1VQOF

The structure of ccpmn bound to the large ribosomal subunit haloarcula marismortui
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1vqoF00
3LWRC 3RA5A 1VQ9F 2KTVA 3V7QA 3FFMA 1Q86H 1PXWA 3CCEF 1N8RH 1M1KH 1VQLF 2VGNA 2CZWA 3G6EF 1DT9A 1W40A 1RA4A 2BO1A 3CC4F 3NMUC 3NK7A 4NUTA 3N4ZA 1YJNF 3SIUA 3CD6F 1QVFF 1X52A 1H7MA 1T0KB 5DCVA 1VQ8F 3G4SF 5G4VC 1CK2A 1VQPF 4BY9D 1IPAA 3CCRF 5EWRA 5FLXM 3LFOA 5GANK 1VQ4F 3CC7F 1GO0A 3CCMF 3LWOC 3AGKA 4TZZA 1YJ9F 3V7EA 1M90H 3CC2F 5FJ4C 3G71F 1E7KA 3CCLF 2OHWA 1Q7YH 1Q81H 3OBWA 2HVYD 2QA4F 1W41A 2VGMA 2OTJF 3NK6A 1JJ2F 1YI2F 3E1YA 3N4YA 5GAPK 1YJWF 1KC8H 3OBYA 1ZWZA 3CCVF 1RLGA 3PAFA 3MCAB 1VQKF 1W3EX 3WXMB 3J80M 3LWVC 2LBWA 3OW2F 5GIPC 4X3LA 2I6DA 3CCUF 3I55F 3CPQA 3E20B 3JAMM 1XBIA 2AIFA 3SIVA 3LWQC 3CCJF 3CXCF 2ALEA 2QEXF 3CPWF 3VMFB 1VQMF 1NJIH 1K8AH 3HAXD 3CG6A 2OZBA 1KD1H 1S72F 3LWPC 2KG4A 1W42A 1X7OA 2KTUA 2JNBA 1YHQF 3CCSF 5GIOC 3VI6A 3ON1A 5G4UC 1NMUB 5EO3A 3NVKE 4BW0B 3CMAF 2OTLF 1GO1A 4X3MA 1VQ7F 3PLAC 1SDSA 3GYQA 3J81M 3RA6A 1W2BF 3I56F 1YITF 1K9MH 2LBXA 5IT9M 3NVIB 1GZ0A 3CMEF 3J7AR 1KQSF 3HJWC 1Q82H 3JCMM 1VQOF 3CCQF 1CN7A 1VQ5F 1VQNF 5A2QM 4LCKA 3IR9A 3O85A 2QI2A 1X7PA 2FC3A 2WALA 1K73H 5GINC 1VQ6F 1QVGF 1YIJF 4C4WC
chains in the Genus database with same CATH superfamily
3F0DA 2H6LA 5MN4A 3LWRC 3RA5A 1RQ7A 1VQ9F 4U3JB 4O4IA 4O4LB 4BT5A 1VH8A 4C82A 2CHTA 1VQLF 2GLZA 4LNUA 2GZLA 1DT9A 1W40A 1RA4A 2Z1TA 5LXTA 5ITZA 1JFFB 4ZK7A 4YJ2A 2ZVZA 4ZI7B 3N2GB 1W59A 3SIUA 4F6RA 4X1IB 4I50A 1U40A 5JVDB 4C8IA 3CYQA 2HS3A 2YYEA 1T0KB 5DCVA 4O2AB 5KMGA 3B6NA 4BVRA 1VQPF 3M4SA 5EWRA 5FLXM 1TUBA 2UYPA 1QAHA 2HP3A 1VQ4F 4ZHQA 2B33A 4EI9A 1W57A 2W8BC 4FFBB 4G4XA 2RB9A 1FFXB 5C8YA 3ZOPA 4G88A 2K1SA 3CC2F 3JASA 2ZAUA 2HS0A 2PMPA 4BT7A 1T0AA 1Q81H 3OBWA 3RE3A 4TV9B 3C9UA 3HTNA 3S0HA 2OTJF 3VYTC 3NK6A 3VO8A 1IV1A 1GX1A 1QU9A 5EYPA 3VYUC 5HXZA 4ZI7A 5J2UB 2HQSC 5LYJB 1KC8H 1U3PA 1ZWZA 3P10A 4X1IA 2VAMA 1RLGA 1VQKF 3LDTA 4O2AA 1XHOA 3OW2F 1OAPA 3ELCA 3RYIB 2Z01A 4BT4A 3V4DA 5EIBD 3CPQA 3WPWA 4FFBA 1Z5WA 