1VQOF

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqoF00
1CK2A 3E20B 3JAMM 5GIPC 1W40A 3I56F 5GANK 2OTJF 1GO0A 3OW2F 2WALA 3CG6A 1H7MA 1E7KA 1YJNF 1X7OA 3O85A 1GZ0A 3LWVC 3J81M 3I55F 3CCQF 3N4ZA 2QA4F 1Q82H 1Q81H 3V7QA 2KTVA 1VQNF 4NUTA 1NJIH 2OHWA 3PAFA 3MCAB 3CMEF 3N4YA 1W41A 3IR9A 3V7EA 1W3EX 3J80M 1YI2F 1GO1A 1PXWA 3LFOA 1Q7YH 4BY9D 3CCRF 1S72F 3CXCF 3JCMM 1VQ4F 2CZWA 5FLXM 3G6EF 3CCMF 1RLGA 3NK6A 2OZBA 1IPAA 3CCJF 1QVGF 1X7PA 1VQOF 3G71F 3CC2F 1VQ5F 5IT9M 3GYQA 3G4SF 5A2QM 3CC7F 2LBWA 1W42A 1VQKF 3LWRC 3RA5A 3VI6A 1N8RH 1KC8H 1KD1H 3HJWC 3NVIB 2QI2A 3HAXD 5GIOC 3SIUA 3CC4F 2I6DA 1RA4A 2KG4A 2KTUA 3NMUC 3RA6A 3FFMA 3CCLF 1M90H 5DCVA 3OBYA 2LBXA 1YJ9F 2QEXF 3LWQC 2VGNA 1M1KH 3AGKA 3E1YA 2FC3A 5GAPK 3LWPC 1YJWF 1SDSA 3CPWF 3CCUF 1QVFF 3VMFB 1NMUB 2BO1A 1VQ8F 3LWOC 3CCSF 1CN7A 1X52A 4X3MA 1Q86H 2HVYD 3CCEF 4X3LA 2VGMA 5EWRA 3PLAC 1DT9A 1K73H 3CD6F 3WXMB 1K9MH 1XBIA 4BW0B 2ALEA 5GINC 4C4WC 5G4UC 1K8AH 1VQ7F 3NVKE 2JNBA 3SIVA 5EO3A 1W2BF 1VQMF 3CMAF 3NK7A 3OBWA 3CCVF 1VQPF 5G4VC 1YITF 1VQLF 1VQ9F 4LCKA 4TZZA 3CPQA 1VQ6F 3ON1A 1ZWZA 1YHQF 2AIFA 1YIJF 3J7AR 1KQSF 2OTLF 1T0KB 5FJ4C 1JJ2F
chains in the Genus database with same CATH superfamily
2G9IA 2HP0A 1W40A 2LCAA 1IV2A 3S02A 5GANK 2HRUA 3JAWA 5EZYB 3OW2F 5ITZB 3O85A 4B46A 3J81M 2QA4F 1Q81H 3HKCB 3V7QA 5LP6B 5HY0A 3MCAB 2CHTA 2LBTA 3UT5B 1GO1A 3KJKA 3K14A 3LFOA 1YI2F 1Q7YH 4G4YA 4I50A 1SA0B 4BT2A 3C9TA 5IJ9A 2UYJA 3HKEB 4O4JB 4RHAA 2CZWA 4U3JB 2OTMA 5FLXM 4EB6A 3K2XA 3CCMF 5LOVB 1U3PA 3VIUA 3CCJF 3G71F 1VQ5F 2HRYA 5IT9M 3JAKA 3E22A 1TUBB 5C8YA 3ESJA 3VI6A 3HJWC 5JH7A 3KE1A 2PHNA 3N2KA 1XRGA 4O2BB 4O4JA 1H48A 1RA4A 1OAPA 4ZI7B 3FFMA 5GONA 4X1IA 1M90H 4E6EA 2QEXF 4G4WA 4DRXA 3LWQC 2HS4A 4O4IB 3FD5A 3BYQA 3E1YA 2FC3A 1YJWF 2HQSC 2H8EA 4X1KB 2ZF8A 5IJ9B 3CCSF 1CN7A 3F0GA 3ERNA 4ZI7A 5LOVA 5HY2A 1K73H 2V9YA 2BTQB 3EORA 5JH7B 4KWEA 2ALEA 3UT5A 1QD9A 3ELCA 3V3TA 2UZHA 2YYEA 1W59A 3WPWA 1K8AH 2MQEA 2Z1TA 2JNBA 5JVDA 3GTZA 4R40B 5EO3A 1W2BF 3RYHA 4WBNA 3CCVF 1VQ9F 3MBMA 4YJ2B 