1VQOF

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqoF00
1Q81H 3LWOC 3NVIB 5G4UC 3PAFA 1PXWA 1M90H 1VQ7F 1W42A 1K9MH 2QEXF 1SDSA 1YITF 3CPQA 3E1YA 3CCQF 1YIJF 2QA4F 1VQLF 1X52A 3E20B 3OBWA 3I55F 1W41A 2CZWA 2JNBA 1YJ9F 1Q86H 4X3LA 1S72F 1RLGA 1VQPF 3AGKA 5IT9M 4BW0B 3CCJF 1GO0A 3I56F 3CD6F 1W3EX 3OBYA 2LBWA 1K73H 1W2BF 4NUTA 3G6EF 5FJ4C 3CCLF 1KQSF 3NMUC 2KTVA 1QVFF 1NMUB 1Q7YH 3G4SF 3J81M 3J7AR 3J80M 1KC8H 1VQ5F 3WXMB 4LCKA 1VQMF 1N8RH 1T0KB 2KTUA 1CN7A 1W40A 1NJIH 3CCMF 1VQ9F 4BY9D 4TZZA 3CMEF 2HVYD 1VQOF 1VQ8F 1Q82H 3NK6A 3IR9A 4C4WC 3CMAF 1GZ0A 3MCAB 4X3MA 2FC3A 3CCVF 1VQNF 1GO1A 3JCMM 1M1KH 3RA5A 5A2QM 1H7MA 1IPAA 2QI2A 2VGMA 1ZWZA 2KG4A 3V7EA 3VI6A 1DT9A 3LFOA 3N4ZA 1CK2A 2BO1A 3CCSF 3RA6A 2WALA 5GINC 3HAXD 3LWPC 1RA4A 1VQ4F 3NVKE 3CG6A 3SIUA 2LBXA 2VGNA 3GYQA 3G71F 3SIVA 3CCUF 1E7KA 3CC2F 1JJ2F 3CXCF 1YJNF 3NK7A 5GIOC 5EWRA 1YI2F 3JAMM 5GIPC 3OW2F 1QVGF 2OTLF 5G4VC 3CC7F 2OZBA 1K8AH 3CCRF 1X7PA 3CCEF 3CPWF 2AIFA 1VQ6F 5DCVA 1X7OA 3CC4F 2OTJF 3LWVC 1YJWF 1KD1H 2I6DA 1YHQF 5FLXM 5EO3A 3HJWC 3VMFB 2ALEA 3PLAC 5GAPK 3V7QA 3LWQC 5GANK 3O85A 1VQKF 1XBIA 3ON1A 3N4YA 3FFMA 3LWRC 2OHWA
chains in the Genus database with same CATH superfamily
4YJ3A 4U39A 3C9RA 2H8EA 3ZOPA 3JVHA 1PXWA 5J2UA 4O4HB 1W42A 1K9MH 3CB2A 1SDSA 3CPQA 5JVDA 1GX1A 3N2GB 3CCQF 1ODEA 4DXDA 3E20B 3R0PA 3S02A 3D00A 3OONA 2JNBA 1YJ9F 5LOVB 2BTOA 1W59A 5HY0A 4BT6A 4G4XA 5IYZA 5MN5A 2ZOVA 1VHAA 4DRXA 1QAHA 3N2GA 4O2BB 1CLIA 3GHZA 3VTIC 4ZHVA 3VIUA 2QTPA 1U3PA 4I4TA 2HS4A 3CCLF 1FNKA 5CB4B 3ELCA 1NMUB 4ZOLB 2CHSA 4O2BA 5FNVA 3IEQA 5EYPB 2G9IA 1VQ9F 4XCQA 3CMEF 2Q1XA 4BT5A 3TD5A 3IR9A 3TD4A 3C9SA 4C4WC 2H6LA 3MCAB 1GO1A 3LYBA 5MN6A 4BT3A 2IQQA 5GONB 3B6NA 4LNUB 4BVTA 4TUYB 1TUBB 2QI2A 1IPAA 4O4IA 5JQGA 1Z5WA 5KX5A 4IIJA 1W5AA 1XV2A 2CHTA 3N4ZA 2BO1A 1SA0B 3E22A 5EB0A 3WGJA 3F0DA 3LDTA 1RA4A 3NVKE 3N2KB 1XRGA 3CG6A 1YQNA 3F0GA 5IJ9B 3GYQA 1FFXB 1IV2A 2PMPA 5LA6B 5HY1A 2HX0A 4BT2A 1Z5VA 5LP6A 3V4DA 3S0YA 4C8EA 2UYKA 4YJ2A 3CXCF 4BT7A 2HP0A 5GIOC 4C82A 2HS3A 