1VQOF

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqoF00
1CK2A 1KD1H 2WALA 5DCVA 1Q81H 1VQLF 1W40A 3CC4F 3N4ZA 5EWRA 4BW0B 1QVGF 1T0KB 3HJWC 3PLAC 3GYQA 2OTJF 3VI6A 1W42A 3J81M 3CCUF 1W3EX 3LWPC 1VQ9F 2OHWA 4X3MA 5FJ4C 3N4YA 2KTUA 3G6EF 5GANK 4C4WC 2VGMA 2FC3A 3E1YA 3CCVF 3CCSF 1VQKF 3LWQC 1NMUB 1PXWA 3SIUA 3OBYA 1Q86H 3CCRF 1VQPF 3VMFB 3PAFA 1SDSA 2LBWA 4NUTA 1X52A 3CXCF 4TZZA 1YJNF 2LBXA 2JNBA 3SIVA 1E7KA 1VQNF 3LWVC 1DT9A 5A2QM 2QEXF 2ALEA 3ON1A 1X7PA 3CPWF 3J7AR 2KTVA 5EO3A 1W2BF 5G4VC 3CD6F 3AGKA 3IR9A 2BO1A 1K8AH 3NK6A 5IT9M 3CCQF 5GAPK 3I55F 2OTLF 1NJIH 2QA4F 1K9MH 1VQ7F 2KG4A 3CC2F 3G71F 4LCKA 1RLGA 3NVKE 1YITF 1KC8H 3E20B 3G4SF 3NVIB 3OW2F 1VQ5F 3FFMA 1K73H 3O85A 3CCJF 5FLXM 4BY9D 1M1KH 3J80M 2I6DA 2HVYD 1YI2F 4X3LA 3WXMB 3LWRC 1Q82H 1CN7A 3LFOA 2QI2A 3CMAF 1ZWZA 5G4UC 1JJ2F 1H7MA 3V7EA 2OZBA 1RA4A 1VQMF 1N8RH 5GINC 3HAXD 3V7QA 3JCMM 3CC7F 1GO1A 1X7OA 3NMUC 3CCMF 1VQOF 1KQSF 3LWOC 2AIFA 3JAMM 1YIJF 3CPQA 5GIOC 1GZ0A 3CG6A 1Q7YH 3CCEF 3RA6A 3RA5A 1XBIA 1IPAA 1YJWF 1GO0A 1W41A 3I56F 1VQ4F 2CZWA 1YJ9F 1VQ6F 2VGNA 3CMEF 3NK7A 1QVFF 3OBWA 5GIPC 1YHQF 1S72F 1VQ8F 3CCLF 1M90H 3MCAB
chains in the Genus database with same CATH superfamily
3RYHB 3CYPB 5JQGA 1UI9A 1Q81H 1VQVA 3UT5B 1W40A 5BMVB 4O4JB 1YQNA 1Z5VA 3K2XA 1YGYA 1T0KB 3HJWC 4C81A 1H48A 1VK3A 1RQ2A 2OTJF 2LBTA 3VI6A 3S03A 1DBFA 3ERNA 4X3MA 2UYNB 3T80A 5HP8A 2YYEA 3N4YA 3G6EF 5GANK 2BTOA 5MN5A 4ZI7A 2QTPA 3LWQC 1NMUB 5HY0A 3SIUA 2UYJA 1Q86H 3KJJA 3RYFB 3DDNA 2LBWA 1X52A 3QHDA 4R40B 2JNBA 3C9SA 2G9IA 1U3LA 5HXUA 4WBNB 1IV4A 2ZVZA 1DT9A 4I50B 5JVDB 5A2QM 4O4LB 4B5CA 2ZAUA 2ALEA 2Z1UA 2EWCA 2K1SA 2VAWA 5KX5B 3CD6F 3NK6A 3QTYA 1GX1A 5JH7A 3N2KA 3CCQF 2LCAA 2OTLF 3JALA 3IMPA 2QA4F 3RE3A 2KG4A 3G71F 2V9YA 3C9TA 5AVMA 5ITZB 3ZP4A 3NVKE 3JAKA 1W581 5HY4A 4X1KA 3NVIB 3I3FA 3FFMA 3N2GB 5EYPB 4EB6B 4BY9D 5FNVB 3P4EA 4X20A 2Q1YA 1JY8A 3VIUA 3KJKA 5LP6A 2QI2A 4U3JB 4F6RB 1JJ2F 3E22B 3HKBB 3HTNA 2OZBA 2GVIA 1VQMF 3LYBA 2HX0A 3HAXD 1FFXA 1Z5WA 5C8YB 5MN6A 3DC2A 3HKCA 4U39A 