1VQOE

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1vqoE02
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1vqoE01
4UY8G 4IO9E 4WF9E 5AN9B 3CCJE 3CCUE 5HL7E 5DM7E 4WFAE 3CC4E 3PIPE 1VQPE 1YJ9E 3I55E 3G4SE 1YI2E 1VQ8E 1K8AG 1M90G 3CD6E 1QVGE 5MLCH 1W2BE 1YITE 3I56E 1VQ5E 1KQSE 4IOCE 2ZJQE 1N8RG 1VQOE 5GAGG 1M1KG 1Q81G 5GAEG 2CQLA 1Q7YG 1KD1G 1JJ2E 1VQ7E 2OTJE 3PIOE 3G71E 2ZJRE 3CCEE 3CCLE 1VQ6E 4WFNE 3OW2E 1VQ4E 4WFBE 1YJWE 5JVGE 1RL6A 1VQ9E 3CCQE 3CC7E 1Q86G 5GAHG 5GADG 3J7ZG 1VQLE 3CXCE 1YIJE 3G6EE 5H1SI 3DLLE 1YJNE 3CPWE 1VQME 1QVFE 3CC2E 2QEXE 5JVHE 3CCRE 5DM6E 3CF5E 2ZJPE 3CCVE 1Q82G 3CMEE 3CCSE 1K9MG 4IOAE 3CMAE 2QA4E 1KC8G 1K73G 2OTLE 4U67E 1NJIG 1VQNE 1S72E 3CCME 1YHQE 1VQKE 4WCEE
chains in the Genus database with same CATH superfamily
4UY8G 4IO9E 4WF9E 5AN9B 3CCJE 3AUMO 3CCUE 5HL7E 5DM7E 4WFAE 3IG9A 3CC4E 3PIPE 1VQPE 2OY7A 2FKGA 1RJLC 1YJ9E 3I55E 5B11O 3G4SE 1YI2E 1VQ8E 2HKDA 1OSPO 1K8AG 2PI3O 1M90G 3CD6E 1QVGE 5MLCH 1W2BE 1YITE 3I56E 1VQ5E 3CKFA 1KQSE 4IOCE 2ZJQE 2AF5A 2OL6O 1N8RG 1VQOE 5GAGG 1M1KG 1Q81G 5GAEG 2CQLA 1FJ1E 1Q7YG 1KD1G 1JJ2E 1VQ7E 3IGEA 2OTJE 3PIOE 3G71E 2ZJRE 3CCEE 3CCLE 1VQ6E 4WFNE 3OW2E 5B10O 1VQ4E 4WFBE 1YJWE 5JVGE 1RL6A 2OY8A 1VQ9E 3CCQE 2I5VO 3CC7E 2OY5O 1Q86G 5GAHG 5GADG 3J7ZG 1VQLE 3CXCE 1YIJE 3G6EE 5H1SI 3DLLE 1YJNE 3CPWE 2I5ZO 1VQME 1QVFE 2OYBO 1P4PA 3CC2E 2QEXE 5JVHE 3CCRE 3CKGA 5DM6E 3CF5E 2ZJPE 2G8CO 3CCVE 1Q82G 5B2AO 5B3MO 2OY1O 3CMEE 3CCSE 2FKJA 1K9MG 4IOAE 3CMAE 2OL8O 2QA4E 1KC8G 1K73G 2OTLE 4U67E 1NJIG 1VQNE 3EC5A 1S72E 3CCME 1YHQE 1VQKE 2OL7A 4WCEE
chains in the Genus database with same CATH topology
4UY8G 4IO9E 4WF9E 5AN9B 3CCJE 3CCUE 5HL7E 5DM7E 4WFAE 3CC4E 3PIPE 1VQPE 1YJ9E 3I55E 3G4SE 1YI2E 1VQ8E 1K8AG 1M90G 3CD6E 1QVGE 5MLCH 1W2BE 1YITE 3I56E 1VQ5E 1KQSE 4IOCE 2ZJQE 1N8RG 1VQOE 5GAGG 1M1KG 1Q81G 5GAEG 2CQLA 1Q7YG 1KD1G 1JJ2E 1VQ7E 2OTJE 3PIOE 3G71E 2ZJRE 3CCEE 3CCLE 1VQ6E 4WFNE 3OW2E 1VQ4E 4WFBE 1YJWE 5JVGE 1RL6A 1VQ9E 3CCQE 3CC7E 1Q86G 5GAHG 5GADG 3J7ZG 1VQLE 3CXCE 1YIJE 3G6EE 5H1SI 3DLLE 1YJNE 3CPWE 1VQME 1QVFE 3CC2E 2QEXE 5JVHE 3CCRE 5DM6E 3CF5E 2ZJPE 3CCVE 1Q82G 3CMEE 3CCSE 1K9MG 4IOAE 3CMAE 2QA4E 1KC8G 1K73G 2OTLE 4U67E 1NJIG 1VQNE 1S72E 3CCME 1YHQE 1VQKE 4WCEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UY8 G;  4IO9 E;  4WF9 E;  5AN9 B;  3CCJ E;  3CCU E;  5HL7 E;  5DM7 E;  4WFA E;  3CC4 E;  3PIP E;  1VQP E;  1YJ9 E;  3I55 E;  3G4S E;  1YI2 E;  1VQ8 E;  1K8A G;  1M90 G;  3CD6 E;  1QVG E;  5MLC H;  1W2B E;  1YIT E;  3I56 E;  1VQ5 E;  1KQS E;  4IOC E;  2ZJQ E;  1N8R G;  1VQO E;  5GAG G;  1M1K G;  1Q81 G;  5GAE G;  2CQL A;  1Q7Y G;  1KD1 G;  1JJ2 E;  1VQ7 E;  2OTJ E;  3PIO E;  3G71 E;  2ZJR E;  3CCE E;  3CCL E;  1VQ6 