2HP3A 2Z01A 3JALA 3HKDA 3JASA 5HXZA 4X20A 4TUYB 3VOBA 4C82A 3K0TA 3E20B 5JQGB 5ITZA 1W581 1VHAA 3CG6A 1H7MA 3FD6A 2CHSA 2UYPA 1FFXA 4BVSA 1YJNF 1E7KA 3WPXA 5HP8A 3I55F 4G4VA 3CCQF 4U39A 3K12A 2QTPA 1VH8A 4DRXB 3MCQA 1NJIH 3WGJA 3CMEF 3V7EA 4XCQA 2ZOVA 2GZLA 1RQ7A 1XHOA 2ZVZA 3LYBA 3TD5A 4I55A 3GHZA 3TD4A 4BT4A 1FSZA 3JALB 3MDOA 1JFFB 3E22B 1VQOF 5CA1B 2P6YA 4YJ2A 4IHJB 3GYQA 3ZP7A 3IKFA 4EI7A 5HXUA 2YXZA 4RQOA 4BT3A 1YQNA 3CC7F 4X20B 3RA5A 1N8RH 4O2BA 1DBFA 2R6R1 4BT7A 5CB4A 3S0HA 3R0PA 2BTUA 5HY1A 5IYZB 3SIUA 3KHNA 2I6DA 3QTYA 3RYHB 4I4TB 2HS0A 1VQVA 1KNJA 3RYCB 3D54A 3JARA 5MN5A 2N48A 1CLIA 1QU9A 1IV1A 5EAZA 3VYSC 5BMVA 1YJ9F 2VGNA 3L7QA 1SA0A 3B6NA 4BVQA 3LWPC 4TUYA 2Q1XA 1TUBA 4ZHVA 4EB6B 3VO8A 3CCUF 1QVFF 3HWUA 3JATB 3VMFB 3CYPB 1U43A 2KGWA 2UYNA 4F6RB 5CA0B 1X52A 4EI8A 1FFXB 1Q86H 2HVYD 3CCEF 3VTIC 3RYCA 5HP7A 3PLAC 3JVHA 1NQ3A 1TVKB 2DT4A 4IHJA 3IMPA 2AIZP 4EI9A 1W5BA 3C9RA 4I4TA 4C4WC 5LYJB 5G4UC 3RYIA 2UYNB 5CA0A 4F6RA 3QUWA 4B62A 3Q8HA 4ZOLA 3SIVA 1VQMF 2K1SA 2B33A 3CMAF 3WGKA 3OBWA 1VQPF 3IEQA 1VQLF 1YITF 4G4XA 3CPQA 3CB2A 2VAMA 1ODEA 5JQGA 2HP0B 2RHJA 4NQ3A 5B8FA 4X1YB 1UI9A 1CK2A 5EZYA 3C9UA 5KX5B 3I56F 2RHOA 2OTJF 1GO0A 4TV9B 3IKEA 3F6MA 2CWJA 1GX1A 4O4HB 5EYPB 2RB9A 2NMUA 3LWVC 1GZ0A 1Q82H 2KTVA 1TVKA 4NUTA 3PAFA 3VYUC 4C8IA 3N4YA 1JD1A 3IR9A 1COMA 1PXWA 4BT5A 4X1YA 4HNAA 2ZAUA 3WJQA 4BY9D 1S72F 3JCMM 1J7HA 3M1XA 5LYJA 4C81A 3G6EF 2FGYA 3VYTC 4O4HA 5EYPA 3DDNA 3KIZA 4M8IA 1VK3A 2BTOA 3D00A 5HY4A 1QVGF 1X7PA 2CVLA 4YJ3A 3ZP4A 5LXTA 3G4SF 4BT6A 2IG8A 2UYKA 5A2QM 3TD3A 5HWEA 1W42A 5FNVB 3WJPA 3NVIB 1SZQA 2QI2A 1OFUA 3ZOPA 5IJ0B 1H47A 5KX5A 3HAXD 4G4ZA 1FNJA 4TV8A 4BVRA 4X1IB 3M4SA 2KG4A 2KTUA 3C8LA 3NMUC 1IV4A 2PMPA 5DCVA 5LP6C 1W55A 4O4IA 3M84A 1RLUA 1M1KH 3AGKA 5KMGB 4I55B 5J2UB 3JATA 1SDSA 2EWCA 3P0ZA 3RYFB 4ZHQB 4O4LB 2BO1A 3I7TA 5EB0A 1PF5A 3S0YA 4G88A 4X3MA 3VOAA 5MN6A 4ERHA 4X3LA 3F0FA 3N2GB 3VCZA 1DT9A 3JARB 3CD6F 1K9MH 5FNVA 4YJ3B 5LXTB 4BW0B 5CB4B 3HKCA 5J2TA 4HNAB 3HKBA 3RYIB 4ZHWA 1U3LA 3MQWA 1U40A 3FBAA 