5EWRA 3KE1A 5GIPC 3RYIB 3JARA 2OZBA 4I4TB 3CCRF 1X7PA 5EIBC 4HNAB 3CCEF 2GLZA 5HP8A 5JVDB 4TV9B 3LWVC 2GVIA 3EORA 4YJ2B 3S0HA 4R40B 3C8LA 4BT4A 1TVKA 5IYZB 1XBIA 1UI9A 3N4YA 5J2TA 5ITZA 4ZHQA 3UT5A 5LYJB 2UYNA 2ZODA 3PAFA 3QHDA 4B5CA 1IV4A 1M90H 1VQ7F 3K12A 2QEXF 3ZP7A 3RYHB 1YITF 5HY4A 4ZOLA 1DBFA 3E22B 2QA4F 3M84A 3OBWA 2I6RA 4F6RA 5HXUA 2CZWA 3JATA 4EI9A 1QD9A 2Q1YA 1RLGA 5IJ9A 3N2KA 4G4WA 3WJPA 4LNUA 1VQPF 3C9TA 3CCJF 1W3EX 3V3TA 3OBYA 2LBWA 4ZHYB 4O2AA 1SA0A 3IKFA 2UYPA 5CA1A 2KGWA 2Z01A 3I7TA 1COMA 4KWEA 4NUTA 5JH7A 5FJ4C 3MCQA 3P4EA 2KTVA 3VOAA 3HKCA 4TV9A 4TV8B 1OFUA 3QTYA 1R1MA 3K2XA 5CB4A 5HY2A 2UYJA 3VYUC 2CSLA 3HTNA 2Z1EA 1VQ8F 5LOVA 3CCVF 1XHOA 4C8IA 4WBNA 4X1KB 3RA5A 1FNJA 3JASB 1H7MA 3ZP4A 1RQ7A 2N48A 2DT4A 3VI6A 3JARB 5IJ0B 1CK2A 4BVSA 3D54A 3RA6A 4M8IA 4ZI7A 3VYSC 3WJQA 1NQ3A 2IAFA 2RHHA 1VQ4F 2PHNA 3HKBB 3RYCA 4O4LB 4BVQA 3SIUA 3FPIA 2VGNA 4PWTA 2ZAUA 5LYJA 3HKEA 3M1XA 1JFFA 1YI2F 3MDOA 1RQ2A 1JY8A 3OW2F 1QVGF 4O4LA 3JALA 3KHNA 3RYCB 5JH7B 2MQEA 3KJJA 2IG8A 4ERHA 3P10A 5JQGB 1H47A 1TUBA 1X7OA 2HRUA 3CYQA 2HRYA 2BTUA 3HKEB 4ZI7B 1KD1H 1VK3A 3L7QA 3HJWC 3PLAC 2ALEA 4RQOA 3V7QA 3LWQC 3FFMA 2K1SA 4I50A 3S03A 3LWRC 1W581 2Z1UA 4E6EA 4WBNB 1Q81H 5EZYA 5G4UC 2F9ZC 3VOBA 4TV8A 2LCAA 2LBTA 3WPXA 1YIJF 1X52A 4ZHQB 4O4HA 5BMVA 3RYIA 4EI7A 1VQVA 2FGYA 2HS0A 4DRXB 4X1IA 1Q86H 1U43A 5GONA 1TVKB 3AGKA 3C9UA 3K0TA 3WGMA 3I56F 3GTZA 5BMVB 2NMUA 2V9YA 3G6EF 3NMUC 2RHOA 1QVFF 3FD5A 1U40A 1Q7YH 4B45A 2RB9A 4B62A 3G4SF 2R6R1 1JD1A 5LXTB 2UZHA 3TD3A 5HP7A 4EB6B 1KC8H 1T0AA 4LCKA 1VQMF 2CW4A 3FD6A 5KMGA 1N8RH 1W40A 2BTQB 5LP6B 1NJIH 1T0KB 1CN7A 4TZZA 4X20B 2Z1TA 1VQOF 1H48A 1JN1A 2H8CA 1SZQA 3JCMM 4B46A 2R751 1U3LA 1M1KH 3I3FA 1UFYA 4ZHWA 1OAPA 5A2QM 2GZLA 2VGMA 1ZWZA 3MBMA 3F0FA 3CYPB 3V7EA 3JALB 5AVMA 5JCOC 3CCSF 3P0ZA 4IHJB 4EI8A 5CA1B 2WALA 3WPWA 2HP3A 3HAXD 3LMEA 3MQWA 3RE3A 4X20A 3JAKA 2VXYA 2HP0B 3CCUF 1E7KA 3BYQA 3CC2F 5C8YA 1JJ2F 1KNJA 1YJNF 4I55B 3IKEA 3NK7A 1FFXA 2ZVYA 3RYHA 2HQSC 2OTMA 2OTLF 1YGYA 2RHLA 1RLUA 3JASA 3S0WA 