1VQOF

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
b'PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqoF00
3LWVC 3CPQA 1S72F 1H7MA 1W42A 3OBYA 1VQNF 1GO1A 1VQKF 1W3EX 3PAFA 3G71F 1XBIA 1VQ6F 1CN7A 2AIFA 3CCMF 3IR9A 3GYQA 3AGKA 1N8RH 2OZBA 3JAMM 5A2QM 3CPWF 4X3LA 1M90H 1K73H 1JJ2F 1K8AH 1Q7YH 3LFOA 5G4UC 5EO3A 3CC7F 1NJIH 2I6DA 3CCQF 3LWQC 3G4SF 3FFMA 5GINC 1M1KH 1X52A 1K9MH 2ALEA 1RA4A 3N4ZA 1YHQF 3VMFB 5GIPC 3LWOC 3SIVA 3NK6A 3J81M 1QVFF 2BO1A 1PXWA 1T0KB 3E1YA 1E7KA 1NMUB 2HVYD 1VQLF 1IPAA 3G6EF 3HAXD 3N4YA 3J80M 3CCRF 1QVGF 3OW2F 3RA5A 4NUTA 1VQOF 3NVIB 2KG4A 3V7QA 3JCMM 1VQ8F 4BW0B 1ZWZA 4BY9D 1RLGA 1X7PA 1YITF 1SDSA 3CCLF 3CG6A 1Q82H 3CXCF 3NK7A 5FJ4C 3CCEF 3I56F 1VQ9F 3OBWA 3LWRC 2WALA 3J7AR 1X7OA 1YJWF 3CC4F 3E20B 3CCUF 5GIOC 2VGMA 1VQ7F 2QI2A 1KQSF 1VQ5F 1KC8H 3CD6F 3WXMB 2JNBA 3CCVF 5EWRA 2OTJF 3VI6A 2OHWA 3ON1A 3RA6A 3HJWC 3LWPC 3MCAB 2LBWA 3I55F 2QEXF 1VQPF 3NVKE 1W40A 4LCKA 1GO0A 5G4VC 1VQMF 1GZ0A 1KD1H 1W41A 2KTUA 5GANK 5GAPK 1Q86H 1YJ9F 3CCSF 3CCJF 4TZZA 3O85A 3CC2F 2LBXA 1YIJF 1W2BF 3NMUC 5IT9M 4X3MA 4C4WC 1YI2F 1CK2A 1Q81H 3PLAC 5FLXM 2QA4F 2FC3A 2CZWA 3SIUA 2OTLF 2KTVA 1VQ4F 3V7EA 1YJNF 1DT9A 2VGNA 5DCVA 3CMEF 3CMAF
chains in the Genus database with same CATH superfamily
4TV9A 3WGJA 2RHHA 2ZAUA 4O4LB 2HX0A 3S06A 1VQKF 4I55B 2L26A 2ZODA 2NMUA 1VQ6F 3RYHB 3AGKA 5MN6A 3JAKB 4IHJA 3WJPA 3CPWF 3HKCB 3VYTC 1W57A 2I6RA 3T80A 1K8AH 1Q7YH 5LYJB 1XRGA 2UYNA 3E22A 2H8EA 3CCQF 2QTPA 3G4SF 1Q8RA 1TVKB 3FFMA 1K9MH 2UYPA 3K14A 5GIPC 4B62A 1W5EA 3NK6A 4C8GA 4YJ2B 4RHAA 4I50B 4O4LA 1KNJA 1FSZA 1VQLF 3VO8A 3G6EF 3JATB 4G4VA 1H48A 2HP0A 4IIJA 3ERNA 5HXUA 3J80M 1QVGF 3RYHA 2Z1EA 1QU9A 3HKCA 4X1IA 3I3FA 4EB6B 2HRYA 1ZWZA 5JVDB 5LA6B 4BW0B 4BY9D 1QAHA 1RLGA 2HQSC 2VXYA 3U0OA 2IQQA 4BVSA 3MCQA 1Q82H 1TVKA 4FFBB 3VOAA 3M4SA 2GLZA 3OONA 2WALA 3J7AR 5CA0B 3E20B 4YJ2A 5GIOC 2QI2A 2CSLA 3S0YA 4I50A 1XV2A 3CYPB 3F0EA 3VTIC 3IMPA 3C9RA 2JNBA 1RLUA 4ZHVA 3V4DA 5EZYB 5LOVB 3VI6A 3ON1A 5FNVB 3MCAB 2PHNA 4X20B 2LBWA 2RHOA 2HP3A 4EB6A 