2Z1UA 1YGYA 1Z5VA 3OONA 3JAWB 4O4LA 5IJ0A 1VQ7F 3C9SA 2RHLA 1JN1A 1ONIA 3S03A 1Z5WA 5BMVB 2VAPA 4U3JA 4LCKA 1VQ6F 2DYYA 3ON1A 3RYFA 2RHHA 1YIJF 3J7AR 2OTLF 5JCOA 3D01A 1JY8A 2W8BC 5LA6A 1JJ2F 1X25A 3JAKB 3JAMM 1R1MA 4TV9A 5AVMA 5GIPC 4TV8B 4ZHQA 4C8GA 3WGMA 2WALA 5EIBC 1X7OA 3N2KB 1XV2A 3F0DA 3N4ZA 1VQNF 1IV3A 2OHWA 3IEWA 3U0OA 1W41A 3I3FA 1W3EX 3J80M 4IIJA 2CSLA 5LA6B 3KJJA 2HX0A 2I6RA 2HS3A 3CCRF 3CXCF 2GVIA 1VQ4F 2Z1FA 3FPIA 3S0WA 2AMTA 4I50B 1JFFA 3S06A 2F9ZC 2CW4A 1RLGA 3NK6A 4BVTA 3N2GA 3HKEA 2OZBA 1W5EA 1IPAA 3ZO8A 3CC2F 1RQ2A 3P4EA 3LDTA 2IAFA 3T80A 1FNKA 3WGLA 3HKBB 2LBWA 1VQKF 4ZK7A 3LWRC 1KC8H 3F0EA 1KD1H 4X1KA 4FFBA 3WJRA 4PWTA 5GIOC 1T0AA 4C8EA 3RE3A 3CC4F 2L26A 3RA6A 4ZHYB 5IYZA 3CCLF 2H8CA 4O2AB 3OBYA 5EB1B 2LBXA 5KMGA 3WGNA 1QAHA 4LNUA 5GAPK 4IIJB 3DC2A 5MN4A 3CPWF 3HKDB 3JASB 4B45A 1UFYA 1NMUB 4DXDA 3LMEA 1VQ8F 3LWOC 2VAWA 5FJ4C 2VXYA 2IQQA 4WBNB 2VGMA 5EWRA 3P10A 3WXMB 5JCOC 2H6LA 2Q1YA 1W5FA 2ZVYA 1XBIA 4NWOB 1Q8RA 3QHDA 3V4DA 5J2UA 3CYQA 5C8YB 5GINC 4ZOLB 4FFBB 4O2AA 3NVKE 2R751 3HTNA 5EIBD 3NK7A 4B5CA 2Z1EA 5GONB 5JVDB 1KNKA 2GLZA 5G4VC 4LNUB 5LP6A 2ZODA 4TZZA 1ZWZA 1YHQF 2AIFA 1KQSF 1T0KB 1W5AA 5CA1A 1W57A 5J2TB
chains in the Genus database with same CATH topology
1CK2A 3E20B 3JAMM 5GIPC 1W40A 3I56F 5GANK 2OTJF 1GO0A 3OW2F 2WALA 3CG6A 1H7MA 4BVSA 1E7KA 1YJNF 1X7OA 3O85A 1GZ0A 3LWVC 3J81M 3I55F 3CCQF 3N4ZA 2QA4F 1Q82H 1Q81H 3V7QA 5HY0A 2KTVA 1VQNF 4NUTA 1NJIH 2OHWA 3PAFA 3MCAB 3CMEF 3N4YA 1W41A 3IR9A 3V7EA 4XCQA 1W3EX 3J80M 1YI2F 1GO1A 1PXWA 3LFOA 1Q7YH 4BY9D 3CCRF 1S72F 3CXCF 3JCMM 1VQ4F 2CZWA 5FLXM 3G6EF 2FGYA 2F9ZC 3CCMF 1RLGA 3NK6A 4BVTA 2OZBA 3D00A 1IPAA 5HY4A 3CCJF 1X7PA 1QVGF 1VQOF 3G71F 3CC2F 1VQ5F 5IT9M 3GYQA 3G4SF 5HXUA 4EI7A 5A2QM 5HWEA 3CC7F 2LBWA 1W42A 1VQKF 3LWRC 3RA5A 3VI6A 1N8RH 1KC8H 1KD1H 3HJWC 3NVIB 2QI2A 3HAXD 5GIOC 4BVRA 5HY1A 3SIUA 3CC4F 2I6DA 1RA4A 2KG4A 2KTUA 3NMUC 3RA6A 3FFMA 3CCLF 1M90H 5DCVA 3OBYA 2LBXA 1YJ9F 2QEXF 3LWQC 2VGNA 1M1KH 3AGKA 3E1YA 4BVQA 2FC3A 5GAPK 3LWPC 1YJWF 1SDSA 