2AIFA 3CC4F 2OTJF 2I6DA 5C8YB 1YHQF 2AMTA 4C8GA 2P6YA 3F0EA 3DC2A 3U0OA 5CA0A 1J7HA 4U3JB 3O85A 4G88A 4O2AB 3HKBA 3DDNA 4BVRA 4C81A 1W5EA 2OHWA 2YXZA 5HXZA 3LWOC 5LA6A 3NVIB 3M4SA 3S06A 2DYYA 2ZF8A 3VYTC 4NWOB 4F6RB 3ERNA 5KMGB 5FNVB 5HWEA 4O4JB 3HKDA 5LXTA 3E1YA 2W8BC 4X1YA 1VQLF 3I55F 1W41A 5EAZA 5LP6C 3VO8A 4X3LA 3JAKB 1S72F 2RHJA 3ZO8A 4X1KA 4TUYA 1W55A 3RYFA 3JATB 5IT9M 4BW0B 1GO0A 2Z1FA 4FFBB 3CD6F 1K73H 4IHJA 2CWJA 4G4VA 4X1IB 3FBAA 1W2BF 1KQSF 3VCZA 5EYPA 1W57A 1VH8A 3J81M 4G4YA 3J7AR 3J80M 1VQ5F 3WXMB 2CVLA 1FSZA 2KTUA 3CCMF 4BY9D 5JCOA 2HVYD 5B8FA 3WGNA 1Q82H 3IMPA 3NK6A 3IEWA 3CMAF 1GZ0A 4X3MA 2FC3A 1VQNF 3WGLA 4EB6A 3HWUA 2KG4A 2B33A 1IV3A 1DT9A 3LFOA 3HKDB 3WJRA 1X25A 5GINC 4I55A 3LWPC 2VAWA 5EB1B 3HKCB 4NQ3A 1W5FA 5J2TB 2L26A 1PF5A 3KJKA 2LBXA 2UYNB 4U3JA 5ITZB 1W5BA 3G71F 3SIVA 5EZYB 5EIBD 3K14A 1QU9A 3ESJA 2ZVZA 4FFBA 3RYFB 1IV1A 2YYEA 5CA0B 4HNAA 3JAMM 3KIZA 3WGKA 3JAWA 5G4VC 5KX5B 3CC7F 2VAPA 4IIJB 5J2UB 1K8AH 1Q8RA 1JFFB 1VQ6F 4O4IB 3CPWF 4O4JA 5DCVA 4YJ3B 1YJWF 2AIZP 4G4ZA 5FLXM 5IJ0A 1ONIA 3D01A 4ZK7A 5EO3A 4I50B 2VAMA 3T80A 1KNKA 3F6MA 3JAWB 3VMFB 5MN4A 5GAPK 2EWCA 5GANK 1VQKF 3UT5B 3ON1A 4RHAA 3QUWA 3Q8HA 4X1YB
chains in the Genus database with same CATH topology
5HXZA 3LWOC 1Q81H 3NVIB 5G4UC 3PAFA 1PXWA 2F9ZC 1M90H 1VQ7F 1W42A 1K9MH 2QEXF 5HWEA 1SDSA 1YITF 3CPQA 5HY4A 3E1YA 3CCQF 1YIJF 2QA4F 1VQLF 1X52A 3E20B 3OBWA 3I55F 3D00A 1W41A 4EI7A 2CZWA 2FGYA 2JNBA 5HXUA 1YJ9F 1Q86H 4EI9A 4X3LA 1S72F 1RLGA 5HY0A 1VQPF 3AGKA 5IT9M 4BW0B 3CCJF 1GO0A 3I56F 3CD6F 1W3EX 3V3TA 3OBYA 2LBWA 1K73H 1W2BF 4NUTA 3G6EF 5FJ4C 3CCLF 1KQSF 3NMUC 2KTVA 1QVFF 1NMUB 1Q7YH 3G4SF 3J81M 3J7AR 3J80M 1KC8H 1VQ5F 3WXMB 4LCKA 1VQMF 1N8RH 5HY2A 2KTUA 1T0KB 1W40A 1CN7A 1NJIH 3CCMF 1VQ9F 4BY9D 4TZZA 4XCQA 3CMEF 2HVYD 1VQOF 1VQ8F 1Q82H 3NK6A 3IR9A 4C4WC 3CMAF 1GZ0A 3MCAB 4X3MA 2FC3A 3CCVF 1VQNF 1GO1A 3JCMM 1M1KH 3RA5A 4BVTA 5A2QM 1H7MA 1IPAA 2QI2A 2VGMA 1ZWZA 2KG4A 3V7EA 3VI6A 1DT9A 3LFOA 3N4ZA 1CK2A 2BO1A 3CCSF 4EI8A 4BVSA 3RA6A 2WALA 5GINC 