1VQUA

Crystal structure of anthranilate phosphoribosyltransferase 2 (17130499) from nostoc sp. at 1.85 a resolution
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
334
Chain Sequence
b'TSWYLLLQQLIDGESLSRSQAAELMQGWLSEAVPPELSGAILTALNFKGVSADELTGMAEVLQSQSKMTNSPFSIIDTCGTGSSTFNISTAVAFVAAAYGVPVAKHGNRSSLTGSADVLEALGVNLGASPEKVQAALQEVGITFLFAPGWHPALKAVATLRRTLRIRTVFNLLGPLVNPLRPTGQVVGLFTPKLLTTVAQALDNLGKQKAIVLHGRERLDEAGLGDLTDLAVLSDGELQLTTINPQEVGVTPAPIGALRGGDVQENAEILKAVLQGKGTQAQQDAVALNAALALQVAGAVPLLDHAQGVSVAKEILQTGTAWAKLAQLVYFLGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase 2
publication title Crystal structure of Anthranilate phosphoribosyltransferase 2 (17130499) from Nostoc sp. at 1.85 A resolution
rcsb
source organism Nostoc sp.
molecule tags Transferase
total genus 115
structure length 334
sequence length 350
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2005-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 1vquA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 1vquA02
3TWPA 1O17A 4OWMA 5EP8A 4OWNA 4MUOA 3GBRA 1ZYKA 4X59A 4X5EA 1KHDA 4N5VA 4GA4A 5BNEA 1VQUA 3R6CA 3QSAA 4X5DA 4GIUA 4HKMA 5C2LA 1OTPA 2DSJA 4X5CA 4M0RA 4YYYA 4X58A 5BYTA 4OWSA 4ZOFA 4GA6A 1ZXYA 1BRWA 3QQSA 5C1RA 5C7SA 3QS8A 4X5BA 5EY3A 3R88A 1V8GA 4GTNA 4OWQA 2J0FA 2BPQA 5BO3A 3UU1A 4XR5A 4OWOA 5BO2A 3QR9A 4X46A 4EAFA 2TPTA 1GXBA 4OWVA 4OWUA 3H5QA 1ZVWA 4X5AA 2ELCA 2WK5A 4GKMA 4N93A 4ZOKA 4N8QA 4ZOJA 1KGZA 4ZTVA 1AZYA 4YI7A 4IJ1A 4EADA 4YEKA 1UOUA 2WK6A 2GVQA 4GA5A 4LHMA
chains in the Genus database with same CATH superfamily
3TWPA 1O17A 4OWMA 5EP8A 4OWNA 4MUOA 3GBRA 1ZYKA 4X59A 4X5EA 1KHDA 4F3FC 4N5VA 4GA4A 5BNEA 1RF8B 1VQUA 3R6CA 3QSAA 4X5DA 4GIUA 4HKMA 5C2LA 1OTPA 2DSJA 4X5CA 4M0RA 4YYYA 4X58A 5BYTA 4OWSA 4ZOFA 4GA6A 1ZXYA 1BRWA 3QQSA 5C1RA 5C7SA 3QS8A 4X5BA 5EY3A 3R88A 1V8GA 4GTNA 4OWQA 2J0FA 2BPQA 5BO3A 3UU1A 4XR5A 4OWOA 5BO2A 3QR9A 4X46A 4EAFA 1RRZA 2TPTA 1GXBA 4OWVA 4OWUA 3H5QA 1ZVWA 4X5AA 2ELCA 2WK5A 4GKMA 4N93A 4ZOKA 4N8QA 4ZOJA 1KGZA 4ZTVA 1AZYA 4YI7A 4IJ1A 4EADA 4YEKA 1UOUA 2WK6A 2GVQA 4GA5A 4LHMA
chains in the Genus database with same CATH topology
3TWPA 1O17A 4OWMA 5EP8A 4OWNA 4MUOA 3GBRA 1ZYKA 4X59A 4X5EA 1KHDA 4N5VA 4GA4A 5BNEA 1VQUA 3R6CA 3QSAA 4X5DA 4GIUA 4HKMA 5C2LA 1OTPA 2DSJA 4X5CA 4M0RA 4YYYA 4X58A 5BYTA 4OWSA 4ZOFA 4GA6A 1ZXYA 1BRWA 3QQSA 5C1RA 5C7SA 3QS8A 4X5BA 5EY3A 3R88A 1V8GA 4GTNA 4OWQA 2J0FA 2BPQA 5BO3A 3UU1A 4XR5A 4OWOA 5BO2A 3QR9A 4X46A 4EAFA 2TPTA 1GXBA 4OWVA 4OWUA 3H5QA 1ZVWA 4X5AA 2ELCA 2WK5A 4GKMA 