5EAZA 1IV2A 3JARB 4IIJA 5HXZA 4B46A 5LA6A 2R751 1JN1A 3RYIA 1YIJF 4ZHQB 5GIOC 5CA0B 2RHOA 1QAHA 2YXZA 1SZQA 3CG6A 1Q7YH 4YJ2B 1W5BA 1RQ7A 5KMGB 2UYNA 3P10A 1YJWF 1W41A 2H6LA 2CZWA 1VQ6F 2HS4A 2VGNA 2CVLA 1T0AA 5EIBD 1VHAA 5GIPC 5GONB 2DT4A 3CCLF 1W5EA 4BT4A 1CK2A 3ZP7A 1CLIA 5DCVA 5J2TB 1SA0A 5IJ9A 4G4YA 2H8EA 3N4ZA 4C8GA 4G88A 1IV1A 4BW0B 4HNAB 3WGLA 3JASB 4X1IB 3GYQA 4KWEA 3J81M 5JCOC 1W3EX 3K14A 3S02A 3FD5A 4G4VA 2VGMA 2FC3A 3CYQA 3CCVF 1VQKF 2OTMA 3HKDA 1KNJA 3D00A 3HKEB 5HY1A 5CB4A 1VQPF 3VMFB 4BT3A 3JAWB 3HWUA 4ZK7A 2HP0A 4X1YB 2LBXA 3M1XA 3S0HA 4TZZA 4U3JA 1E7KA 2QEXF 4BT6A 5IYZB 3QUWA 5EO3A 1W2BF 5G4VC 4IHJB 3K0TA 3IR9A 1K8AH 2VAPA 2IG8A 4TUYA 2HP3A 4O4IA 2ZF8A 2HRYA 4BT5A 4EI9A 1VQ7F 4RHAA 1YITF 1TUBB 1XRGA 4O2BA 3G4SF 1X25A 4FFBB 4O4HB 4TV9B 5CA1B 3VTIC 3VO8A 5FLXM 3WGKA 1JFFB 3J80M 4C8EA 5LXTB 2HVYD 1YI2F 5HP7A 3EORA 3WXMB 1TVKA 3Q8HA 3LFOA 2CSLA 3R0PA 5EZYB 2B33A 3ELCA 5G4UC 1H7MA 1RA4A 4TV8A 1QU9A 3TD4A 3F0GA 2F9ZC 3JCMM 3V4DA 3FBAA 3LDTA 1GO1A 2KGWA 4ZHWA 3RYCB 3NMUC 5EIBC 3K12A 1KQSF 3LMEA 2IAFA 4DRXA 5IJ0A 3LWOC 2AIFA 3JASA 2L26A 3KIZA 4X1IA 1GZ0A 1H47A 5LOVB 1FNKA 3RA5A 3VYUC 1GO0A 5J2UB 1VH8A 4YJ3A 4NWOB 4ZOLA 3F6MA 3D01A 4I55A 2MQEA 3OBWA 3F0DA 4LNUB 3JATB 3RYHA 1VQ8F 1OFUA 3VCZA 1M90H 3UT5A 3MCAB 5BMVA 3WGJA 4O4JA 1IV3A 1VQLF 3L7QA 2W8BC 3CC4F 3IEWA 1NQ3A 4BT7A 3TD3A 4O2AB 4RQOA 4IHJA 5EWRA 5HY2A 3KHNA 5JQGB 3S0YA 3ZOPA 4BVSA 1JD1A 1U40A 3GTZA 3M84A 1W42A 1W55A 3CCUF 2RB9A 4BVTA 1VQ9F 2OHWA 1TUBA 1ODEA 5FJ4C 3MCQA 2KTUA 4I4TB 4C4WC 3RYFA 3I7TA 3CCSF 3S0WA 2Z1TA 5LYJB 4WBNA 4ZI7B 5HWEA 4I50A 2UZHA 5JVDA 1OAPA 4O4LA 1YJNF 4XCQA 2GLZA 3SIVA 2HS0A 3D54A 5KX5A 3ESJA 3V3TA 3MDOA 3CB2A 3J7AR 3FD6A 2KTVA 4NQ3A 2NMUA 3AGKA 5ITZA 3C8LA 1W5FA 3I55F 1W59A 2R6R1 4C8IA 3CC2F 4LCKA 5JH7B 1RLGA 3N2KB 3N2GA 5EYPA 4EB6A 5FNVA 3E20B 3B6NA 3IEQA 3JALB 5LOVA 3O85A 3JAKB 2I6DA 4X1KB 3S06A 4F6RA 3E22A 3HKBA 3U0OA 4X20B 3JATA 3OONA 2VXYA 1ZWZA 5C8YA 2ZVYA 3V7EA 1N8RH 5GINC 3P0ZA 2HRUA 3JARA 2H8CA 3F0FA 2ZODA 3V7QA 3CC7F 1FSZA 4ZHQA 