3HAXD 3LWPC 4NQ3A 1RA4A 1VQ4F 3NVKE 3CG6A 4BVQA 3SIUA 2LBXA 2VGNA 3GYQA 3G71F 5HY1A 3SIVA 3CCUF 1E7KA 3CC2F 1JJ2F 3CXCF 1YJNF 3NK7A 5GIOC 5EWRA 1YI2F 3JAMM 5GIPC 3OW2F 1QVGF 2OTLF 5G4VC 3CC7F 2OZBA 1K8AH 3CCRF 1X7PA 3CCEF 3CPWF 2GLZA 2AIFA 1VQ6F 5DCVA 1X7OA 3CC4F 2OTJF 3LWVC 1YJWF 1KD1H 2I6DA 1YHQF 5FLXM 5EO3A 3HJWC 3VMFB 2ALEA 3PLAC 5GAPK 3V7QA 5GANK 3LWQC 3O85A 1VQKF 1XBIA 3ON1A 3N4YA 3FFMA 3LWRC 4BVRA 2OHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 H;  3LWO C;  3NVI B;  5G4U C;  3PAF A;  1PXW A;  1M90 H;  1VQ7 F;  1W42 A;  1K9M H;  2QEX F;  1SDS A;  1YIT F;  3CPQ A;  3E1Y A;  3CCQ F;  1YIJ F;  2QA4 F;  1VQL F;  1X52 A;  3E20 B;  3OBW A;  3I55 F;  1W41 A;  2CZW A;  2JNB A;  1YJ9 F;  1Q86 H;  4X3L A;  1S72 F;  1RLG A;  1VQP F;  3AGK A;  5IT9 M;  4BW0 B;  3CCJ F;  1GO0 A;  3I56 F;  3CD6 F;  1W3E X;  3OBY A;  2LBW A;  1K73 H;  1W2B F;  4NUT A;  3G6E F;  5FJ4 C;  3CCL F;  1KQS F;  3NMU C;  2KTV A;  1QVF F;  1NMU B;  1Q7Y H;  3G4S F;  3J81 M;  3J7A R;  3J80 M;  1KC8 H;  1VQ5 F;  3WXM B;  4LCK A;  1VQM F;  1N8R H;  1T0K B;  2KTU A;  1CN7 A;  1W40 A;  1NJI H;  3CCM F;  1VQ9 F;  4BY9 D;  4TZZ A;  3CME F;  2HVY D;  1VQO F;  1VQ8 F;  1Q82 H;  3NK6 A;  3IR9 A;  4C4W C;  3CMA F;  1GZ0 A;  3MCA B;  4X3M A;  2FC3 A;  3CCV F;  1VQN F;  1GO1 A;  3JCM M;  1M1K H;  3RA5 A;  5A2Q M;  1H7M A;  1IPA A;  2QI2 A;  2VGM A;  1ZWZ A;  2KG4 A;  3V7E A;  3VI6 A;  1DT9 A;  3LFO A;  3N4Z A;  1CK2 A;  2BO1 A;  3CCS F;  3RA6 A;  2WAL A;  5GIN C;  3HAX D;  3LWP C;  1RA4 A;  1VQ4 F;  3NVK E;  3CG6 A;  3SIU A;  2LBX A;  2VGN A;  3GYQ A;  3G71 F;  3SIV A;  3CCU F;  1E7K A;  3CC2 F;  1JJ2 F;  3CXC F;  1YJN F;  3NK7 A;  5GIO C;  5EWR A;  1YI2 F;  3JAM M;  5GIP C;  3OW2 F;  1QVG F;  2OTL F;  5G4V C;  3CC7 F;  2OZB A;  1K8A H;  3CCR F;  1X7P A;  3CCE F;  3CPW F;  2AIF A;  1VQ6 F;  5DCV A;  1X7O A;  3CC4 F;  2OTJ F;  3LWV C;  1YJW F;  1KD1 H;  2I6D A;  1YHQ F;  5FLX M;  5EO3 A;  3HJW C;  3VMF B;  2ALE A;  3PLA C;  5GAP K;  3V7Q A;  3LWQ C;  5GAN K;  3O85 A;  1VQK F;  1XBI A;  3ON1 A;  3N4Y A;  3FFM A;  3LWR C;  2OHW A; 