E;  4WFN E;  3OW2 E;  1VQ4 E;  4WFB E;  1YJW E;  5JVG E;  1RL6 A;  1VQ9 E;  3CCQ E;  3CC7 E;  1Q86 G;  5GAH G;  5GAD G;  3J7Z G;  1VQL E;  3CXC E;  1YIJ E;  3G6E E;  5H1S I;  3DLL E;  1YJN E;  3CPW E;  1VQM E;  1QVF E;  3CC2 E;  2QEX E;  5JVH E;  3CCR E;  5DM6 E;  3CF5 E;  2ZJP E;  3CCV E;  1Q82 G;  3CME E;  3CCS E;  1K9M G;  4IOA E;  3CMA E;  2QA4 E;  1KC8 G;  1K73 G;  2OTL E;  4U67 E;  1NJI G;  1VQN E;  1S72 E;  3CCM E;  1YHQ E;  1VQK E;  4WCE E; 
#chains in the Genus database with same CATH topology
 4UY8 G;  4IO9 E;  4WF9 E;  5AN9 B;  3CCJ E;  3AUM O;  3CCU E;  5HL7 E;  5DM7 E;  4WFA E;  3IG9 A;  3CC4 E;  3PIP E;  1VQP E;  2OY7 A;  2FKG A;  1RJL C;  1YJ9 E;  3I55 E;  5B11 O;  3G4S E;  1YI2 E;  1VQ8 E;  2HKD A;  1OSP O;  1K8A G;  2PI3 O;  1M90 G;  3CD6 E;  1QVG E;  5MLC H;  1W2B E;  1YIT E;  3I56 E;  1VQ5 E;  3CKF A;  1KQS E;  4IOC E;  2ZJQ E;  2AF5 A;  2OL6 O;  1N8R G;  1VQO E;  5GAG G;  1M1K G;  1Q81 G;  5GAE G;  2CQL A;  1FJ1 E;  1Q7Y G;  1KD1 G;  1JJ2 E;  1VQ7 E;  3IGE A;  2OTJ E;  3PIO E;  3G71 E;  2ZJR E;  3CCE E;  3CCL E;  1VQ6 E;  4WFN E;  3OW2 E;  5B10 O;  1VQ4 E;  4WFB E;  1YJW E;  5JVG E;  1RL6 A;  2OY8 A;  1VQ9 E;  3CCQ E;  2I5V O;  3CC7 E;  2OY5 O;  1Q86 G;  5GAH G;  5GAD G;  3J7Z G;  1VQL E;  3CXC E;  1YIJ E;  3G6E E;  5H1S I;  3DLL E;  1YJN E;  3CPW E;  2I5Z O;  1VQM E;  1QVF E;  2OYB O;  1P4P A;  3CC2 E;  2QEX E;  5JVH E;  3CCR E;  3CKG A;  5DM6 E;  3CF5 E;  2ZJP E;  2G8C O;  3CCV E;  1Q82 G;  5B2A O;  5B3M O;  2OY1 O;  3CME E;  3CCS E;  2FKJ A;  1K9M G;  4IOA E;  3CMA E;  2OL8 O;  2QA4 E;  1KC8 G;  1K73 G;  2OTL E;  4U67 E;  1NJI G;  1VQN E;  3EC5 A;  1S72 E;  3CCM E;  1YHQ E;  1VQK E;  2OL7 A;  4WCE E; 
#chains in the Genus database with same CATH homology
 4UY8 G;  4IO9 E;  4WF9 E;  5AN9 B;  3CCJ E;  3CCU E;  5HL7 E;  5DM7 E;  4WFA E;  3CC4 E;  3PIP E;  1VQP E;  1YJ9 E;  3I55 E;  3G4S E;  1YI2 E;  1VQ8 E;  1K8A G;  1M90 G;  3CD6 E;  1QVG E;  5MLC H;  1W2B E;  1YIT E;  3I56 E;  1VQ5 E;  1KQS E;  4IOC E;  2ZJQ E;  1N8R G;  1VQO E;  5GAG G;  1M1K G;  1Q81 G;  5GAE G;  2CQL A;  1Q7Y G;  1KD1 G;  1JJ2 E;  1VQ7 E;  2OTJ E;  3PIO E;  3G71 E;  2ZJR E;  3CCE E;  3CCL E;  1VQ6 E;  4WFN E;  3OW2 E;  1VQ4 E;  4WFB E;  1YJW E;  5JVG E;  1RL6 A;  1VQ9 E;  3CCQ E;  3CC7 E;  1Q86 G;  5GAH G;  5GAD G;  3J7Z G;  1VQL E;  3CXC E;  1YIJ E;  3G6E E;  5H1S I;  3DLL E;  1YJN E;  3CPW E;  1VQM E;  1QVF E;  3CC2 E;  2QEX E;  5JVH E;  3CCR E;  5DM6 E;  3CF5 E;  2ZJP E;  3CCV E;  1Q82 G;  3CME E;  3CCS E;  1K9M G;  4IOA E;  3CMA E;  2QA4 E;  1KC8 G;  1K73 G;  2OTL E;  4U67 E;  1NJI G;  1VQN E;  1S72 E;  3CCM E;  1YHQ E;  1VQK E;  4WCE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...