3CPWF 3CCUF 1QVFF 3VMFB 1NMUB 2BO1A 1VQ8F 3LWOC 3CCSF 1CN7A 1X52A 4EI8A 4X3MA 1Q86H 2HVYD 3CCEF 4X3LA 2VGMA 5EWRA 3PLAC 5HY2A 1DT9A 1K73H 3CD6F 3WXMB 1K9MH 1XBIA 4BW0B 2ALEA 3V3TA 5GINC 4EI9A 4C4WC 5G4UC 1K8AH 1VQ7F 3NVKE 2JNBA 3SIVA 5EO3A 1W2BF 1VQMF 3CMAF 3NK7A 3OBWA 3CCVF 2GLZA 1VQPF 5G4VC 1YITF 1VQLF 1VQ9F 4LCKA 4TZZA 3CPQA 1VQ6F 3ON1A 1ZWZA 1YHQF 2AIFA 1YIJF 3J7AR 1KQSF 2OTLF 1T0KB 4NQ3A 5HXZA 5FJ4C 1JJ2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK2 A;  3E20 B;  3JAM M;  5GIP C;  1W40 A;  3I56 F;  5GAN K;  2OTJ F;  1GO0 A;  3OW2 F;  2WAL A;  3CG6 A;  1H7M A;  1E7K A;  1YJN F;  1X7O A;  3O85 A;  1GZ0 A;  3LWV C;  3J81 M;  3I55 F;  3CCQ F;  3N4Z A;  2QA4 F;  1Q82 H;  1Q81 H;  3V7Q A;  2KTV A;  1VQN F;  4NUT A;  1NJI H;  2OHW A;  3PAF A;  3MCA B;  3CME F;  3N4Y A;  1W41 A;  3IR9 A;  3V7E A;  1W3E X;  3J80 M;  1YI2 F;  1GO1 A;  1PXW A;  3LFO A;  1Q7Y H;  4BY9 D;  3CCR F;  1S72 F;  3CXC F;  3JCM M;  1VQ4 F;  2CZW A;  5FLX M;  3G6E F;  3CCM F;  1RLG A;  3NK6 A;  2OZB A;  1IPA A;  3CCJ F;  1QVG F;  1X7P A;  1VQO F;  3G71 F;  3CC2 F;  1VQ5 F;  5IT9 M;  3GYQ A;  3G4S F;  5A2Q M;  3CC7 F;  2LBW A;  1W42 A;  1VQK F;  3LWR C;  3RA5 A;  3VI6 A;  1N8R H;  1KC8 H;  1KD1 H;  3HJW C;  3NVI B;  2QI2 A;  3HAX D;  5GIO C;  3SIU A;  3CC4 F;  2I6D A;  1RA4 A;  2KG4 A;  2KTU A;  3NMU C;  3RA6 A;  3FFM A;  3CCL F;  1M90 H;  5DCV A;  3OBY A;  2LBX A;  1YJ9 F;  2QEX F;  3LWQ C;  2VGN A;  1M1K H;  3AGK A;  3E1Y A;  2FC3 A;  5GAP K;  3LWP C;  1YJW F;  1SDS A;  3CPW F;  3CCU F;  1QVF F;  3VMF B;  1NMU B;  2BO1 A;  1VQ8 F;  3LWO C;  3CCS F;  1CN7 A;  1X52 A;  4X3M A;  1Q86 H;  2HVY D;  3CCE F;  4X3L A;  2VGM A;  5EWR A;  3PLA C;  1DT9 A;  1K73 H;  3CD6 F;  3WXM B;  1K9M H;  1XBI A;  4BW0 B;  2ALE A;  5GIN C;  4C4W C;  5G4U C;  1K8A H;  1VQ7 F;  3NVK E;  2JNB A;  3SIV A;  5EO3 A;  1W2B F;  1VQM F;  3CMA F;  3NK7 A;  3OBW A;  3CCV F;  1VQP F;  5G4V C;  1YIT F;  1VQL F;  1VQ9 F;  4LCK A;  4TZZ A;  3CPQ A;  1VQ6 F;  3ON1 A;  1ZWZ A;  1YHQ F;  2AIF A;  1YIJ F;  3J7A R;  1KQS F;  2OTL F;  1T0K B;  5FJ4 C;  1JJ2 F; 