#chains in the Genus database with same CATH topology
 4YJ3 A;  4U39 A;  3C9R A;  2H8E A;  3ZOP A;  3JVH A;  1PXW A;  5J2U A;  4O4H B;  1W42 A;  1K9M H;  3CB2 A;  1SDS A;  3CPQ A;  5JVD A;  1GX1 A;  3N2G B;  3CCQ F;  1ODE A;  4DXD A;  3E20 B;  3R0P A;  3S02 A;  3D00 A;  3OON A;  2JNB A;  1YJ9 F;  5LOV B;  2BTO A;  1W59 A;  5HY0 A;  4BT6 A;  4G4X A;  5IYZ A;  5MN5 A;  2ZOV A;  1VHA A;  4DRX A;  1QAH A;  3N2G A;  4O2B B;  1CLI A;  3GHZ A;  3VTI C;  4ZHV A;  3VIU A;  2QTP A;  1U3P A;  4I4T A;  2HS4 A;  3CCL F;  1FNK A;  5CB4 B;  3ELC A;  1NMU B;  4ZOL B;  2CHS A;  4O2B A;  5FNV A;  3IEQ A;  5EYP B;  2G9I A;  1VQ9 F;  4XCQ A;  3CME F;  2Q1X A;  4BT5 A;  3TD5 A;  3IR9 A;  3TD4 A;  3C9S A;  4C4W C;  2H6L A;  3MCA B;  1GO1 A;  3LYB A;  5MN6 A;  4BT3 A;  2IQQ A;  5GON B;  3B6N A;  4LNU B;  4BVT A;  4TUY B;  1TUB B;  2QI2 A;  1IPA A;  4O4I A;  5JQG A;  1Z5W A;  5KX5 A;  4IIJ A;  1W5A A;  1XV2 A;  2CHT A;  3N4Z A;  2BO1 A;  1SA0 B;  3E22 A;  5EB0 A;  3WGJ A;  3F0D A;  3LDT A;  1RA4 A;  3NVK E;  3N2K B;  1XRG A;  3CG6 A;  1YQN A;  3F0G A;  5IJ9 B;  3GYQ A;  1FFX B;  1IV2 A;  2PMP A;  5LA6 B;  5HY1 A;  2HX0 A;  4BT2 A;  1Z5V A;  5LP6 A;  3V4D A;  3S0Y A;  4C8E A;  2UYK A;  4YJ2 A;  3CXC F;  4BT7 A;  2HP0 A;  5GIO C;  4C82 A;  2HS3 A;  5EWR A;  3KE1 A;  5GIP C;  3RYI B;  3JAR A;  2OZB A;  4I4T B;  3CCR F;  1X7P A;  5EIB C;  4HNA B;  3CCE F;  2GLZ A;  5HP8 A;  5JVD B;  4TV9 B;  3LWV C;  2GVI A;  3EOR A;  4YJ2 B;  3S0H A;  4R40 B;  3C8L A;  4BT4 A;  1TVK A;  5IYZ B;  1XBI A;  1UI9 A;  3N4Y A;  5J2T A;  5ITZ A;  4ZHQ A;  3UT5 A;  5LYJ B;  2UYN A;  2ZOD A;  3PAF A;  3QHD A;  4B5C A;  1IV4 A;  1M90 H;  1VQ7 F;  3K12 A;  2QEX F;  3ZP7 A;  3RYH B;  1YIT F;  5HY4 A;  4ZOL A;  1DBF A;  3E22 B;  2QA4 F;  3M84 A;  3OBW A;  2I6R A;  4F6R A;  5HXU A;  2CZW A;  3JAT A;  4EI9 A;  1QD9 A;  2Q1Y A;  1RLG A;  5IJ9 A;  3N2K A;  4G4W A;  3WJP A;  4LNU A;  1VQP F;  3C9T A;  3CCJ F;  1W3E X;  3V3T