3D54A 1U3PA 4LCKA 2P6YA 2Z01A 1SA0B 2Q1XA 1VQMF 5HXZA 4O4HB 4DXDA 5HY2A 5JQGA 1YJ9F 5J2UB 3CCJF 5EYPB 4TZZA 3UT5B 3NMUC 3MBMA 2OTMA 3M1XA 5CA0A 2RHLA 3CB2A 1R1MA 3V7EA 1YJNF 5EZYA 3RYFA 1DT9A 3ZP7A 1VQ9F 5DCVA 3JALB 3VIUA 1U40A 1IV4A 1OFUA 5EB0A 1H7MA 4HNAA 2CHSA 3OBYA 3CYQA 3JAWA 3HKBB 4I4TB 1U3LA 4ZHYB 4O4HA 1JD1A 4NWOB 5KMGB 5J2UA 4BVQA 4ZHWA 5EYPA 3JAMM 2OZBA 3UT5A 5CA1B 1K73H 1M90H 4YJ3B 1OAPA 3MQWA 2HS3A 5LP6B 5EO3A 3CC7F 3DDNA 4DRXA 3LWQC 5GINC 1M1KH 1X52A 3ESJA 5HY1A 4LNUB 1VQVA 3S03A 5B8FA 1YHQF 3P4EA 3RYIB 3KE1A 4EI8A 2BO1A 1QVFF 3E1YA 4F6RA 5IYZA 5MN4A 2CW4A 3F0GA 3HAXD 2GZLA 2LCAA 4I4TA 2HRUA 4ZOLB 4C81A 1IV3A 5KMGA 4BVTA 2UYJA 3OW2F 3RA5A 3HKEB 5HY4A 3R0PA 5CA1A 2UYKA 4TUYA 4C8EA 1FFXA 1VQ8F 5LP6A 1Z5WA 4X1YB 4G4WA 3KIZA 1X7PA 5ITZB 1SDSA 4U39A 3CG6A 4EI7A 1RQ7A 3QTYA 5EB1B 3P0ZA 1ONIA 4LNUA 3WPWA 2UZHA 3I56F 1GX1A 3RYIA 1SZQA 3RE3A 5HP7A 1YJWF 3CC4F 1W5AA 3QUWA 4I55A 1VQ5F 2VAMA 4EI9A 2YXZA 4TV8B 4C82A 3CCVF 1W5BA 3HKDB 4ZOLA 5EWRA 1TUBB 3JAKA 3ZOPA 1RQ2A 4E6EA 2OHWA 4O4IB 4WBNB 3HKEA 3I55F 5LYJA 2QEXF 3F0FA 3C9TA 3TD5A 2VAPA 2ZOVA 3D01A 4X1YA 1W40A 4G4XA 3VCZA 2RB9A 5CB4B 5ITZA 1KD1H 1GZ0A 1W41A 2KTUA 4O2AB 1JY8A 3CCSF 4BT6A 1COMA 3FBAA 2LBXA 1YIJF 1W2BF 1YI2F 1CK2A 2N48A 1W5FA 1Q81H 5EIBD 2BTUA 3JATA 2CZWA 3WJRA 5KX5B 2VGNA 5IJ9B 3CMEF 1FNJA 3TD3A 3LWVC 4PWTA 1S72F 1W581 2IAFA 2ZVZA 1W42A 3GHZA 5LA6A 5JVDA 3I7TA 4X1KB 1VQNF 1GO1A 3BYQA 4G4ZA 3FPIA 2K1SA 5CB4A 4FFBA 4O2AA 2H8CA 1CN7A 1XHOA 3IR9A 1ODEA 3GYQA 2ZVYA 1T0AA 1IV2A 5A2QM 3JARB 4X3LA 1JJ2F 3JASB 3LFOA 3N2KB 2GVIA 2G9IA 4BT5A 5G4UC 2LBTA 4O4JB 2I6DA 3HTNA 2CVLA 4ERHA 3KJKA 4BT2A 5LOVA 2Z1TA 2ALEA 2BTQB 5FNVA 1RA4A 1YQNA 4X20A 3VMFB 4M8IA 3SIVA 4B46A 3LMEA 5C8YB 3J81M 1T0KB 3F0DA 2Z1FA 1E7KA 1SA0A 2HVYD 1CLIA 3WGMA 4NQ3A 3N4YA 3CCRF 1W59A 3ZP4A 4NUTA 3JARA 1VQOF 3S0HA 2KG4A 4ZI7B 3JASA 3FD5A 4O2BB 1JN1A 1FNKA 1YITF 2R751 4XCQA 3K12A 3F6MA 3CCLF 4BT4A 3FD6A 3CXCF 3JALA 4BT7A 5FJ4C 3VYSC 5J2TB 4B45A 2IG8A 3MDOA 3KHNA 5C8YA 3D00A 1KC8H 2HS0A 3CD6F 3HKBA 2AIZP 3WGKA 