#chains in the Genus database with same CATH topology
 2G9I A;  2HP0 A;  1W40 A;  2LCA A;  1IV2 A;  3S02 A;  5GAN K;  2HRU A;  3JAW A;  5EZY B;  3OW2 F;  5ITZ B;  3O85 A;  4B46 A;  3J81 M;  2QA4 F;  1Q81 H;  3HKC B;  3V7Q A;  5LP6 B;  5HY0 A;  3MCA B;  2CHT A;  2LBT A;  3UT5 B;  1GO1 A;  3KJK A;  3K14 A;  3LFO A;  1YI2 F;  1Q7Y H;  4G4Y A;  4I50 A;  1SA0 B;  4BT2 A;  3C9T A;  5IJ9 A;  2UYJ A;  3HKE B;  4O4J B;  4RHA A;  2CZW A;  4U3J B;  2OTM A;  5FLX M;  4EB6 A;  3K2X A;  3CCM F;  5LOV B;  1U3P A;  3VIU A;  3CCJ F;  3G71 F;  1VQ5 F;  2HRY A;  5IT9 M;  3JAK A;  3E22 A;  1TUB B;  5C8Y A;  3ESJ A;  3VI6 A;  3HJW C;  5JH7 A;  3KE1 A;  2PHN A;  3N2K A;  1XRG A;  4O2B B;  4O4J A;  1H48 A;  1RA4 A;  1OAP A;  4ZI7 B;  3FFM A;  5GON A;  4X1I A;  1M90 H;  4E6E A;  2QEX F;  4G4W A;  4DRX A;  3LWQ C;  2HS4 A;  4O4I B;  3FD5 A;  3BYQ A;  3E1Y A;  2FC3 A;  1YJW F;  2HQS C;  2H8E A;  4X1K B;  2ZF8 A;  5IJ9 B;  3CCS F;  1CN7 A;  3F0G A;  3ERN A;  4ZI7 A;  5LOV A;  5HY2 A;  1K73 H;  2V9Y A;  2BTQ B;  3EOR A;  5JH7 B;  4KWE A;  2ALE A;  3UT5 A;  1QD9 A;  3ELC A;  3V3T A;  2UZH A;  2YYE A;  1W59 A;  3WPW A;  1K8A H;  2MQE A;  2Z1T A;  2JNB A;  5JVD A;  3GTZ A;  4R40 B;  5EO3 A;  1W2B F;  3RYH A;  4WBN A;  3CCV F;  1VQ9 F;  3MBM A;  4YJ2 B;  2HP3 A;  2Z01 A;  3JAL A;  3HKD A;  3JAS A;  5HXZ A;  4X20 A;  4TUY B;  3VOB A;  4C82 A;  3K0T A;  3E20 B;  5JQG B;  5ITZ A;  1W58 1;  1VHA A;  3CG6 A;  1H7M A;  3FD6 A;  2CHS A;  2UYP A;  1FFX A;  4BVS A;  1YJN F;  1E7K A;  3WPX A;  5HP8 A;  3I55 F;  4G4V A;  3CCQ F;  4U39 A;  3K12 A;  2QTP A;  1VH8 A;  4DRX B;  3MCQ A;  1NJI H;  3WGJ A;  3CME F;  3V7E A;  4XCQ A;  2ZOV A;  2GZL A;  1RQ7 A;  1XHO A;  2ZVZ A;  3LYB A;  3TD5 A;  4I55 A;  3GHZ A;  3TD4 A;  4BT4 A;  1FSZ A;  3JAL B;  3MDO A;  1JFF B;  3E22 B;  1VQO F;  5CA1 B;  2P6Y A;  4YJ2 A;  4IHJ B;  3GYQ A;  3ZP7 A;  3IKF A;  4EI7 A;  5HXU A;  2YXZ A;  4RQO A;  4BT3 A;  1YQN A;  3CC7 F;  