A;  3OBY A;  2LBW A;  4ZHY B;  4O2A A;  1SA0 A;  3IKF A;  2UYP A;  5CA1 A;  2KGW A;  2Z01 A;  3I7T A;  1COM A;  4KWE A;  4NUT A;  5JH7 A;  5FJ4 C;  3MCQ A;  3P4E A;  2KTV A;  3VOA A;  3HKC A;  4TV9 A;  4TV8 B;  1OFU A;  3QTY A;  1R1M A;  3K2X A;  5CB4 A;  5HY2 A;  2UYJ A;  3VYU C;  2CSL A;  3HTN A;  2Z1E A;  1VQ8 F;  5LOV A;  3CCV F;  1XHO A;  4C8I A;  4WBN A;  4X1K B;  3RA5 A;  1FNJ A;  3JAS B;  1H7M A;  3ZP4 A;  1RQ7 A;  2N48 A;  2DT4 A;  3VI6 A;  3JAR B;  5IJ0 B;  1CK2 A;  4BVS A;  3D54 A;  3RA6 A;  4M8I A;  4ZI7 A;  3VYS C;  3WJQ A;  1NQ3 A;  2IAF A;  2RHH A;  1VQ4 F;  2PHN A;  3HKB B;  3RYC A;  4O4L B;  4BVQ A;  3SIU A;  3FPI A;  2VGN A;  4PWT A;  2ZAU A;  5LYJ A;  3HKE A;  3M1X A;  1JFF A;  1YI2 F;  3MDO A;  1RQ2 A;  1JY8 A;  3OW2 F;  1QVG F;  4O4L A;  3JAL A;  3KHN A;  3RYC B;  5JH7 B;  2MQE A;  3KJJ A;  2IG8 A;  4ERH A;  3P10 A;  5JQG B;  1H47 A;  1TUB A;  1X7O A;  2HRU A;  3CYQ A;  2HRY A;  2BTU A;  3HKE B;  4ZI7 B;  1KD1 H;  1VK3 A;  3L7Q A;  3HJW C;  3PLA C;  2ALE A;  4RQO A;  3V7Q A;  3LWQ C;  3FFM A;  2K1S A;  4I50 A;  3S03 A;  3LWR C;  1W58 1;  2Z1U A;  4E6E A;  4WBN B;  1Q81 H;  5EZY A;  5G4U C;  2F9Z C;  3VOB A;  4TV8 A;  2LCA A;  2LBT A;  3WPX A;  1YIJ F;  1X52 A;  4ZHQ B;  4O4H A;  5BMV A;  3RYI A;  4EI7 A;  1VQV A;  2FGY A;  2HS0 A;  4DRX B;  4X1I A;  1Q86 H;  1U43 A;  5GON A;  1TVK B;  3AGK A;  3C9U A;  3K0T A;  3WGM A;  3I56 F;  3GTZ A;  5BMV B;  2NMU A;  2V9Y A;  3G6E F;  3NMU C;  2RHO A;  1QVF F;  3FD5 A;  1U40 A;  1Q7Y H;  4B45 A;  2RB9 A;  4B62 A;  3G4S F;  2R6R 1;  1JD1 A;  5LXT B;  2UZH A;  3TD3 A;  5HP7 A;  4EB6 B;  1KC8 H;  1T0A A;  4LCK A;  1VQM F;  2CW4 A;  3FD6 A;  5KMG A;  1N8R H;  1W40 A;  2BTQ B;  5LP6 B;  1NJI H;  1T0K B;  1CN7 A;  4TZZ A;  4X20 B;  2Z1T A;  1VQO F;  1H48 A;  1JN1 A;  2H8C A;  1SZQ A;  3JCM M;  4B46 A;  2R75 1;  1U3L A;  1M1K H;  3I3F A;  1UFY A;  4ZHW A;  1OAP A;  5A2Q M;  2GZL A;  2VGM A;  1ZWZ A;  3MBM A;  3F0F A;  3CYP B;  3V7E A;  3JAL B;  5AVM A;  5JCO C;  3CCS F;  