1X7OA 5CA0A 1FFXB 4YJ2A 2ZOVA 3HKCB 2IQQA 5EB1B 5KMGA 4IIJB 3CCEF 5LA6B 1J7HA 3RYIB 1XBIA 1IPAA 4I4TA 5GONA 3I56F 2PHNA 2AMTA 4C82A 3NK7A 2N48A 2Q1XA 3C9UA 3MQWA 2BTUA 5LYJA 1YHQF 2RHJA 1S72F 2PMPA 3GHZA 2CHTA 3VOBA 5J2TA 2HS3A 2CHSA 1KD1H 2WALA 4HNAA 4EI8A 4B45A 3VYTC 3M4SA 3VOAA 2DYYA 1QVGF 3WPXA 4BVRA 3PLAC 1COMA 1SA0B 1ONIA 2FGYA 3ZO8A 5IJ9B 1UFYA 3LWPC 3HKEA 2CW4A 3E1YA 3JAWA 1PXWA 2RHLA 4X1YA 2BTQB 1U3PA 3OBYA 3CCRF 3BYQA 2RHHA 2P6YA 3PAFA 1SDSA 3HKDB 4NUTA 3CXCF 3MBMA 5IYZA 5CB4B 3TD5A 3IKEA 1XV2A 1VQNF 5LP6C 4ZHVA 3WJQA 4BVQA 3LWVC 4BT2A 5MN4A 5EB0A 2HP0B 1X7PA 3ON1A 3CPWF 3WGMA 1KNKA 1W5AA 2BO1A 4ERHA 5IT9M 4G4XA 2CWJA 4EI7A 5GAPK 1NJIH 4PWTA 1K9MH 4FFBA 4O4HA 4TV9A 4DXDA 5CA1A 2GZLA 4TUYB 1KC8H 1JFFA 5LXTA 1QD9A 4O4IB 3OW2F 1VQ5F 1K73H 3CCJF 1M1KH 4O2BB 4X3LA 5EZYA 4G4WA 3LWRC 1Q82H 1CN7A 2Z1FA 3CMAF 2VAMA 2I6RA 3WJPA 4B62A 4ZHYB 2Z01A 1TVKB 3RYCA 1Q8RA 4M8IA 3WPWA 3JVHA 5JCOA 2Z1EA 3C9RA 3WGNA 3F0EA 4TV8B 3CCMF 1VQOF 1U43A 1RLUA 3JAMM 2UYKA 1PF5A 3CPQA 2AIZP 3WJRA 2UYPA 4G4ZA 5J2UA 3VYSC 2HQSC 4DRXB 5IJ0B 3RA6A 1FNJA 3FPIA 3KE1A 4E6EA 1R1MA 1VQ4F 1XHOA 1YJ9F 4LNUA 3CMEF 1W57A 1QVFF 5B8FA 4YJ3B 5LP6B 4ZOLB 4I55B 3IKFA 4O2AA
chains in the Genus database with same CATH topology
1CK2A 1KD1H 2WALA 5DCVA 4EI8A 1Q81H 1VQLF 1W40A 3CC4F 3N4ZA 5EWRA 4BW0B 5HY2A 1QVGF 4BVRA 1T0KB 4BVSA 3HJWC 3PLAC 2FGYA 3GYQA 2OTJF 3VI6A 1W42A 3J81M 3CCUF 1W3EX 4BVTA 3LWPC 1VQ9F 2OHWA 4X3MA 5FJ4C 3N4YA 2KTUA 3G6EF 5GANK 4C4WC 2VGMA 2FC3A 3E1YA 3CCVF 3CCSF 1VQKF 3LWQC 1NMUB 1PXWA 3D00A 5HY0A 5HY1A 3SIUA 3OBYA 1Q86H 3CCRF 1VQPF 3VMFB 3PAFA 5HWEA 1SDSA 2LBWA 4NUTA 1X52A 3CXCF 4TZZA 1YJNF 2LBXA 4XCQA 2GLZA 2JNBA 5HXUA 3SIVA 1E7KA 1VQNF 3LWVC 4BVQA 1DT9A 5A2QM 2QEXF 3V3TA 2ALEA 3ON1A 1X7PA 3CPWF 3J7AR 2KTVA 5EO3A 1W2BF 5G4VC 4NQ3A 3CD6F 3AGKA 3IR9A 2BO1A 1K8AH 3NK6A 5IT9M 3CCQF 4EI7A 5GAPK 3I55F 2OTLF 1NJIH 2QA4F 1K9MH 4EI9A 1VQ7F 2KG4A 3CC2F 3G71F 4LCKA 1RLGA 3NVKE 1YITF 1KC8H 3E20B 3G4SF 5HY4A 3NVIB 3OW2F 1VQ5F 3FFMA 1K73H 3O85A 3CCJF 5FLXM 4BY9D 