4X20 B;  3RA5 A;  1N8R H;  4O2B A;  1DBF A;  2R6R 1;  4BT7 A;  5CB4 A;  3S0H A;  3R0P A;  2BTU A;  5HY1 A;  5IYZ B;  3SIU A;  3KHN A;  2I6D A;  3QTY A;  3RYH B;  4I4T B;  2HS0 A;  1VQV A;  1KNJ A;  3RYC B;  3D54 A;  3JAR A;  5MN5 A;  2N48 A;  1CLI A;  1QU9 A;  1IV1 A;  5EAZ A;  3VYS C;  5BMV A;  1YJ9 F;  2VGN A;  3L7Q A;  1SA0 A;  3B6N A;  4BVQ A;  3LWP C;  4TUY A;  2Q1X A;  1TUB A;  4ZHV A;  4EB6 B;  3VO8 A;  3CCU F;  1QVF F;  3HWU A;  3JAT B;  3VMF B;  3CYP B;  1U43 A;  2KGW A;  2UYN A;  4F6R B;  5CA0 B;  1X52 A;  4EI8 A;  1FFX B;  1Q86 H;  2HVY D;  3CCE F;  3VTI C;  3RYC A;  5HP7 A;  3PLA C;  3JVH A;  1NQ3 A;  1TVK B;  2DT4 A;  4IHJ A;  3IMP A;  2AIZ P;  4EI9 A;  1W5B A;  3C9R A;  4I4T A;  4C4W C;  5LYJ B;  5G4U C;  3RYI A;  2UYN B;  5CA0 A;  4F6R A;  3QUW A;  4B62 A;  3Q8H A;  4ZOL A;  3SIV A;  1VQM F;  2K1S A;  2B33 A;  3CMA F;  3WGK A;  3OBW A;  1VQP F;  3IEQ A;  1VQL F;  1YIT F;  4G4X A;  3CPQ A;  3CB2 A;  2VAM A;  1ODE A;  5JQG A;  2HP0 B;  2RHJ A;  4NQ3 A;  5B8F A;  4X1Y B;  1UI9 A;  1CK2 A;  5EZY A;  3C9U A;  5KX5 B;  3I56 F;  2RHO A;  2OTJ F;  1GO0 A;  4TV9 B;  3IKE A;  3F6M A;  2CWJ A;  1GX1 A;  4O4H B;  5EYP B;  2RB9 A;  2NMU A;  3LWV C;  1GZ0 A;  1Q82 H;  2KTV A;  1TVK A;  4NUT A;  3PAF A;  3VYU C;  4C8I A;  3N4Y A;  1JD1 A;  3IR9 A;  1COM A;  1PXW A;  4BT5 A;  4X1Y A;  4HNA A;  2ZAU A;  3WJQ A;  4BY9 D;  1S72 F;  3JCM M;  1J7H A;  3M1X A;  5LYJ A;  4C81 A;  3G6E F;  2FGY A;  3VYT C;  4O4H A;  5EYP A;  3DDN A;  3KIZ A;  4M8I A;  1VK3 A;  2BTO A;  3D00 A;  5HY4 A;  1QVG F;  1X7P A;  2CVL A;  4YJ3 A;  3ZP4 A;  5LXT A;  3G4S F;  4BT6 A;  2IG8 A;  2UYK A;  5A2Q M;  3TD3 A;  5HWE A;  1W42 A;  5FNV B;  3WJP A;  3NVI B;  1SZQ A;  2QI2 A;  1OFU A;  3ZOP A;  5IJ0 B;  1H47 A;  5KX5 A;  3HAX D;  4G4Z A;  1FNJ A;  4TV8 A;  4BVR A;  4X1I B;  3M4S A;  2KG4 A;  2KTU A;  3C8L A;  3NMU C;  1IV4 A;  2PMP A;  5DCV A;  5LP6 C;  1W55 A;  4O4I A;  3M84 A;  1RLU A;  1M1K H;  3AGK A;  5KMG B;  4I55 B;  5J2U B;  3JAT A;  1SDS A;  2EWC A;  