4N93A 4ZOKA 4N8QA 4ZOJA 1KGZA 4ZTVA 1AZYA 4YI7A 4IJ1A 4EADA 4YEKA 1UOUA 2WK6A 2GVQA 4GA5A 4LHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWP A;  1O17 A;  4OWM A;  5EP8 A;  4OWN A;  4MUO A;  3GBR A;  1ZYK A;  4X59 A;  4X5E A;  1KHD A;  4N5V A;  4GA4 A;  5BNE A;  1VQU A;  3R6C A;  3QSA A;  4X5D A;  4GIU A;  4HKM A;  5C2L A;  1OTP A;  2DSJ A;  4X5C A;  4M0R A;  4YYY A;  4X58 A;  5BYT A;  4OWS A;  4ZOF A;  4GA6 A;  1ZXY A;  1BRW A;  3QQS A;  5C1R A;  5C7S A;  3QS8 A;  4X5B A;  5EY3 A;  3R88 A;  1V8G A;  4GTN A;  4OWQ A;  2J0F A;  2BPQ A;  5BO3 A;  3UU1 A;  4XR5 A;  4OWO A;  5BO2 A;  3QR9 A;  4X46 A;  4EAF A;  2TPT A;  1GXB A;  4OWV A;  4OWU A;  3H5Q A;  1ZVW A;  4X5A A;  2ELC A;  2WK5 A;  4GKM A;  4N93 A;  4ZOK A;  4N8Q A;  4ZOJ A;  1KGZ A;  4ZTV A;  1AZY A;  4YI7 A;  4IJ1 A;  4EAD A;  4YEK A;  1UOU A;  2WK6 A;  2GVQ A;  4GA5 A;  4LHM A; 
#chains in the Genus database with same CATH topology
 3TWP A;  1O17 A;  4OWM A;  5EP8 A;  4OWN A;  4MUO A;  3GBR A;  1ZYK A;  4X59 A;  4X5E A;  1KHD A;  4F3F C;  4N5V A;  4GA4 A;  5BNE A;  1RF8 B;  1VQU A;  3R6C A;  3QSA A;  4X5D A;  4GIU A;  4HKM A;  5C2L A;  1OTP A;  2DSJ A;  4X5C A;  4M0R A;  4YYY A;  4X58 A;  5BYT A;  4OWS A;  4ZOF A;  4GA6 A;  1ZXY A;  1BRW A;  3QQS A;  5C1R A;  5C7S A;  3QS8 A;  4X5B A;  5EY3 A;  3R88 A;  1V8G A;  4GTN A;  4OWQ A;  2J0F A;  2BPQ A;  5BO3 A;  3UU1 A;  4XR5 A;  4OWO A;  5BO2 A;  3QR9 A;  4X46 A;  4EAF A;  1RRZ A;  2TPT A;  1GXB A;  4OWV A;  4OWU A;  3H5Q A;  1ZVW A;  4X5A A;  2ELC A;  2WK5 A;  4GKM A;  4N93 A;  4ZOK A;  4N8Q A;  4ZOJ A;  1KGZ A;  4ZTV A;  1AZY A;  4YI7 A;  4IJ1 A;  4EAD A;  4YEK A;  1UOU A;  2WK6 A;  2GVQ A;  4GA5 A;  4LHM A; 
#chains in the Genus database with same CATH homology
 3TWP A;  1O17 A;  4OWM A;  5EP8 A;  4OWN A;  4MUO A;  3GBR A;  1ZYK A;  4X59 A;  4X5E A;  1KHD A;  4N5V A;  4GA4 A;  5BNE A;  1VQU A;  3R6C A;  3QSA A;  4X5D A;  4GIU A;  4HKM A;  5C2L A;  1OTP A;  2DSJ A;  4X5C A;  4M0R A;  4YYY A;  4X58 A;  5BYT A;  4OWS A;  4ZOF A;  4GA6 A;  1ZXY A;  1BRW A;  3QQS A;  5C1R A;  5C7S A;  3QS8 A;  4X5B A;  5EY3 A;  3R88 A;  1V8G A;  4GTN A;  4OWQ A;  2J0F A;  2BPQ A;  5BO3 A;  3UU1 A;  4XR5 A;  4OWO A;  5BO2 A;  3QR9 A;  4X46 A;  4EAF A;  2TPT A;  1GXB A;  4OWV A;  4OWU A;  3H5Q A;  1ZVW A;  4X5A A;  2ELC A;  2WK5 A;  4GKM A;  4N93 A;  4ZOK A;  4N8Q A;  4ZOJ A;  1KGZ A;  4ZTV A;  1AZY A;  4YI7 A;  4IJ1 A;  4EAD A;  4YEK A;  1UOU A;  2WK6 A;  2GVQ A;  4GA5 A;  4LHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...