1M1KH 3J80M 2I6DA 2HVYD 1YI2F 4X3LA 3WXMB 3LWRC 1Q82H 1CN7A 3LFOA 2QI2A 3CMAF 1ZWZA 5G4UC 1JJ2F 1H7MA 3V7EA 2OZBA 1RA4A 1VQMF 1N8RH 5GINC 3HAXD 3V7QA 2F9ZC 3JCMM 3CC7F 1GO1A 1X7OA 3NMUC 3CCMF 1VQOF 1KQSF 5HXZA 3LWOC 2AIFA 3JAMM 1YIJF 3CPQA 5GIOC 1GZ0A 3CG6A 1Q7YH 3CCEF 3RA6A 3RA5A 1XBIA 1IPAA 1YJWF 1GO0A 1W41A 3I56F 1VQ4F 2CZWA 1YJ9F 1VQ6F 2VGNA 3CMEF 3NK7A 1QVFF 3OBWA 5GIPC 1YHQF 1S72F 1VQ8F 3CCLF 1M90H 3MCAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK2 A;  1KD1 H;  2WAL A;  5DCV A;  1Q81 H;  1VQL F;  1W40 A;  3CC4 F;  3N4Z A;  5EWR A;  4BW0 B;  1QVG F;  1T0K B;  3HJW C;  3PLA C;  3GYQ A;  2OTJ F;  3VI6 A;  1W42 A;  3J81 M;  3CCU F;  1W3E X;  3LWP C;  1VQ9 F;  2OHW A;  4X3M A;  5FJ4 C;  3N4Y A;  2KTU A;  3G6E F;  5GAN K;  4C4W C;  2VGM A;  2FC3 A;  3E1Y A;  3CCV F;  3CCS F;  1VQK F;  3LWQ C;  1NMU B;  1PXW A;  3SIU A;  3OBY A;  1Q86 H;  3CCR F;  1VQP F;  3VMF B;  3PAF A;  1SDS A;  2LBW A;  4NUT A;  1X52 A;  3CXC F;  4TZZ A;  1YJN F;  2LBX A;  2JNB A;  3SIV A;  1E7K A;  1VQN F;  3LWV C;  1DT9 A;  5A2Q M;  2QEX F;  2ALE A;  3ON1 A;  1X7P A;  3CPW F;  3J7A R;  2KTV A;  5EO3 A;  1W2B F;  5G4V C;  3CD6 F;  3AGK A;  3IR9 A;  2BO1 A;  1K8A H;  3NK6 A;  5IT9 M;  3CCQ F;  5GAP K;  3I55 F;  2OTL F;  1NJI H;  2QA4 F;  1K9M H;  1VQ7 F;  2KG4 A;  3CC2 F;  3G71 F;  4LCK A;  1RLG A;  3NVK E;  1YIT F;  1KC8 H;  3E20 B;  3G4S F;  3NVI B;  3OW2 F;  1VQ5 F;  3FFM A;  1K73 H;  3O85 A;  3CCJ F;  5FLX M;  4BY9 D;  1M1K H;  3J80 M;  2I6D A;  2HVY D;  1YI2 F;  4X3L A;  3WXM B;  3LWR C;  1Q82 H;  1CN7 A;  3LFO A;  2QI2 A;  3CMA F;  1ZWZ A;  5G4U C;  1JJ2 F;  1H7M A;  3V7E A;  2OZB A;  1RA4 A;  1VQM F;  1N8R H;  5GIN C;  3HAX D;  3V7Q A;  3JCM M;  3CC7 F;  1GO1 A;  1X7O A;  3NMU C;  3CCM F;  1VQO F;  1KQS F;  3LWO C;  2AIF A;  3JAM M;  1YIJ F;  3CPQ A;  5GIO C;  1GZ0 A;  3CG6 A;  1Q7Y H;  3CCE F;  3RA6 A;  3RA5 A;  1XBI A;  1IPA A;  1YJW F;  1GO0 A;  1W41 A;  3I56 F;  1VQ4 F;  2CZW A;  1YJ9 F;  1VQ6 F;  2VGN A;  3CME F;  3NK7 A;  1QVF F;  3OBW A;  5GIP C;  1YHQ F;  1S72 F;  1VQ8 F;  3CCL F;  1M90 H;  3MCA B; 