3LYBA 2UYNB 5EIBC 3VOBA 3RYCB 3L7QA 3EORA 3IEWA 3WGNA 3RA6A 3HWUA 3HJWC 4YJ3A 3LWPC 3B6NA 4ZI7A 3WJQA 2H6LA 5LXTB 2PMPA 4O2BA 3N2GB 2CHTA 3IKFA 2V9YA 3TD4A 3KJJA 4ZK7A 1Q86H 2EWCA 2HP0B 4IIJB 5J2TA 3O85A 4BVRA 3K2XA 1KNKA 5LP6C 5BMVB 3C9SA 4X1IB 3P10A 5MN5A 4KWEA 3PLAC 2QA4F 3V3TA 3SIUA 2KTVA 1VQ4F 3RYCA 1X25A 3CPQA 4U3JB 2Z1UA 5IJ0B 2VAWA 2B33A 1JFFB 4G88A 4BT3A 4RQOA 2Q1YA 5LXTA 3N2GA 1VHAA 5JCOA 1W3EX 3PAFA 5GONB 1XBIA 1QD9A 3G71F 2AIFA 2MQEA 3CCMF 3S02A 1N8RH 1VK3A 3QHDA 2AMTA 2FGYA 5BMVA 3GTZA 4TV8A 3IKEA 5JCOC 1NJIH 3HKDA 1TUBA 3ELCA 4R40B 5JH7B 3C8LA 4O4IA 2CWJA 4WBNA 3N4ZA 3IEQA 3K0TA 5JQGB 1Z5VA 3LWOC 3ZO8A 4U3JA 1PXWA 5IJ0A 1NMUB 1JFFA 2F9ZC 1IPAA 1W55A 5GONA 2DT4A 3C9UA 2W8BC 3S0WA 3RYFB 3NVIB 3V7QA 3JCMM 4ZHQB 4HNAB 2BTOA 5EAZA 2ZF8A 3JAWB 5JH7A 5KX5A 3NK7A 5IJ9A 3CCEF 5HWEA 3OBWA 3LWRC 1IV1A 4X1KA 1X7OA 3CCUF 1VQ7F 2VGMA 2HS4A 2KGWA 3LDTA 1KQSF 2DYYA 3JVHA 3Q8HA 3WXMB 2RHJA 4DRXB 3M84A 1VH8A 1H47A 2OTJF 4C8IA 2R6R1 4TV9B 1YGYA 3WPXA 3N2KA 3DC2A 1VQPF 4ZHQA 4O4JA 3NVKE 5HP8A 4F6RB 1GO0A 5IYZB 5G4VC 5HY0A 1PF5A 5GANK 5GAPK 4B5CA 1UI9A 4IHJB 3CC2F 5IT9M 1U43A 3VYUC 4X3MA 4C4WC 1J7HA 4TUYB 1DBFA 1FFXB 1UFYA 5FLXM 2FC3A 3E22B 3WGLA 2OTLF 2YYEA 4G4YA 5AVMA 1NQ3A 3CMAF
chains in the Genus database with same CATH topology
3LWVC 3CPQA 1S72F 1H7MA 1W42A 3OBYA 1VQNF 1GO1A 1VQKF 1W3EX 3PAFA 3G71F 1XBIA 1VQ6F 1CN7A 2AIFA 3CCMF 3IR9A 3GYQA 3AGKA 1N8RH 4BVQA 2OZBA 3JAMM 5A2QM 3CPWF 4X3LA 1M90H 1K73H 2FGYA 1JJ2F 1K8AH 1Q7YH 3LFOA 5G4UC 5EO3A 3CC7F 1NJIH 2I6DA 3CCQF 3LWQC 3G4SF 3FFMA 5GINC 1M1KH 1X52A 1K9MH 2ALEA 5HY1A 1RA4A 3N4ZA 1YHQF 3VMFB 5GIPC 3LWOC 3SIVA 3NK6A 3J81M 4EI8A 2BO1A 1QVFF 1PXWA 1T0KB 3E1YA 1E7KA 1NMUB 2HVYD 2F9ZC 1VQLF 1IPAA 3G6EF 3HAXD 4NQ3A 3N4YA 5HXUA 3J80M 3CCRF 1QVGF 4BVTA 3OW2F 3RA5A 4NUTA 5HY4A 1VQOF 3NVIB 2KG4A 3V7QA 3JCMM 1VQ8F 4BW0B 1ZWZA 4BY9D 1RLGA 1X7PA 1YITF 4XCQA 1SDSA 3CCLF 3CG6A 4EI7A 4BVSA 1Q82H 3CXCF 3NK7A 5FJ4C 3CCEF 5HWEA 2GLZA 3I56F 1VQ9F 3OBWA 3LWRC 2WALA 3J7AR 1X7OA 3D00A 1YJWF 3E20B 3CC4F 3CCUF 