3VOBA 3CPWF 3VMFB 1VQMF 1VK3A 1KD1H 1FFXA 3BYQA 1S72F 3FPIA 3E22B 2KTUA 3JAWB 2ZOVA 3K0TA 1SZQA 3S0WA 4C8GA 4NWOB 4G4VA 2RHJA 4TV9A 5B8FA 5G4UC 2LBTA 3I7TA 3T80A 1SDSA 3JVHA 5J2UA 5LYJA 3J81M 3RA6A 1W55A 4IIJB 1GZ0A 3FD5A 3MBMA 3CMEF 2OTMA 3D54A 5HP8A 5LP6C 3JCMM 3JAKB 1CN7A 4B62A 2CW4A 3KE1A 2R6R1 5A2QM 1DBFA 1UFYA 4BVSA 1COMA 1U43A 1H48A 3FD6A 5KX5A 3VOAA 1YIJF 5HXUA 3C8LA 4I55B 2HX0A 5HY1A 3WGNA 3JAWA 3IMPA 2LCAA 4PWTA 1Q86H 3FFMA 5JH7B 4I50B 2CZWA 3S02A 3G6EF 2PHNA 4B5CA 1PF5A 3NMUC 3VIUA 2CSLA 3MCQA 3N4ZA 1QVFF 4ZHQB 1IV3A 4IIJA 3MDOA 1XV2A 1CK2A 4BY9D 1IPAA 3F0FA 5C8YB 5GANK 3CYPB 1FNJA 3JAKA 3JASB 4EI7A 4TZZA 3Q8HA 2AMTA 1YJ9F 3LMEA 3V7EA 2MQEA 3VCZA 3TD5A 2H8EA 3FBAA 3KHNA 4DRXB 3WGMA 3UT5B 5FNVB 3CCLF 4I55A 5EYPB 2L26A 5JH7A 3E1YA 5GAPK 1YJWF 2IQQA 3OBYA 3S0YA 4BT2A 3F0GA 2UYNB 1SA0B 2R751 2LBWA 5EB0A 2NMUA 5GIPC 2I6DA 2HRUA 1XRGA 1XBIA 5EB1B 1NQ3A 4BT3A 2CVLA 5EIBC 3HAXD 3S06A 5JCOC 3WJQA 1R1MA 2BTOA 1W42A 4TV8B 1X7OA 1QD9A 3UT5A 4DRXA 5FNVA 2JNBA 1X25A 3RYCA 3CCSF 5LOVB 5LP6A 1NMUB 3NVKE 4RHAA 4X3MA 3WJRA 4X1YB 3D01A 1VQ7F 3HKCA 3PLAC 1Z5VA 2UYJA 1JD1A 3JATA 2YXZA 1YITF 1W2BF 1KNJA 2RHOA 2UYNA 1KNKA 1SA0A 1KQSF 1JN1A 5LA6B 2FGYA 4B45A 1VQOF 3N2KB 5HY0A 5JQGB 3V3TA 3S03A 5KX5B 1FNKA 1RQ2A 2VAWA 5EAZA 3M1XA 5GONA 3O85A 1U3LA 4O4HB 2FC3A 1VQ6F 4G4ZA 4TV8A 5IJ9A 4ZHVA 3OONA 3KJKA 2KTVA 3V7QA 1N8RH 3CCEF 1M1KH 2Z1EA 2VGNA 5LOVA 2ZVYA 3CC4F 2BO1A 5HY4A 2VAPA 4ZOLA 3R0PA 2RHLA 2EWCA 3HKEB 4X1YA 1YJNF 3CD6F 1H7MA 3HWUA 3RYHB 4B46A 2HRYA 4XCQA 3G4SF 1VQ8F 5MN5A 3CCRF 1W5EA 5HWEA 4G4YA 5LA6A 3CC7F 3N2KA 4BT6A 5JQGA 3CCMF 3QHDA 3L7QA 3P0ZA 4TUYB 2N48A 4O4HA 2KGWA 2GVIA 3K12A 3JARB 4ZHWA 3G71F 1E7KA 2OHWA 2CWJA 2UZHA 2HVYD 2QA4F 1W41A 1YQNA 1JJ2F 3HKEA 3N4YA 1YGYA 1TVKA 3PAFA 3WJPA 3RYHA 3J80M 3C9TA 3WXMB 3U0OA 4I4TB 4X3LA 2F9ZC 3I55F 1VQVA 4EB6B 3E20B 5BMVB 3ZO8A 3CCJF 3CXCF 2ALEA 1K8AH 3CG6A 4TUYA 3RYCB 4YJ3A 5LP6B 3LWPC 4NQ3A 3JARA 4X1KB 3GHZA 3HKCB 3IKFA 1YHQF 2Z1UA 3JATB 1ONIA 2Q1YA 5EO3A 3CMAF 4IHJB 3WGLA 2OTLF 5CB4B 3MQWA 2VXYA 