#chains in the Genus database with same CATH topology
 3RYH B;  3CYP B;  5JQG A;  1UI9 A;  1Q81 H;  1VQV A;  3UT5 B;  1W40 A;  5BMV B;  4O4J B;  1YQN A;  1Z5V A;  3K2X A;  1YGY A;  1T0K B;  3HJW C;  4C81 A;  1H48 A;  1VK3 A;  1RQ2 A;  2OTJ F;  2LBT A;  3VI6 A;  3S03 A;  1DBF A;  3ERN A;  4X3M A;  2UYN B;  3T80 A;  5HP8 A;  2YYE A;  3N4Y A;  3G6E F;  5GAN K;  2BTO A;  5MN5 A;  4ZI7 A;  2QTP A;  3LWQ C;  1NMU B;  5HY0 A;  3SIU A;  2UYJ A;  1Q86 H;  3KJJ A;  3RYF B;  3DDN A;  2LBW A;  1X52 A;  3QHD A;  4R40 B;  2JNB A;  3C9S A;  2G9I A;  1U3L A;  5HXU A;  4WBN B;  1IV4 A;  2ZVZ A;  1DT9 A;  4I50 B;  5JVD B;  5A2Q M;  4O4L B;  4B5C A;  2ZAU A;  2ALE A;  2Z1U A;  2EWC A;  2K1S A;  2VAW A;  5KX5 B;  3CD6 F;  3NK6 A;  3QTY A;  1GX1 A;  5JH7 A;  3N2K A;  3CCQ F;  2LCA A;  2OTL F;  3JAL A;  3IMP A;  2QA4 F;  3RE3 A;  2KG4 A;  3G71 F;  2V9Y A;  3C9T A;  5AVM A;  5ITZ B;  3ZP4 A;  3NVK E;  3JAK A;  1W58 1;  5HY4 A;  4X1K A;  3NVI B;  3I3F A;  3FFM A;  3N2G B;  5EYP B;  4EB6 B;  4BY9 D;  5FNV B;  3P4E A;  4X20 A;  2Q1Y A;  1JY8 A;  3VIU A;  3KJK A;  5LP6 A;  2QI2 A;  4U3J B;  4F6R B;  1JJ2 F;  3E22 B;  3HKB B;  3HTN A;  2OZB A;  2GVI A;  1VQM F;  3LYB A;  2HX0 A;  3HAX D;  1FFX A;  1Z5W A;  5C8Y B;  5MN6 A;  3DC2 A;  3HKC A;  4U39 A;  5EAZ A;  1IV2 A;  3JAR B;  4IIJ A;  5HXZ A;  4B46 A;  5LA6 A;  2R75 1;  1JN1 A;  3RYI A;  1YIJ F;  4ZHQ B;  5GIO C;  5CA0 B;  2RHO A;  1QAH A;  2YXZ A;  1SZQ A;  3CG6 A;  1Q7Y H;  4YJ2 B;  1W5B A;  1RQ7 A;  5KMG B;  2UYN A;  3P10 A;  1YJW F;  1W41 A;  2H6L A;  2CZW A;  1VQ6 F;  2HS4 A;  2VGN A;  2CVL A;  1T0A A;  5EIB D;  1VHA A;  5GIP C;  5GON B;  2DT4 A;  3CCL F;  1W5E A;  4BT4 A;  1CK2 A;  3ZP7 A;  1CLI A;  5DCV A;  5J2T B;  1SA0 A;  5IJ9 A;  4G4Y A;  2H8E A;  3N4Z A;  4C8G A;  4G88 A;  1IV1 A;  4BW0 B;  4HNA B;  3WGL A;  3JAS B;  4X1I B;  3GYQ A;  4KWE A;  3J81 M;  5JCO C;  1W3E X;  3K14 A;  3S02 A;  3FD5 A;  4G4V A;  2VGM A;  2FC3 A;  