5GIOC 2VGMA 1VQ7F 2QI2A 1KQSF 1VQ5F 1KC8H 4EI9A 3CD6F 3WXMB 2JNBA 3CCVF 5EWRA 2OTJF 3VI6A 2OHWA 3ON1A 3RA6A 3HJWC 3LWPC 3MCAB 2LBWA 3I55F 2QEXF 1VQPF 3NVKE 1W40A 4LCKA 1GO0A 5G4VC 1VQMF 1GZ0A 5HY0A 1KD1H 1W41A 2KTUA 5HXZA 5GANK 5GAPK 5HY2A 1Q86H 1YJ9F 3CCSF 3CCJF 4TZZA 3O85A 3CC2F 4BVRA 2LBXA 1YIJF 1W2BF 3NMUC 5IT9M 4X3MA 4C4WC 1YI2F 1CK2A 1Q81H 3PLAC 5FLXM 2QA4F 2FC3A 3V3TA 2CZWA 3SIUA 2OTLF 2KTVA 1VQ4F 3V7EA 1YJNF 1DT9A 2VGNA 5DCVA 3CMEF 3CMAF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWV C;  3CPQ A;  1S72 F;  1H7M A;  1W42 A;  3OBY A;  1VQN F;  1GO1 A;  1VQK F;  1W3E X;  3PAF A;  3G71 F;  1XBI A;  1VQ6 F;  1CN7 A;  2AIF A;  3CCM F;  3IR9 A;  3GYQ A;  3AGK A;  1N8R H;  2OZB A;  3JAM M;  5A2Q M;  3CPW F;  4X3L A;  1M90 H;  1K73 H;  1JJ2 F;  1K8A H;  1Q7Y H;  3LFO A;  5G4U C;  5EO3 A;  3CC7 F;  1NJI H;  2I6D A;  3CCQ F;  3LWQ C;  3G4S F;  3FFM A;  5GIN C;  1M1K H;  1X52 A;  1K9M H;  2ALE A;  1RA4 A;  3N4Z A;  1YHQ F;  3VMF B;  5GIP C;  3LWO C;  3SIV A;  3NK6 A;  3J81 M;  1QVF F;  2BO1 A;  1PXW A;  1T0K B;  3E1Y A;  1E7K A;  1NMU B;  2HVY D;  1VQL F;  1IPA A;  3G6E F;  3HAX D;  3N4Y A;  3J80 M;  3CCR F;  1QVG F;  3OW2 F;  3RA5 A;  4NUT A;  1VQO F;  3NVI B;  2KG4 A;  3V7Q A;  3JCM M;  1VQ8 F;  4BW0 B;  1ZWZ A;  4BY9 D;  1RLG A;  1X7P A;  1YIT F;  1SDS A;  3CCL F;  3CG6 A;  1Q82 H;  3CXC F;  3NK7 A;  5FJ4 C;  3CCE F;  3I56 F;  1VQ9 F;  3OBW A;  3LWR C;  2WAL A;  3J7A R;  1X7O A;  1YJW F;  3CC4 F;  3E20 B;  3CCU F;  5GIO C;  2VGM A;  1VQ7 F;  2QI2 A;  1KQS F;  1VQ5 F;  1KC8 H;  3CD6 F;  3WXM B;  2JNB A;  3CCV F;  5EWR A;  2OTJ F;  3VI6 A;  2OHW A;  3ON1 A;  3RA6 A;  3HJW C;  3LWP C;  3MCA B;  2LBW A;  3I55 F;  2QEX F;  1VQP F;  3NVK E;  1W40 A;  4LCK A;  1GO0 A;  5G4V C;  1VQM F;  1GZ0 A;  1KD1 H;  1W41 A;  2KTU A;  5GAN K;  5GAP K;  1Q86 H;  1YJ9 F;  3CCS F;  3CCJ F;  4TZZ A;  3O85 A;  3CC2 F;  2LBX A;  1YIJ F;  1W2B F;  3NMU C;  5IT9 M;  4X3M A;  4C4W C;  1YI2 F;  1CK2 A;  1Q81 H;  3PLA C;  5FLX M;  2QA4 F;  2FC3 A;  2CZW A;  3SIU A;  2OTL F;  2KTV A;  1VQ4 F;  3V7E A;  1YJN F;  1DT9 A;  2VGN A;  5DCV A;  3CME F;  3CMA F; 
