ETE A;  2JK5 C;  1VQ8 V;  3ASN C;  1K5S A;  3OM3 B;  3OE7 G;  2HJF C;  4G28 B;  1FXK B;  3ZJZ A;  3LUT B;  3CCE V;  3SPI A;  1K5Q A;  1OHH G;  1SES A;  4GX1 A;  1CPY A;  1GK9 A;  4DO2 A;  3ETG A;  1S76 D;  1QVF U;  2V7Q G;  2Z3Y A;  3K04 A;  1NH2 B;  4MVS A;  2FTK A;  4JTD B;  2HVJ C;  3SYQ A;  3OR7 C;  2DQ3 A;  2EIL C;  1PL0 A;  2P7T C;  4KFM A;  4P9P A;  1JCH A;  2OCC B;  3FB7 C;  4CBC A;  1L1F A;  3SPC A;  1K33 A;  1VQO V;  5EBM C;  1NVP D;  5IYD O;  4MVQ A;  3T4D A;  1QLN A;  4JAS A;  5HFL A;  2D3O W;  2WLL B;  1AI6 A;  4R50 A;  3W7S A;  3ASO B;  1F4N A;  2V1D A;  2X7R B;  3OUF A;  2WLK A;  2WSS G;  1JVM A;  1GM9 A;  1K97 A;  1OCR B;  3CCR V;  4UV9 A;  5B1B B;  3ETD A;  3OUS A;  4UUJ C;  3I55 V;  4P9O A;  2IU0 A;  4KP4 A;  1SZT A;  1OCO B;  1NQT A;  2EJR A;  3OMI B;  3E89 A;  1K3E A;  3JCZ A;  3OGC C;  2WLJ A;  3A0R A;  3B8M A;  2ZXW B;  3AG3 C;  3ABL B;  1GM8 A;  4Z1M G;  2IJH A;  4WFH A;  4P30 A;  3K06 A;  1K4D C;  2WLM A;  1V54 B;  5CN0 A;  2XND G;  3T2M A;  1G4Y B;  1KQS U;  2NLJ C;  2QTO A;  3MHS C;  3K79 A;  2YSU B;  1I5Y A;  2Y48 A;  2A9H A;  4MS2 A;  1CP9 A;  1ARO P;  4R6Z A;  1NKD A;  1K7D A;  5B1A C;  3P30 A;  3FB6 C;  2WPD G;  3T4Z A;  3P32 A;  2PI4 A;  3STZ C;  3JD2 A;  4RAI A;  5LHI A;  3ML0 A;  5KUK A;  1YHQ V;  5FL7 G;  1QBZ A;  1AI4 A;  1M57 C;  1FFT B;  1JX9 A;  4UVA A;  3ZRS A;  2DYR C;  1M9N A;  3ABM C;  3CME V;  1YI2 V;  4JTA B;  2DYS C;  3BEH A;  4JGS A;  3SPG A;  1VQP V;  4Q20 A;  1Q81 W;  2JJ1 G;  1V55 C;  4PA6 A;  3BY6 A;  5CMU A;  3X2Q C;  3TK1 A;  3ZMV A;  3OR6 C;  1M56 C;  5LGT A;  1FXK A;  4QIW F;  4HAM A;  4CZZ A;  4BAY A;  4JF3 A;  1OZ0 A;  3RBZ A;  5IY5 B;  5C93 A;  3ABK C;  3E8H A;  3TCU A;  1IXM A;  3CCJ V;  1W0K G;  2ZR2 A;  1GMG A;  2DW4 A;  4RQF A;  5B3S C;  4DXW A;  2IJI A;  3KG2 A;  1ENV A;  2QA4 V;  3E8B A;  1R3K C;  5EC2 C;  5L3B A;  3AG2 C;  3G4S V;  2IW5 A;  2X0L A;  3SJQ C;  4PEL A;  2JJ2 G;  1BHB A;  3EHB B;  3F7Y C;  4EKW A;  3ZCC A;  2XAF A;  4PA3 A;  1W0J G;  2HLD G;  5L3D A;  1VQN V;  3CMA V;  3E2E A;  3STL C;  1RPR A;  4OXS A;  1R3J C;  2HKO A;  1QLE C;  1OCZ B;  3IC7 A;  2WLL A;  3JD0 A;  3HPL C;  3F7V C;  3GB7 C;  4MT8 A;  2XAG A;  1J95 A;  3FYI B;  3CXC U;  1PD3 A;  3AG1 C;  4R8C A;  5LBQ A;  1YJN V;  3E8G A;  2HR3 A;  4WFF A;  3JD3 A;  1H2G A;  3OFN G;  4XBF A;  3FB8 C;  1YTF D;  1NR1 A;  5L3C A;  4PDV A;  4TWK A;  2ITD C;  2B1G A;  2QM7 A;  3B8N A;  2IU3 A;  4MTF A;  4XDL A;  4RUF A;  1VQ5 V;  1MOF A;  4MVO A;  2KB1 A;  2ATK C;  2P90 A;  5H6R A;  4BIZ A;  4WF9 V;  2A79 B;  4UV8 A;  1M1K W;  1R3L C;  4TSF G;  4PA9 A;  3CPW U;  1H38 A;  5B1O A;  4JTC B;  1VQK V;  3MD0 A;  2BOC C;  3HB3 B;  1Y66 A;  1RPO A;  1KP2 A;  3ZMU A;  1K92 A;  2Q67 A;  5H6Q A;  1Q82 W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...