3CYQ A;  3CCV F;  1VQK F;  2OTM A;  3HKD A;  1KNJ A;  3D00 A;  3HKE B;  5HY1 A;  5CB4 A;  1VQP F;  3VMF B;  4BT3 A;  3JAW B;  3HWU A;  4ZK7 A;  2HP0 A;  4X1Y B;  2LBX A;  3M1X A;  3S0H A;  4TZZ A;  4U3J A;  1E7K A;  2QEX F;  4BT6 A;  5IYZ B;  3QUW A;  5EO3 A;  1W2B F;  5G4V C;  4IHJ B;  3K0T A;  3IR9 A;  1K8A H;  2VAP A;  2IG8 A;  4TUY A;  2HP3 A;  4O4I A;  2ZF8 A;  2HRY A;  4BT5 A;  4EI9 A;  1VQ7 F;  4RHA A;  1YIT F;  1TUB B;  1XRG A;  4O2B A;  3G4S F;  1X25 A;  4FFB B;  4O4H B;  4TV9 B;  5CA1 B;  3VTI C;  3VO8 A;  5FLX M;  3WGK A;  1JFF B;  3J80 M;  4C8E A;  5LXT B;  2HVY D;  1YI2 F;  5HP7 A;  3EOR A;  3WXM B;  1TVK A;  3Q8H A;  3LFO A;  2CSL A;  3R0P A;  5EZY B;  2B33 A;  3ELC A;  5G4U C;  1H7M A;  1RA4 A;  4TV8 A;  1QU9 A;  3TD4 A;  3F0G A;  2F9Z C;  3JCM M;  3V4D A;  3FBA A;  3LDT A;  1GO1 A;  2KGW A;  4ZHW A;  3RYC B;  3NMU C;  5EIB C;  3K12 A;  1KQS F;  3LME A;  2IAF A;  4DRX A;  5IJ0 A;  3LWO C;  2AIF A;  3JAS A;  2L26 A;  3KIZ A;  4X1I A;  1GZ0 A;  1H47 A;  5LOV B;  1FNK A;  3RA5 A;  3VYU C;  1GO0 A;  5J2U B;  1VH8 A;  4YJ3 A;  4NWO B;  4ZOL A;  3F6M A;  3D01 A;  4I55 A;  2MQE A;  3OBW A;  3F0D A;  4LNU B;  3JAT B;  3RYH A;  1VQ8 F;  1OFU A;  3VCZ A;  1M90 H;  3UT5 A;  3MCA B;  5BMV A;  3WGJ A;  4O4J A;  1IV3 A;  1VQL F;  3L7Q A;  2W8B C;  3CC4 F;  3IEW A;  1NQ3 A;  4BT7 A;  3TD3 A;  4O2A B;  4RQO A;  4IHJ A;  5EWR A;  5HY2 A;  3KHN A;  5JQG B;  3S0Y A;  3ZOP A;  4BVS A;  1JD1 A;  1U40 A;  3GTZ A;  3M84 A;  1W42 A;  1W55 A;  3CCU F;  2RB9 A;  4BVT A;  1VQ9 F;  2OHW A;  1TUB A;  1ODE A;  5FJ4 C;  3MCQ A;  2KTU A;  4I4T B;  4C4W C;  3RYF A;  3I7T A;  3CCS F;  3S0W A;  2Z1T A;  5LYJ B;  4WBN A;  4ZI7 B;  5HWE A;  4I50 A;  2UZH A;  5JVD A;  1OAP A;  4O4L A;  1YJN F;  4XCQ A;  2GLZ A;  3SIV A;  2HS0 A;  3D54 A;  5KX5 A;  3ESJ A;  3V3T A;  3MDO A;  3CB2 A;  3J7A R;  3FD6 A;  2KTV A;  4NQ3 A;  2NMU A;  3AGK A;  5ITZ A;  3C8L A;  1W5F A;  3I55 F;  1W59 A;  2R6R 1;  4C8I A;  3CC2 F;  4LCK A;  5JH7 B;  1RLG A;  3N2K B;  3N2G A;  