#chains in the Genus database with same CATH topology
 4TV9 A;  3WGJ A;  2RHH A;  2ZAU A;  4O4L B;  2HX0 A;  3S06 A;  1VQK F;  4I55 B;  2L26 A;  2ZOD A;  2NMU A;  1VQ6 F;  3RYH B;  3AGK A;  5MN6 A;  3JAK B;  4IHJ A;  3WJP A;  3CPW F;  3HKC B;  3VYT C;  1W57 A;  2I6R A;  3T80 A;  1K8A H;  1Q7Y H;  5LYJ B;  1XRG A;  2UYN A;  3E22 A;  2H8E A;  3CCQ F;  2QTP A;  3G4S F;  1Q8R A;  1TVK B;  3FFM A;  1K9M H;  2UYP A;  3K14 A;  5GIP C;  4B62 A;  1W5E A;  3NK6 A;  4C8G A;  4YJ2 B;  4RHA A;  4I50 B;  4O4L A;  1KNJ A;  1FSZ A;  1VQL F;  3VO8 A;  3G6E F;  3JAT B;  4G4V A;  1H48 A;  2HP0 A;  4IIJ A;  3ERN A;  5HXU A;  3J80 M;  1QVG F;  3RYH A;  2Z1E A;  1QU9 A;  3HKC A;  4X1I A;  3I3F A;  4EB6 B;  2HRY A;  1ZWZ A;  5JVD B;  5LA6 B;  4BW0 B;  4BY9 D;  1QAH A;  1RLG A;  2HQS C;  2VXY A;  3U0O A;  2IQQ A;  4BVS A;  3MCQ A;  1Q82 H;  1TVK A;  4FFB B;  3VOA A;  3M4S A;  2GLZ A;  3OON A;  2WAL A;  3J7A R;  5CA0 B;  3E20 B;  4YJ2 A;  5GIO C;  2QI2 A;  2CSL A;  3S0Y A;  4I50 A;  1XV2 A;  3CYP B;  3F0E A;  3VTI C;  3IMP A;  3C9R A;  2JNB A;  1RLU A;  4ZHV A;  3V4D A;  5EZY B;  5LOV B;  3VI6 A;  3ON1 A;  5FNV B;  3MCA B;  2PHN A;  4X20 B;  2LBW A;  2RHO A;  2HP3 A;  4EB6 A;  3D54 A;  1U3P A;  4LCK A;  2P6Y A;  2Z01 A;  1SA0 B;  2Q1X A;  1VQM F;  5HXZ A;  4O4H B;  4DXD A;  5HY2 A;  5JQG A;  1YJ9 F;  5J2U B;  3CCJ F;  5EYP B;  4TZZ A;  3UT5 B;  3NMU C;  3MBM A;  2OTM A;  3M1X A;  5CA0 A;  2RHL A;  3CB2 A;  1R1M A;  3V7E A;  1YJN F;  5EZY A;  3RYF A;  1DT9 A;  3ZP7 A;  1VQ9 F;  5DCV A;  3JAL B;  3VIU A;  1U40 A;  1IV4 A;  1OFU A;  5EB0 A;  1H7M A;  4HNA A;  2CHS A;  3OBY A;  3CYQ A;  3JAW A;  3HKB B;  4I4T B;  1U3L A;  4ZHY B;  4O4H A;  1JD1 A;  4NWO B;  5KMG B;  5J2U A;  4BVQ A;  4ZHW A;  5EYP A;  3JAM M;  2OZB A;  3UT5 A;  5CA1 B;  1K73 H;  1M90 H;  4YJ3 B;  1OAP A;  3MQW A;  2HS3 A;  5LP6 B;  5EO3 A;  3CC7 F;  3DDN A;  4DRX A;  3LWQ C;  5GIN C;  1M1K H;  1X52 A;  