3P0Z A;  3RYF B;  4ZHQ B;  4O4L B;  2BO1 A;  3I7T A;  5EB0 A;  1PF5 A;  3S0Y A;  4G88 A;  4X3M A;  3VOA A;  5MN6 A;  4ERH A;  4X3L A;  3F0F A;  3N2G B;  3VCZ A;  1DT9 A;  3JAR B;  3CD6 F;  1K9M H;  5FNV A;  4YJ3 B;  5LXT B;  4BW0 B;  5CB4 B;  3HKC A;  5J2T A;  4HNA B;  3HKB A;  3RYI B;  4ZHW A;  1U3L A;  3MQW A;  1U40 A;  3FBA A;  2Z1U A;  1YGY A;  1Z5V A;  3OON A;  3JAW B;  4O4L A;  5IJ0 A;  1VQ7 F;  3C9S A;  2RHL A;  1JN1 A;  1ONI A;  3S03 A;  1Z5W A;  5BMV B;  2VAP A;  4U3J A;  4LCK A;  1VQ6 F;  2DYY A;  3ON1 A;  3RYF A;  2RHH A;  1YIJ F;  3J7A R;  2OTL F;  5JCO A;  3D01 A;  1JY8 A;  2W8B C;  5LA6 A;  1JJ2 F;  1X25 A;  3JAK B;  3JAM M;  1R1M A;  4TV9 A;  5AVM A;  5GIP C;  4TV8 B;  4ZHQ A;  4C8G A;  3WGM A;  2WAL A;  5EIB C;  1X7O A;  3N2K B;  1XV2 A;  3F0D A;  3N4Z A;  1VQN F;  1IV3 A;  2OHW A;  3IEW A;  3U0O A;  1W41 A;  3I3F A;  1W3E X;  3J80 M;  4IIJ A;  2CSL A;  5LA6 B;  3KJJ A;  2HX0 A;  2I6R A;  2HS3 A;  3CCR F;  3CXC F;  2GVI A;  1VQ4 F;  2Z1F A;  3FPI A;  3S0W A;  2AMT A;  4I50 B;  1JFF A;  3S06 A;  2F9Z C;  2CW4 A;  1RLG A;  3NK6 A;  4BVT A;  3N2G A;  3HKE A;  2OZB A;  1W5E A;  1IPA A;  3ZO8 A;  3CC2 F;  1RQ2 A;  3P4E A;  3LDT A;  2IAF A;  3T80 A;  1FNK A;  3WGL A;  3HKB B;  2LBW A;  1VQK F;  4ZK7 A;  3LWR C;  1KC8 H;  3F0E A;  1KD1 H;  4X1K A;  4FFB A;  3WJR A;  4PWT A;  5GIO C;  1T0A A;  4C8E A;  3RE3 A;  3CC4 F;  2L26 A;  3RA6 A;  4ZHY B;  5IYZ A;  3CCL F;  2H8C A;  4O2A B;  3OBY A;  5EB1 B;  2LBX A;  5KMG A;  3WGN A;  1QAH A;  4LNU A;  5GAP K;  4IIJ B;  3DC2 A;  5MN4 A;  3CPW F;  3HKD B;  3JAS B;  4B45 A;  1UFY A;  1NMU B;  4DXD A;  3LME A;  1VQ8 F;  3LWO C;  2VAW A;  5FJ4 C;  2VXY A;  2IQQ A;  4WBN B;  2VGM A;  5EWR A;  3P10 A;  3WXM B;  5JCO C;  2H6L A;  2Q1Y A;  1W5F A;  2ZVY A;  1XBI A;  4NWO B;  1Q8R A;  3QHD A;  3V4D A;  5J2U A;  3CYQ A;  5C8Y B;  5GIN C;  4ZOL B;  4FFB B;  4O2A A;  3NVK E;  2R75 1;  3HTN A;  5EIB D;  3NK7 A;  4B5C A;  2Z1E A;  5GON B;  5JVD B;  1KNK A;  2GLZ A;  5G4V C;  4LNU B;  5LP6 A;  2ZOD A;  4TZZ A;  1ZWZ A;  1YHQ F;  2AIF A;  1KQS F;  1T0K B;  1W5A A;  5CA1 A;  1W57 A;  5J2T B; 