3DDNA 3K2XA 3GYQA 4R40B 2LBXA 2P6YA 5IYZA 3HKBA 4U39A 5GONB 1OFUA 4C81A 2ZODA 1VHAA 4I4TA 3RYFB 3CCQF 3M84A 3EORA 1Q8RA 4C8EA 4EB6A 1VQ5F 1VQNF 3IEQA 4KWEA 4X20B 5BMVA 3TD3A 5IJ9B 2IG8A 1W5AA 4EI8A 2QI2A 2WALA 2CHSA 3F6MA 4O4JB 4M8IA 5J2TA 3ZP4A 4ZOLB 4X1KA 1PXWA 4HNAB 4ZHYB 2IAFA 1W581 5CA1A 4IHJA 5CB4A 3NK7A 4U3JA 4NUTA 4O4LA 1W5FA 3C9SA 1X52A 1JFFA 5G4VC 2HP0B 4DXDA 5CA0B 2BTUA 3N2GA 3LFOA 3LYBA 1H47A 3RYFA 5JVDA 5AVMA 2AIZP 1GO0A 3ESJA 3I3FA 3LWOC 3AGKA 3QUWA 3HKDB 4X20A 1ODEA 3WPXA 5EZYB 2Z1FA 1M90H 4O4JA 2G9IA 3IEWA 3K14A 4O2BB 5FJ4C 3C9RA 5IJ0B 3GTZA 3F0EA 1Q7YH 1W5BA 3ERNA 2VGMA 1CLIA 2V9YA 4HNAA 2H8CA 1TVKB 1YI2F 4BVQA 3CCVF 3WGJA 2HS4A 1J7HA 3MCAB 1UI9A 3ZP7A 1W3EX 3LWVC 4E6EA 2HP0A 5CA0A 1JY8A 2UYKA 4YJ3B 3JALB 4G4WA 3CCUF 3JAMM 1FSZA 2AIFA 3SIVA 3LWQC 2QEXF 3HKDA 1NJIH 4WBNB 1RLUA 2OZBA 2I6RA 3KJJA 3CB2A 5EZYA 3RYIA 4BVTA 2KG4A 3VYSC 4O2BA 4O4IB 5IJ0A 5GIOC 3VI6A 4ERHA 3E22A 3ON1A 4LNUB 5JCOA 5LXTB 4BW0B 1GO1A 1IV2A 5ITZB 3IKEA 3P4EA 4YJ2B 2Q1XA 5IYZB 3HKBB 3QTYA 4F6RB 3WGKA 3I56F 1K9MH 5IT9M 3NVIB 3VTIC 2RHHA 5KMGB 2BTQB 2DYYA 2ZF8A 4RQOA 3J7AR 5MN6A 1TUBB 3HJWC 1Q82H 5HY2A 3JALA 5J2TB 3DC2A 5HP7A 4LCKA 3IR9A 4WBNA 1IV4A 3KIZA 1X7PA 2DT4A 2QTPA 1K73H 3D00A 5GINC 1QVGF 3TD4A 5CA1B 4C4WC
chains in the Genus database with same CATH topology
3LWRC 5HY1A 3RA5A 1VQ9F 2KTVA 3V7QA 3FFMA 1Q86H 1PXWA 3CCEF 1N8RH 1M1KH 1VQLF 2VGNA 2CZWA 2GLZA 3G6EF 1DT9A 1W40A 1RA4A 2BO1A 5HY4A 3CC4F 3NMUC 3NK7A 4NUTA 3N4ZA 1YJNF 3SIUA 3CD6F 1QVFF 1X52A 1H7MA 1T0KB 5DCVA 1VQ8F 4XCQA 3G4SF 5G4VC 1CK2A 4BVRA 1VQPF 4BY9D 1IPAA 3CCRF 5EWRA 5FLXM 3LFOA 5HWEA 5GANK 1VQ4F 3CC7F 4EI9A 1GO0A 3CCMF 4EI7A 3LWOC 3AGKA 4TZZA 1YJ9F 3V7EA 1M90H 3CC2F 5FJ4C 3G71F 1E7KA 3CCLF 2OHWA 1Q7YH 1Q81H 3OBWA 2HVYD 2QA4F 1W41A 2VGMA 2OTJF 3NK6A 1JJ2F 1YI2F 4BVQA 3E1YA 5HXZA 3N4YA 5GAPK 1YJWF 1KC8H 3OBYA 1ZWZA 3CCVF 1RLGA 3PAFA 3MCAB 1VQKF 1W3EX 3WXMB 3J80M 3LWVC 2LBWA 3OW2F 5GIPC 4X3LA 2I6DA 2F9ZC 3CCUF 3I55F 3CPQA 3E20B 3JAMM 1XBIA 2AIFA 3SIVA 3LWQC 3CCJF 3CXCF 2ALEA 2QEXF 3CPWF 