5EYP A;  4EB6 A;  5FNV A;  3E20 B;  3B6N A;  3IEQ A;  3JAL B;  5LOV A;  3O85 A;  3JAK B;  2I6D A;  4X1K B;  3S06 A;  4F6R A;  3E22 A;  3HKB A;  3U0O A;  4X20 B;  3JAT A;  3OON A;  2VXY A;  1ZWZ A;  5C8Y A;  2ZVY A;  3V7E A;  1N8R H;  5GIN C;  3P0Z A;  2HRU A;  3JAR A;  2H8C A;  3F0F A;  2ZOD A;  3V7Q A;  3CC7 F;  1FSZ A;  4ZHQ A;  1X7O A;  5CA0 A;  1FFX B;  4YJ2 A;  2ZOV A;  3HKC B;  2IQQ A;  5EB1 B;  5KMG A;  4IIJ B;  3CCE F;  5LA6 B;  1J7H A;  3RYI B;  1XBI A;  1IPA A;  4I4T A;  5GON A;  3I56 F;  2PHN A;  2AMT A;  4C82 A;  3NK7 A;  2N48 A;  2Q1X A;  3C9U A;  3MQW A;  2BTU A;  5LYJ A;  1YHQ F;  2RHJ A;  1S72 F;  2PMP A;  3GHZ A;  2CHT A;  3VOB A;  5J2T A;  2HS3 A;  2CHS A;  1KD1 H;  2WAL A;  4HNA A;  4EI8 A;  4B45 A;  3VYT C;  3M4S A;  3VOA A;  2DYY A;  1QVG F;  3WPX A;  4BVR A;  3PLA C;  1COM A;  1SA0 B;  1ONI A;  2FGY A;  3ZO8 A;  5IJ9 B;  1UFY A;  3LWP C;  3HKE A;  2CW4 A;  3E1Y A;  3JAW A;  1PXW A;  2RHL A;  4X1Y A;  2BTQ B;  1U3P A;  3OBY A;  3CCR F;  3BYQ A;  2RHH A;  2P6Y A;  3PAF A;  1SDS A;  3HKD B;  4NUT A;  3CXC F;  3MBM A;  5IYZ A;  5CB4 B;  3TD5 A;  3IKE A;  1XV2 A;  1VQN F;  5LP6 C;  4ZHV A;  3WJQ A;  4BVQ A;  3LWV C;  4BT2 A;  5MN4 A;  5EB0 A;  2HP0 B;  1X7P A;  3ON1 A;  3CPW F;  3WGM A;  1KNK A;  1W5A A;  2BO1 A;  4ERH A;  5IT9 M;  4G4X A;  2CWJ A;  4EI7 A;  5GAP K;  1NJI H;  4PWT A;  1K9M H;  4FFB A;  4O4H A;  4TV9 A;  4DXD A;  5CA1 A;  2GZL A;  4TUY B;  1KC8 H;  1JFF A;  5LXT A;  1QD9 A;  4O4I B;  3OW2 F;  1VQ5 F;  1K73 H;  3CCJ F;  1M1K H;  4O2B B;  4X3L A;  5EZY A;  4G4W A;  3LWR C;  1Q82 H;  1CN7 A;  2Z1F A;  3CMA F;  2VAM A;  2I6R A;  3WJP A;  4B62 A;  4ZHY B;  2Z01 A;  1TVK B;  3RYC A;  1Q8R A;  4M8I A;  3WPW A;  3JVH A;  5JCO A;  2Z1E A;  3C9R A;  3WGN A;  3F0E A;  4TV8 B;  3CCM F;  1VQO F;  1U43 A;  1RLU A;  3JAM M;  2UYK A;  1PF5 A;  3CPQ A;  2AIZ P;  3WJR A;  2UYP A;  4G4Z A;  5J2U A;  3VYS C;  2HQS C;  4DRX B;  5IJ0 B;  3RA6 A;  1FNJ A;  3FPI A;  3KE1 A;  4E6E A;  1R1M A;  1VQ4 F;  1XHO A;  1YJ9 F;  4LNU A;  3CME F;  1W57 A;  1QVF F;  5B8F A;  4YJ3 B;  5LP6 B;  4ZOL B;  4I55 B;  3IKF A;  4O2A A; 