#chains in the Genus database with same CATH homology
 1CK2 A;  3E20 B;  3JAM M;  5GIP C;  1W40 A;  3I56 F;  5GAN K;  2OTJ F;  1GO0 A;  3OW2 F;  2WAL A;  3CG6 A;  1H7M A;  4BVS A;  1E7K A;  1YJN F;  1X7O A;  3O85 A;  1GZ0 A;  3LWV C;  3J81 M;  3I55 F;  3CCQ F;  3N4Z A;  2QA4 F;  1Q82 H;  1Q81 H;  3V7Q A;  5HY0 A;  2KTV A;  1VQN F;  4NUT A;  1NJI H;  2OHW A;  3PAF A;  3MCA B;  3CME F;  3N4Y A;  1W41 A;  3IR9 A;  3V7E A;  4XCQ A;  1W3E X;  3J80 M;  1YI2 F;  1GO1 A;  1PXW A;  3LFO A;  1Q7Y H;  4BY9 D;  3CCR F;  1S72 F;  3CXC F;  3JCM M;  1VQ4 F;  2CZW A;  5FLX M;  3G6E F;  2FGY A;  2F9Z C;  3CCM F;  1RLG A;  3NK6 A;  4BVT A;  2OZB A;  3D00 A;  1IPA A;  5HY4 A;  3CCJ F;  1X7P A;  1QVG F;  1VQO F;  3G71 F;  3CC2 F;  1VQ5 F;  5IT9 M;  3GYQ A;  3G4S F;  5HXU A;  4EI7 A;  5A2Q M;  5HWE A;  3CC7 F;  2LBW A;  1W42 A;  1VQK F;  3LWR C;  3RA5 A;  3VI6 A;  1N8R H;  1KC8 H;  1KD1 H;  3HJW C;  3NVI B;  2QI2 A;  3HAX D;  5GIO C;  4BVR A;  5HY1 A;  3SIU A;  3CC4 F;  2I6D A;  1RA4 A;  2KG4 A;  2KTU A;  3NMU C;  3RA6 A;  3FFM A;  3CCL F;  1M90 H;  5DCV A;  3OBY A;  2LBX A;  1YJ9 F;  2QEX F;  3LWQ C;  2VGN A;  1M1K H;  3AGK A;  3E1Y A;  4BVQ A;  2FC3 A;  5GAP K;  3LWP C;  1YJW F;  1SDS A;  3CPW F;  3CCU F;  1QVF F;  3VMF B;  1NMU B;  2BO1 A;  1VQ8 F;  3LWO C;  3CCS F;  1CN7 A;  1X52 A;  4EI8 A;  4X3M A;  1Q86 H;  2HVY D;  3CCE F;  4X3L A;  2VGM A;  5EWR A;  3PLA C;  5HY2 A;  1DT9 A;  1K73 H;  3CD6 F;  3WXM B;  1K9M H;  1XBI A;  4BW0 B;  2ALE A;  3V3T A;  5GIN C;  4EI9 A;  4C4W C;  5G4U C;  1K8A H;  1VQ7 F;  3NVK E;  2JNB A;  3SIV A;  5EO3 A;  1W2B F;  1VQM F;  3CMA F;  3NK7 A;  3OBW A;  3CCV F;  2GLZ A;  1VQP F;  5G4V C;  1YIT F;  1VQL F;  1VQ9 F;  4LCK A;  4TZZ A;  3CPQ A;  1VQ6 F;  3ON1 A;  1ZWZ A;  1YHQ F;  2AIF A;  1YIJ F;  3J7A R;  1KQS F;  2OTL F;  1T0K B;  4NQ3 A;  5HXZ A;  5FJ4 C;  1JJ2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...