3ESJ A;  5HY1 A;  4LNU B;  1VQV A;  3S03 A;  5B8F A;  1YHQ F;  3P4E A;  3RYI B;  3KE1 A;  4EI8 A;  2BO1 A;  1QVF F;  3E1Y A;  4F6R A;  5IYZ A;  5MN4 A;  2CW4 A;  3F0G A;  3HAX D;  2GZL A;  2LCA A;  4I4T A;  2HRU A;  4ZOL B;  4C81 A;  1IV3 A;  5KMG A;  4BVT A;  2UYJ A;  3OW2 F;  3RA5 A;  3HKE B;  5HY4 A;  3R0P A;  5CA1 A;  2UYK A;  4TUY A;  4C8E A;  1FFX A;  1VQ8 F;  5LP6 A;  1Z5W A;  4X1Y B;  4G4W A;  3KIZ A;  1X7P A;  5ITZ B;  1SDS A;  4U39 A;  3CG6 A;  4EI7 A;  1RQ7 A;  3QTY A;  5EB1 B;  3P0Z A;  1ONI A;  4LNU A;  3WPW A;  2UZH A;  3I56 F;  1GX1 A;  3RYI A;  1SZQ A;  3RE3 A;  5HP7 A;  1YJW F;  3CC4 F;  1W5A A;  3QUW A;  4I55 A;  1VQ5 F;  2VAM A;  4EI9 A;  2YXZ A;  4TV8 B;  4C82 A;  3CCV F;  1W5B A;  3HKD B;  4ZOL A;  5EWR A;  1TUB B;  3JAK A;  3ZOP A;  1RQ2 A;  4E6E A;  2OHW A;  4O4I B;  4WBN B;  3HKE A;  3I55 F;  5LYJ A;  2QEX F;  3F0F A;  3C9T A;  3TD5 A;  2VAP A;  2ZOV A;  3D01 A;  4X1Y A;  1W40 A;  4G4X A;  3VCZ A;  2RB9 A;  5CB4 B;  5ITZ A;  1KD1 H;  1GZ0 A;  1W41 A;  2KTU A;  4O2A B;  1JY8 A;  3CCS F;  4BT6 A;  1COM A;  3FBA A;  2LBX A;  1YIJ F;  1W2B F;  1YI2 F;  1CK2 A;  2N48 A;  1W5F A;  1Q81 H;  5EIB D;  2BTU A;  3JAT A;  2CZW A;  3WJR A;  5KX5 B;  2VGN A;  5IJ9 B;  3CME F;  1FNJ A;  3TD3 A;  3LWV C;  4PWT A;  1S72 F;  1W58 1;  2IAF A;  2ZVZ A;  1W42 A;  3GHZ A;  5LA6 A;  5JVD A;  3I7T A;  4X1K B;  1VQN F;  1GO1 A;  3BYQ A;  4G4Z A;  3FPI A;  2K1S A;  5CB4 A;  4FFB A;  4O2A A;  2H8C A;  1CN7 A;  1XHO A;  3IR9 A;  1ODE A;  3GYQ A;  2ZVY A;  1T0A A;  1IV2 A;  5A2Q M;  3JAR B;  4X3L A;  1JJ2 F;  3JAS B;  3LFO A;  3N2K B;  2GVI A;  2G9I A;  4BT5 A;  5G4U C;  2LBT A;  4O4J B;  2I6D A;  3HTN A;  2CVL A;  4ERH A;  3KJK A;  4BT2 A;  5LOV A;  2Z1T A;  2ALE A;  2BTQ B;  5FNV A;  1RA4 A;  1YQN A;  4X20 A;  3VMF B;  4M8I A;  3SIV A;  4B46 A;  3LME A;  5C8Y B;  3J81 M;  1T0K B;  3F0D A;  2Z1F A;  1E7K A;  1SA0 A;  2HVY D;  1CLI A;  3WGM A;  4NQ3 A;  3N4Y A;  3CCR F;  1W59 A;  3ZP4 A;  4NUT A;  3JAR A;  1VQO F;  3S0H A;  2KG4 A;  4ZI7 