3VMFB 1VQMF 1NJIH 1K8AH 3HAXD 3CG6A 2OZBA 1KD1H 1S72F 3LWPC 4BVTA 2KG4A 1W42A 4NQ3A 1X7OA 2KTUA 2JNBA 1YHQF 3CCSF 5GIOC 3VI6A 3ON1A 5G4UC 1NMUB 5EO3A 3NVKE 4BW0B 3CMAF 2OTLF 1GO1A 4X3MA 1VQ7F 3PLAC 1SDSA 3GYQA 3J81M 3RA6A 1W2BF 3I56F 1YITF 1K9MH 2LBXA 5IT9M 3NVIB 1GZ0A 3CMEF 3J7AR 1KQSF 3HJWC 1Q82H 3JCMM 2FGYA 1VQOF 5HY2A 3CCQF 1CN7A 5HY0A 3V3TA 1VQ5F 1VQNF 5A2QM 4BVSA 4LCKA 3IR9A 4EI8A 3O85A 2QI2A 1X7PA 2FC3A 2WALA 1K73H 3D00A 5GINC 1VQ6F 1QVGF 1YIJF 4C4WC 5HXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWR C;  3RA5 A;  1VQ9 F;  2KTV A;  3V7Q A;  3FFM A;  1Q86 H;  1PXW A;  3CCE F;  1N8R H;  1M1K H;  1VQL F;  2VGN A;  2CZW A;  3G6E F;  1DT9 A;  1W40 A;  1RA4 A;  2BO1 A;  3CC4 F;  3NMU C;  3NK7 A;  4NUT A;  3N4Z A;  1YJN F;  3SIU A;  3CD6 F;  1QVF F;  1X52 A;  1H7M A;  1T0K B;  5DCV A;  1VQ8 F;  3G4S F;  5G4V C;  1CK2 A;  1VQP F;  4BY9 D;  1IPA A;  3CCR F;  5EWR A;  5FLX M;  3LFO A;  5GAN K;  1VQ4 F;  3CC7 F;  1GO0 A;  3CCM F;  3LWO C;  3AGK A;  4TZZ A;  1YJ9 F;  3V7E A;  1M90 H;  3CC2 F;  5FJ4 C;  3G71 F;  1E7K A;  3CCL F;  2OHW A;  1Q7Y H;  1Q81 H;  3OBW A;  2HVY D;  2QA4 F;  1W41 A;  2VGM A;  2OTJ F;  3NK6 A;  1JJ2 F;  1YI2 F;  3E1Y A;  3N4Y A;  5GAP K;  1YJW F;  1KC8 H;  3OBY A;  1ZWZ A;  3CCV F;  1RLG A;  3PAF A;  3MCA B;  1VQK F;  1W3E X;  3WXM B;  3J80 M;  3LWV C;  2LBW A;  3OW2 F;  5GIP C;  4X3L A;  2I6D A;  3CCU F;  3I55 F;  3CPQ A;  3E20 B;  3JAM M;  1XBI A;  2AIF A;  3SIV A;  3LWQ C;  3CCJ F;  3CXC F;  2ALE A;  2QEX F;  3CPW F;  3VMF B;  1VQM F;  1NJI H;  1K8A H;  3HAX D;  3CG6 A;  2OZB A;  1KD1 H;  1S72 F;  3LWP C;  2KG4 A;  1W42 A;  1X7O A;  2KTU A;  2JNB A;  1YHQ F;  3CCS F;  5GIO C;  3VI6 A;  3ON1 A;  5G4U C;  1NMU B;  5EO3 A;  3NVK E;  4BW0 B;  3CMA F;  2OTL F;  1GO1 A;  4X3M A;  1VQ7 F;  3PLA C;  1SDS A;  3GYQ A;  3J81 M;  3RA6 A;  1W2B F;  3I56 F;  1YIT F;  1K9M H;  2LBX A;  5IT9 M;  3NVI B;  1GZ0 A;  3CME F;  3J7A R;  1KQS F;  3HJW C;  1Q82 H;  3JCM M;  1VQO F;  3CCQ F;  1CN7 A;  1VQ5 F;  1VQN F;  5A2Q M;  4LCK A;  3IR9 A;  3O85 A;  2QI2 A;  1X7P A;  2FC3 A;  2WAL A;  1K73 H;  5GIN C;  1VQ6 F;  1QVG F;  1YIJ F;  4C4W C; 