#chains in the Genus database with same CATH homology
 1CK2 A;  1KD1 H;  2WAL A;  5DCV A;  4EI8 A;  1Q81 H;  1VQL F;  1W40 A;  3CC4 F;  3N4Z A;  5EWR A;  4BW0 B;  5HY2 A;  1QVG F;  4BVR A;  1T0K B;  4BVS A;  3HJW C;  3PLA C;  2FGY A;  3GYQ A;  2OTJ F;  3VI6 A;  1W42 A;  3J81 M;  3CCU F;  1W3E X;  4BVT A;  3LWP C;  1VQ9 F;  2OHW A;  4X3M A;  5FJ4 C;  3N4Y A;  2KTU A;  3G6E F;  5GAN K;  4C4W C;  2VGM A;  2FC3 A;  3E1Y A;  3CCV F;  3CCS F;  1VQK F;  3LWQ C;  1NMU B;  1PXW A;  3D00 A;  5HY0 A;  5HY1 A;  3SIU A;  3OBY A;  1Q86 H;  3CCR F;  1VQP F;  3VMF B;  3PAF A;  5HWE A;  1SDS A;  2LBW A;  4NUT A;  1X52 A;  3CXC F;  4TZZ A;  1YJN F;  2LBX A;  4XCQ A;  2GLZ A;  2JNB A;  5HXU A;  3SIV A;  1E7K A;  1VQN F;  3LWV C;  4BVQ A;  1DT9 A;  5A2Q M;  2QEX F;  3V3T A;  2ALE A;  3ON1 A;  1X7P A;  3CPW F;  3J7A R;  2KTV A;  5EO3 A;  1W2B F;  5G4V C;  4NQ3 A;  3CD6 F;  3AGK A;  3IR9 A;  2BO1 A;  1K8A H;  3NK6 A;  5IT9 M;  3CCQ F;  4EI7 A;  5GAP K;  3I55 F;  2OTL F;  1NJI H;  2QA4 F;  1K9M H;  4EI9 A;  1VQ7 F;  2KG4 A;  3CC2 F;  3G71 F;  4LCK A;  1RLG A;  3NVK E;  1YIT F;  1KC8 H;  3E20 B;  3G4S F;  5HY4 A;  3NVI B;  3OW2 F;  1VQ5 F;  3FFM A;  1K73 H;  3O85 A;  3CCJ F;  5FLX M;  4BY9 D;  1M1K H;  3J80 M;  2I6D A;  2HVY D;  1YI2 F;  4X3L A;  3WXM B;  3LWR C;  1Q82 H;  1CN7 A;  3LFO A;  2QI2 A;  3CMA F;  1ZWZ A;  5G4U C;  1JJ2 F;  1H7M A;  3V7E A;  2OZB A;  1RA4 A;  1VQM F;  1N8R H;  5GIN C;  3HAX D;  3V7Q A;  2F9Z C;  3JCM M;  3CC7 F;  1GO1 A;  1X7O A;  3NMU C;  3CCM F;  1VQO F;  1KQS F;  5HXZ A;  3LWO C;  2AIF A;  3JAM M;  1YIJ F;  3CPQ A;  5GIO C;  1GZ0 A;  3CG6 A;  1Q7Y H;  3CCE F;  3RA6 A;  3RA5 A;  1XBI A;  1IPA A;  1YJW F;  1GO0 A;  1W41 A;  3I56 F;  1VQ4 F;  2CZW A;  1YJ9 F;  1VQ6 F;  2VGN A;  3CME F;  3NK7 A;  1QVF F;  3OBW A;  5GIP C;  1YHQ F;  1S72 F;  1VQ8 F;  3CCL F;  1M90 H;  3MCA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...