B;  3JAS A;  3FD5 A;  4O2B B;  1JN1 A;  1FNK A;  1YIT F;  2R75 1;  4XCQ A;  3K12 A;  3F6M A;  3CCL F;  4BT4 A;  3FD6 A;  3CXC F;  3JAL A;  4BT7 A;  5FJ4 C;  3VYS C;  5J2T B;  4B45 A;  2IG8 A;  3MDO A;  3KHN A;  5C8Y A;  3D00 A;  1KC8 H;  2HS0 A;  3CD6 F;  3HKB A;  2AIZ P;  3WGK A;  3LYB A;  2UYN B;  5EIB C;  3VOB A;  3RYC B;  3L7Q A;  3EOR A;  3IEW A;  3WGN A;  3RA6 A;  3HWU A;  3HJW C;  4YJ3 A;  3LWP C;  3B6N A;  4ZI7 A;  3WJQ A;  2H6L A;  5LXT B;  2PMP A;  4O2B A;  3N2G B;  2CHT A;  3IKF A;  2V9Y A;  3TD4 A;  3KJJ A;  4ZK7 A;  1Q86 H;  2EWC A;  2HP0 B;  4IIJ B;  5J2T A;  3O85 A;  4BVR A;  3K2X A;  1KNK A;  5LP6 C;  5BMV B;  3C9S A;  4X1I B;  3P10 A;  5MN5 A;  4KWE A;  3PLA C;  2QA4 F;  3V3T A;  3SIU A;  2KTV A;  1VQ4 F;  3RYC A;  1X25 A;  3CPQ A;  4U3J B;  2Z1U A;  5IJ0 B;  2VAW A;  2B33 A;  1JFF B;  4G88 A;  4BT3 A;  4RQO A;  2Q1Y A;  5LXT A;  3N2G A;  1VHA A;  5JCO A;  1W3E X;  3PAF A;  5GON B;  1XBI A;  1QD9 A;  3G71 F;  2AIF A;  2MQE A;  3CCM F;  3S02 A;  1N8R H;  1VK3 A;  3QHD A;  2AMT A;  2FGY A;  5BMV A;  3GTZ A;  4TV8 A;  3IKE A;  5JCO C;  1NJI H;  3HKD A;  1TUB A;  3ELC A;  4R40 B;  5JH7 B;  3C8L A;  4O4I A;  2CWJ A;  4WBN A;  3N4Z A;  3IEQ A;  3K0T A;  5JQG B;  1Z5V A;  3LWO C;  3ZO8 A;  4U3J A;  1PXW A;  5IJ0 A;  1NMU B;  1JFF A;  2F9Z C;  1IPA A;  1W55 A;  5GON A;  2DT4 A;  3C9U A;  2W8B C;  3S0W A;  3RYF B;  3NVI B;  3V7Q A;  3JCM M;  4ZHQ B;  4HNA B;  2BTO A;  5EAZ A;  2ZF8 A;  3JAW B;  5JH7 A;  5KX5 A;  3NK7 A;  5IJ9 A;  3CCE F;  5HWE A;  3OBW A;  3LWR C;  1IV1 A;  4X1K A;  1X7O A;  3CCU F;  1VQ7 F;  2VGM A;  2HS4 A;  2KGW A;  3LDT A;  1KQS F;  2DYY A;  3JVH A;  3Q8H A;  3WXM B;  2RHJ A;  4DRX B;  3M84 A;  1VH8 A;  1H47 A;  2OTJ F;  4C8I A;  2R6R 1;  4TV9 B;  1YGY A;  3WPX A;  3N2K A;  3DC2 A;  1VQP F;  4ZHQ A;  4O4J A;  3NVK E;  5HP8 A;  4F6R B;  1GO0 A;  5IYZ B;  5G4V C;  5HY0 A;  1PF5 A;  5GAN K;  5GAP K;  4B5C A;  1UI9 A;  4IHJ B;  3CC2 F;  5IT9 M;  1U43 A;  3VYU C;  4X3M A;  4C4W C;  1J7H A;  4TUY B;  1DBF A;  1FFX B;  1UFY A;  5FLX M;  2FC3 A;  3E22 B;  3WGL A;  2OTL F;  2YYE A;  4G4Y A;  5AVM A;  1NQ3 A;  3CMA F; 