#chains in the Genus database with same CATH topology
 3F0D A;  2H6L A;  5MN4 A;  3LWR C;  3RA5 A;  1RQ7 A;  1VQ9 F;  4U3J B;  4O4I A;  4O4L B;  4BT5 A;  1VH8 A;  4C82 A;  2CHT A;  1VQL F;  2GLZ A;  4LNU A;  2GZL A;  1DT9 A;  1W40 A;  1RA4 A;  2Z1T A;  5LXT A;  5ITZ A;  1JFF B;  4ZK7 A;  4YJ2 A;  2ZVZ A;  4ZI7 B;  3N2G B;  1W59 A;  3SIU A;  4F6R A;  4X1I B;  4I50 A;  1U40 A;  5JVD B;  4C8I A;  3CYQ A;  2HS3 A;  2YYE A;  1T0K B;  5DCV A;  4O2A B;  5KMG A;  3B6N A;  4BVR A;  1VQP F;  3M4S A;  5EWR A;  5FLX M;  1TUB A;  2UYP A;  1QAH A;  2HP3 A;  1VQ4 F;  4ZHQ A;  2B33 A;  4EI9 A;  1W57 A;  2W8B C;  4FFB B;  4G4X A;  2RB9 A;  1FFX B;  5C8Y A;  3ZOP A;  4G88 A;  2K1S A;  3CC2 F;  3JAS A;  2ZAU A;  2HS0 A;  2PMP A;  4BT7 A;  1T0A A;  1Q81 H;  3OBW A;  3RE3 A;  4TV9 B;  3C9U A;  3HTN A;  3S0H A;  2OTJ F;  3VYT C;  3NK6 A;  3VO8 A;  1IV1 A;  1GX1 A;  1QU9 A;  5EYP A;  3VYU C;  5HXZ A;  4ZI7 A;  5J2U B;  2HQS C;  5LYJ B;  1KC8 H;  1U3P A;  1ZWZ A;  3P10 A;  4X1I A;  2VAM A;  1RLG A;  1VQK F;  3LDT A;  4O2A A;  1XHO A;  3OW2 F;  1OAP A;  3ELC A;  3RYI B;  2Z01 A;  4BT4 A;  3V4D A;  5EIB D;  3CPQ A;  3WPW A;  4FFB A;  1Z5W A;  3VOB A;  3CPW F;  3VMF B;  1VQM F;  1VK3 A;  1KD1 H;  1FFX A;  3BYQ A;  1S72 F;  3FPI A;  3E22 B;  2KTU A;  3JAW B;  2ZOV A;  3K0T A;  1SZQ A;  3S0W A;  4C8G A;  4NWO B;  4G4V A;  2RHJ A;  4TV9 A;  5B8F A;  5G4U C;  2LBT A;  3I7T A;  3T80 A;  1SDS A;  3JVH A;  5J2U A;  5LYJ A;  3J81 M;  3RA6 A;  1W55 A;  4IIJ B;  1GZ0 A;  3FD5 A;  3MBM A;  3CME F;  2OTM A;  3D54 A;  5HP8 A;  5LP6 C;  3JCM M;  3JAK B;  1CN7 A;  4B62 A;  2CW4 A;  3KE1 A;  2R6R 1;  5A2Q M;  1DBF A;  1UFY A;  4BVS A;  1COM A;  1U43 A;  1H48 A;  3FD6 A;  5KX5 A;  3VOA A;  1YIJ F;  5HXU A;  3C8L A;  4I55 B;  2HX0 A;  5HY1 A;  3WGN A;  3JAW A;  3IMP A;  2LCA A;  4PWT A;  1Q86 H;  3FFM A;  5JH7 B;  4I50 B;  2CZW A;  3S02 A;  3G6E F;  2PHN A;  4B5C A;  1PF5 