3P0Z A;  4IHJ B;  4EI8 A;  5CA1 B;  2WAL A;  3WPW A;  2HP3 A;  3HAX D;  3LME A;  3MQW A;  3RE3 A;  4X20 A;  3JAK A;  2VXY A;  2HP0 B;  3CCU F;  1E7K A;  3BYQ A;  3CC2 F;  5C8Y A;  1JJ2 F;  1KNJ A;  1YJN F;  4I55 B;  3IKE A;  3NK7 A;  1FFX A;  2ZVY A;  3RYH A;  2HQS C;  2OTM A;  2OTL F;  1YGY A;  2RHL A;  1RLU A;  3JAS A;  3S0W A;  2AIF A;  3CC4 F;  2OTJ F;  2I6D A;  5C8Y B;  1YHQ F;  2AMT A;  4C8G A;  2P6Y A;  3F0E A;  3DC2 A;  3U0O A;  5CA0 A;  1J7H A;  4U3J B;  3O85 A;  4G88 A;  4O2A B;  3HKB A;  3DDN A;  4BVR A;  4C81 A;  1W5E A;  2OHW A;  2YXZ A;  5HXZ A;  3LWO C;  5LA6 A;  3NVI B;  3M4S A;  3S06 A;  2DYY A;  2ZF8 A;  3VYT C;  4NWO B;  4F6R B;  3ERN A;  5KMG B;  5FNV B;  5HWE A;  4O4J B;  3HKD A;  5LXT A;  3E1Y A;  2W8B C;  4X1Y A;  1VQL F;  3I55 F;  1W41 A;  5EAZ A;  5LP6 C;  3VO8 A;  4X3L A;  3JAK B;  1S72 F;  2RHJ A;  3ZO8 A;  4X1K A;  4TUY A;  1W55 A;  3RYF A;  3JAT B;  5IT9 M;  4BW0 B;  1GO0 A;  2Z1F A;  4FFB B;  3CD6 F;  1K73 H;  4IHJ A;  2CWJ A;  4G4V A;  4X1I B;  3FBA A;  1W2B F;  1KQS F;  3VCZ A;  5EYP A;  1W57 A;  1VH8 A;  3J81 M;  4G4Y A;  3J7A R;  3J80 M;  1VQ5 F;  3WXM B;  2CVL A;  1FSZ A;  2KTU A;  3CCM F;  4BY9 D;  5JCO A;  2HVY D;  5B8F A;  3WGN A;  1Q82 H;  3IMP A;  3NK6 A;  3IEW A;  3CMA F;  1GZ0 A;  4X3M A;  2FC3 A;  1VQN F;  3WGL A;  4EB6 A;  3HWU A;  2KG4 A;  2B33 A;  1IV3 A;  1DT9 A;  3LFO A;  3HKD B;  3WJR A;  1X25 A;  5GIN C;  4I55 A;  3LWP C;  2VAW A;  5EB1 B;  3HKC B;  4NQ3 A;  1W5F A;  5J2T B;  2L26 A;  1PF5 A;  3KJK A;  2LBX A;  2UYN B;  4U3J A;  5ITZ B;  1W5B A;  3G71 F;  3SIV A;  5EZY B;  5EIB D;  3K14 A;  1QU9 A;  3ESJ A;  2ZVZ A;  4FFB A;  3RYF B;  1IV1 A;  2YYE A;  5CA0 B;  4HNA A;  3JAM M;  3KIZ A;  3WGK A;  3JAW A;  5G4V C;  5KX5 B;  3CC7 F;  2VAP A;  4IIJ B;  5J2U B;  1K8A H;  1Q8R A;  1JFF B;  1VQ6 F;  4O4I B;  3CPW F;  4O4J A;  5DCV A;  4YJ3 B;  1YJW F;  2AIZ P;  4G4Z A;  5FLX M;  5IJ0 A;  1ONI A;  3D01 A;  4ZK7 A;  5EO3 A;  4I50 B;  2VAM A;  3T80 A;  1KNK A;  3F6M A;  3JAW B;  3VMF B;  5MN4 A;  5GAP K;  2EWC A;  5GAN K;  1VQK F;  3UT5 B;  3ON1 A;  4RHA A;  3QUW A;  3Q8H A;  4X1Y B; 
#chains in the Genus database with same CATH homology
 5HXZ A;  3LWO C;  1Q81 H;  3NVI B;  5G4U C;  3PAF A;  1PXW A;  2F9Z C;  1M90 H;  1VQ7 F;  1W42 A;  1K9M H;  2QEX F;  5HWE A;  1SDS A;  1YIT F;  3CPQ A;  5HY4 A;  3E1Y A;  3CCQ F;  1YIJ F;  2QA4 F;  1VQL F;  1X52 A;  3E20 B;  3OBW A;  3I55 F;  3D00 A;  1W41 A;  4EI7 A;  2CZW A;  2FGY A;  2JNB A;  5HXU A;  1YJ9 F;  1Q86 H;  4EI9 A;  4X3L A;  1S72 F;  1RLG A;  5HY0 A;  1VQP F;  3AGK A;  5IT9 M;  4BW0 B;  3CCJ F;  1GO0 A;  3I56 F;  3CD6 F;  1W3E X;  3V3T A;  3OBY A;  2LBW A;  1K73 H;  1W2B F;  4NUT A;  3G6E F;  5FJ4 C;  3CCL F;  1KQS F;  3NMU C;  2KTV A;  1QVF F;  1NMU B;  1Q7Y H;  3G4S F;  3J81 M;  3J7A R;  3J80 M;  1KC8 H;  1VQ5 F;  3WXM B;  4LCK A;  1VQM F;  1N8R H;  5HY2 A;  2KTU A;  1T0K B;  1W40 A;  1CN7 A;  1NJI H;  3CCM F;  1VQ9 F;  4BY9 D;  4TZZ A;  4XCQ A;  3CME F;  2HVY D;  1VQO F;  1VQ8 F;  1Q82 H;  3NK6 A;  3IR9 A;  4C4W C;  3CMA F;  1GZ0 A;  3MCA B;  4X3M A;  2FC3 A;  3CCV F;  1VQN F;  1GO1 A;  3JCM M;  1M1K H;  3RA5 A;  4BVT A;  5A2Q M;  1H7M A;  1IPA A;  2QI2 A;  2VGM A;  1ZWZ A;  2KG4 A;  3V7E A;  3VI6 A;  1DT9 A;  3LFO A;  3N4Z A;  1CK2 A;  2BO1 A;  3CCS F;  4EI8 A;  4BVS A;  3RA6 A;  2WAL A;  5GIN C;  3HAX D;  3LWP C;  4NQ3 A;  1RA4 A;  1VQ4 F;  3NVK E;  3CG6 A;  4BVQ A;  3SIU A;  2LBX A;  2VGN A;  3GYQ A;  3G71 F;  5HY1 A;  3SIV A;  3CCU F;  1E7K A;  3CC2 F;  1JJ2 F;  3CXC F;  1YJN F;  3NK7 A;  5GIO C;  5EWR A;  1YI2 F;  3JAM M;  5GIP C;  3OW2 F;  1QVG F;  2OTL F;  5G4V C;  3CC7 F;  2OZB A;  1K8A H;  3CCR F;  1X7P A;  3CCE F;  3CPW F;  2GLZ A;  2AIF A;  1VQ6 F;  5DCV A;  1X7O A;  3CC4 F;  2OTJ F;  3LWV C;  1YJW F;  1KD1 H;  2I6D A;  1YHQ F;  5FLX M;  5EO3 A;  3HJW C;  3VMF B;  2ALE A;  3PLA C;  5GAP K;  3V7Q A;  5GAN K;  3LWQ C;  3O85 A;  1VQK F;  1XBI A;  3ON1 A;  3N4Y A;  3FFM A;  3LWR C;  4BVR A;  2OHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...