#chains in the Genus database with same CATH homology
 3LWV C;  3CPQ A;  1S72 F;  1H7M A;  1W42 A;  3OBY A;  1VQN F;  1GO1 A;  1VQK F;  1W3E X;  3PAF A;  3G71 F;  1XBI A;  1VQ6 F;  1CN7 A;  2AIF A;  3CCM F;  3IR9 A;  3GYQ A;  3AGK A;  1N8R H;  4BVQ A;  2OZB A;  3JAM M;  5A2Q M;  3CPW F;  4X3L A;  1M90 H;  1K73 H;  2FGY A;  1JJ2 F;  1K8A H;  1Q7Y H;  3LFO A;  5G4U C;  5EO3 A;  3CC7 F;  1NJI H;  2I6D A;  3CCQ F;  3LWQ C;  3G4S F;  3FFM A;  5GIN C;  1M1K H;  1X52 A;  1K9M H;  2ALE A;  5HY1 A;  1RA4 A;  3N4Z A;  1YHQ F;  3VMF B;  5GIP C;  3LWO C;  3SIV A;  3NK6 A;  3J81 M;  4EI8 A;  2BO1 A;  1QVF F;  1PXW A;  1T0K B;  3E1Y A;  1E7K A;  1NMU B;  2HVY D;  2F9Z C;  1VQL F;  1IPA A;  3G6E F;  3HAX D;  4NQ3 A;  3N4Y A;  5HXU A;  3J80 M;  3CCR F;  1QVG F;  4BVT A;  3OW2 F;  3RA5 A;  4NUT A;  5HY4 A;  1VQO F;  3NVI B;  2KG4 A;  3V7Q A;  3JCM M;  1VQ8 F;  4BW0 B;  1ZWZ A;  4BY9 D;  1RLG A;  1X7P A;  1YIT F;  4XCQ A;  1SDS A;  3CCL F;  3CG6 A;  4EI7 A;  4BVS A;  1Q82 H;  3CXC F;  3NK7 A;  5FJ4 C;  3CCE F;  5HWE A;  2GLZ A;  3I56 F;  1VQ9 F;  3OBW A;  3LWR C;  2WAL A;  3J7A R;  1X7O A;  3D00 A;  1YJW F;  3E20 B;  3CC4 F;  3CCU F;  5GIO C;  2VGM A;  1VQ7 F;  2QI2 A;  1KQS F;  1VQ5 F;  1KC8 H;  4EI9 A;  3CD6 F;  3WXM B;  2JNB A;  3CCV F;  5EWR A;  2OTJ F;  3VI6 A;  2OHW A;  3ON1 A;  3RA6 A;  3HJW C;  3LWP C;  3MCA B;  2LBW A;  3I55 F;  2QEX F;  1VQP F;  3NVK E;  1W40 A;  4LCK A;  1GO0 A;  5G4V C;  1VQM F;  1GZ0 A;  5HY0 A;  1KD1 H;  1W41 A;  2KTU A;  5HXZ A;  5GAN K;  5GAP K;  5HY2 A;  1Q86 H;  1YJ9 F;  3CCS F;  3CCJ F;  4TZZ A;  3O85 A;  3CC2 F;  4BVR A;  2LBX A;  1YIJ F;  1W2B F;  3NMU C;  5IT9 M;  4X3M A;  4C4W C;  1YI2 F;  1CK2 A;  1Q81 H;  3PLA C;  5FLX M;  2QA4 F;  2FC3 A;  3V3T A;  2CZW A;  3SIU A;  2OTL F;  2KTV A;  1VQ4 F;  3V7E A;  1YJN F;  1DT9 A;  2VGN A;  5DCV A;  3CME F;  3CMA F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...