A;  3NMU C;  3VIU A;  2CSL A;  3MCQ A;  3N4Z A;  1QVF F;  4ZHQ B;  1IV3 A;  4IIJ A;  3MDO A;  1XV2 A;  1CK2 A;  4BY9 D;  1IPA A;  3F0F A;  5C8Y B;  5GAN K;  3CYP B;  1FNJ A;  3JAK A;  3JAS B;  4EI7 A;  4TZZ A;  3Q8H A;  2AMT A;  1YJ9 F;  3LME A;  3V7E A;  2MQE A;  3VCZ A;  3TD5 A;  2H8E A;  3FBA A;  3KHN A;  4DRX B;  3WGM A;  3UT5 B;  5FNV B;  3CCL F;  4I55 A;  5EYP B;  2L26 A;  5JH7 A;  3E1Y A;  5GAP K;  1YJW F;  2IQQ A;  3OBY A;  3S0Y A;  4BT2 A;  3F0G A;  2UYN B;  1SA0 B;  2R75 1;  2LBW A;  5EB0 A;  2NMU A;  5GIP C;  2I6D A;  2HRU A;  1XRG A;  1XBI A;  5EB1 B;  1NQ3 A;  4BT3 A;  2CVL A;  5EIB C;  3HAX D;  3S06 A;  5JCO C;  3WJQ A;  1R1M A;  2BTO A;  1W42 A;  4TV8 B;  1X7O A;  1QD9 A;  3UT5 A;  4DRX A;  5FNV A;  2JNB A;  1X25 A;  3RYC A;  3CCS F;  5LOV B;  5LP6 A;  1NMU B;  3NVK E;  4RHA A;  4X3M A;  3WJR A;  4X1Y B;  3D01 A;  1VQ7 F;  3HKC A;  3PLA C;  1Z5V A;  2UYJ A;  1JD1 A;  3JAT A;  2YXZ A;  1YIT F;  1W2B F;  1KNJ A;  2RHO A;  2UYN A;  1KNK A;  1SA0 A;  1KQS F;  1JN1 A;  5LA6 B;  2FGY A;  4B45 A;  1VQO F;  3N2K B;  5HY0 A;  5JQG B;  3V3T A;  3S03 A;  5KX5 B;  1FNK A;  1RQ2 A;  2VAW A;  5EAZ A;  3M1X A;  5GON A;  3O85 A;  1U3L A;  4O4H B;  2FC3 A;  1VQ6 F;  4G4Z A;  4TV8 A;  5IJ9 A;  4ZHV A;  3OON A;  3KJK A;  2KTV A;  3V7Q A;  1N8R H;  3CCE F;  1M1K H;  2Z1E A;  2VGN A;  5LOV A;  2ZVY A;  3CC4 F;  2BO1 A;  5HY4 A;  2VAP A;  4ZOL A;  3R0P A;  2RHL A;  2EWC A;  3HKE B;  4X1Y A;  1YJN F;  3CD6 F;  1H7M A;  3HWU A;  3RYH B;  4B46 A;  2HRY A;  4XCQ A;  3G4S F;  1VQ8 F;  5MN5 A;  3CCR F;  1W5E A;  5HWE A;  4G4Y A;  5LA6 A;  3CC7 F;  3N2K A;  4BT6 A;  5JQG A;  3CCM F;  3QHD A;  3L7Q A;  3P0Z A;  4TUY B;  2N48 A;  4O4H A;  2KGW A;  2GVI A;  3K12 A;  3JAR B;  4ZHW A;  3G71 F;  1E7K A;  2OHW A;  2CWJ A;  2UZH A;  2HVY D;  2QA4 F;  1W41 A;  1YQN A;  1JJ2 F;  3HKE A;  3N4Y A;  1YGY A;  1TVK A;  3PAF A;  3WJP A;  3RYH A;  3J80 M;  3C9T A;  3WXM B;  3U0O A;  4I4T B;  4X3L A;  2F9Z C;  3I55 F;  1VQV A;  4EB6 B;  3E20 B;  5BMV B;  3ZO8 A;  3CCJ F;  3CXC F;  2ALE A;  1K8A H;  3CG6 A;  4TUY A;  3RYC B;  4YJ3 A;  5LP6 B;  3LWP C;  4NQ3 A;  3JAR A;  4X1K B;  3GHZ A;  3HKC B;  3IKF A;  1YHQ F;  2Z1U A;  3JAT B;  1ONI A;  2Q1Y A;  5EO3 A;  3CMA F;  4IHJ B;  3WGL A;  2OTL F;  5CB4 B;  3MQW A;  2VXY A;  3DDN A;  3K2X A;  3GYQ A;  4R40 B;  2LBX A;  2P6Y A;  5IYZ A;  3HKB A;  4U39 A;  5GON B;  1OFU A;  4C81 A;  2ZOD A;  1VHA A;  4I4T A;  3RYF B;  3CCQ F;  3M84 A;  3EOR A;  1Q8R A;  4C8E A;  4EB6 A;  1VQ5 F;  1VQN F;  3IEQ A;  4KWE A;  4X20 B;  5BMV A;  3TD3 A;  5IJ9 B;  2IG8 A;  1W5A A;  4EI8 A;  2QI2 A;  2WAL A;  2CHS A;  3F6M A;  4O4J B;  4M8I A;  5J2T A;  3ZP4 A;  4ZOL B;  4X1K A;  1PXW A;  4HNA B;  4ZHY B;  2IAF A;  1W58 1;  5CA1 A;  4IHJ A;  5CB4 A;  3NK7 A;  4U3J A;  4NUT A;  4O4L A;  1W5F A;  3C9S A;  1X52 A;  1JFF A;  5G4V C;  2HP0 B;  4DXD A;  5CA0 B;  2BTU A;  3N2G A;  3LFO A;  3LYB A;  1H47 A;  3RYF A;  5JVD A;  5AVM A;  2AIZ P;  1GO0 A;  3ESJ A;  3I3F A;  3LWO C;  3AGK A;  3QUW A;  3HKD B;  4X20 A;  1ODE A;  3WPX A;  5EZY B;  2Z1F A;  1M90 H;  4O4J A;  2G9I A;  3IEW A;  3K14 A;  4O2B B;  5FJ4 C;  3C9R A;  5IJ0 B;  3GTZ A;  3F0E A;  1Q7Y H;  1W5B A;  3ERN A;  2VGM A;  1CLI A;  2V9Y A;  4HNA A;  2H8C A;  1TVK B;  1YI2 F;  4BVQ A;  3CCV F;  3WGJ A;  2HS4 A;  1J7H A;  3MCA B;  1UI9 A;  3ZP7 A;  1W3E X;  3LWV C;  4E6E A;  2HP0 A;  5CA0 A;  1JY8 A;  2UYK A;  4YJ3 B;  3JAL B;  4G4W A;  3CCU F;  3JAM M;  1FSZ A;  2AIF A;  3SIV A;  3LWQ C;  2QEX F;  3HKD A;  1NJI H;  4WBN B;  1RLU A;  2OZB A;  2I6R A;  3KJJ A;  3CB2 A;  5EZY A;  3RYI A;  4BVT A;  2KG4 A;  3VYS C;  4O2B A;  4O4I B;  5IJ0 A;  5GIO C;  3VI6 A;  4ERH A;  3E22 A;  3ON1 A;  4LNU B;  5JCO A;  5LXT B;  4BW0 B;  1GO1 A;  1IV2 A;  5ITZ B;  3IKE A;  3P4E A;  4YJ2 B;  2Q1X A;  5IYZ B;  3HKB B;  3QTY A;  4F6R B;  3WGK A;  3I56 F;  1K9M H;  5IT9 M;  3NVI B;  3VTI C;  2RHH A;  5KMG B;  2BTQ B;  2DYY A;  2ZF8 A;  4RQO A;  3J7A R;  5MN6 A;  1TUB B;  3HJW C;  1Q82 H;  5HY2 A;  3JAL A;  5J2T B;  3DC2 A;  5HP7 A;  4LCK A;  3IR9 A;  4WBN A;  1IV4 A;  3KIZ A;  1X7P A;  2DT4 A;  2QTP A;  1K73 H;  3D00 A;  5GIN C;  1QVG F;  3TD4 A;  5CA1 B;  4C4W C; 
#chains in the Genus database with same CATH homology
 3LWR C;  5HY1 A;  3RA5 A;  1VQ9 F;  2KTV A;  3V7Q A;  3FFM A;  1Q86 H;  1PXW A;  3CCE F;  1N8R H;  1M1K H;  1VQL F;  2VGN A;  2CZW A;  2GLZ A;  3G6E F;  1DT9 A;  1W40 A;  1RA4 A;  2BO1 A;  5HY4 A;  3CC4 F;  3NMU C;  3NK7 A;  4NUT A;  3N4Z A;  1YJN F;  3SIU A;  3CD6 F;  1QVF F;  1X52 A;  1H7M A;  1T0K B;  5DCV A;  1VQ8 F;  4XCQ A;  3G4S F;  5G4V C;  1CK2 A;  4BVR A;  1VQP F;  4BY9 D;  1IPA A;  3CCR F;  5EWR A;  5FLX M;  3LFO A;  5HWE A;  5GAN K;  1VQ4 F;  3CC7 F;  4EI9 A;  1GO0 A;  3CCM F;  4EI7 A;  3LWO C;  3AGK A;  4TZZ A;  1YJ9 F;  3V7E A;  1M90 H;  3CC2 F;  5FJ4 C;  3G71 F;  1E7K A;  3CCL F;  2OHW A;  1Q7Y H;  1Q81 H;  3OBW A;  2HVY D;  2QA4 F;  1W41 A;  2VGM A;  2OTJ F;  3NK6 A;  1JJ2 F;  1YI2 F;  4BVQ A;  3E1Y A;  5HXZ A;  3N4Y A;  5GAP K;  1YJW F;  1KC8 H;  3OBY A;  1ZWZ A;  3CCV F;  1RLG A;  3PAF A;  3MCA B;  1VQK F;  1W3E X;  3WXM B;  3J80 M;  3LWV C;  2LBW A;  3OW2 F;  5GIP C;  4X3L A;  2I6D A;  2F9Z C;  3CCU F;  3I55 F;  3CPQ A;  3E20 B;  3JAM M;  1XBI A;  2AIF A;  3SIV A;  3LWQ C;  3CCJ F;  3CXC F;  2ALE A;  2QEX F;  3CPW F;  3VMF B;  1VQM F;  1NJI H;  1K8A H;  3HAX D;  3CG6 A;  2OZB A;  1KD1 H;  1S72 F;  3LWP C;  4BVT A;  2KG4 A;  1W42 A;  4NQ3 A;  1X7O A;  2KTU A;  2JNB A;  1YHQ F;  3CCS F;  5GIO C;  3VI6 A;  3ON1 A;  5G4U C;  1NMU B;  5EO3 A;  3NVK E;  4BW0 B;  3CMA F;  2OTL F;  1GO1 A;  4X3M A;  1VQ7 F;  3PLA C;  1SDS A;  3GYQ A;  3J81 M;  3RA6 A;  1W2B F;  3I56 F;  1YIT F;  1K9M H;  2LBX A;  5IT9 M;  3NVI B;  1GZ0 A;  3CME F;  3J7A R;  1KQS F;  3HJW C;  1Q82 H;  3JCM M;  2FGY A;  1VQO F;  5HY2 A;  3CCQ F;  1CN7 A;  5HY0 A;  3V3T A;  1VQ5 F;  1VQN F;  5A2Q M;  4BVS A;  4LCK A;  3IR9 A;  4EI8 A;  3O85 A;  2QI2 A;  1X7P A;  2FC3 A;  2WAL A;  1K73 H;  3D00 A;  5GIN C;  1VQ6 F;  1QVG F;  1YIJ F;  4C4W C;  5HXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...