1VRGA

Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
515
structure length
515
Chain Sequence
MSLRDKIEELKKIEKEIEQGGGPEKVEKQHRAGKLTAWERLELLLDPGTFVEIDKFVEHRNTYFGLDKVKLPRDGVITGVGEINGRKVAVFSQDFTVMGGSLGEMHAKKIVKLLDLALKMGIPVIGINDSGGARIQEGVDALAGYGEIFLRNTLASGVVPQITVIAGPCAGGAVYSPALTDFIVMVDQTARMFITGPNVIKAVTGEEISQEDLGGAMVHNQKSGNAHFLADNDEKAMSLVRTLLSYLPSNNAEEPPVEDPDTSLETPEDILDILPDNPNKGYDVRDVIKRVVDHGEFFEVQPYFAKNIVIGFARIQGKTVGIVANQPSVLAGVLDIDSSDKAARFIRFLDAFNIPILTFVDTPGYLPGVAQEHGGIIRHGAKLLYAYSEATVPKITVILRKAYGGAYIAMGSKHLGADMVLAWPSAEIAVMGPEGAANIIFKREIEASSNPEETRRKLIEEYKQQFANPYIAASRGYVDMVIDPRETRKYIMRALEVCETKVEYRPKKKHGNIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of propionyl-CoA carboxylase, beta subunit (TM0716) from THERMOTOGA MARITIMA at 2.30 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
molecule keywords propionyl-CoA carboxylase, beta subunit
total genus 181
structure length 515
sequence length 515
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1vrgA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1vrgA01
5DUFA 2VX2A 1FC9A 2HW5A 4Q1IA 1HNUA 1K39A 1XNVA 1SZOA 2VSSF 4JCSA 3TRRA 3OC7A 1Y7OA 4QFEA 2IEXA 4GHNA 5CTBA 3I47A 3PEAA 3M6MA 4JOTA 3NJDA 2J5IA 5JBWA 3WG5A 5INFA 3R6HA 1RJMA 4NEKA 3KTGA 2EJ5A 3JU1A 5FIFA 3TDCA 4LK5A 4K2NA 2J5GD 3R9QA 4JYJA 3QXIA 1ON9A 3P85A 2ZQQA 1DUBA 3U9RB 1UYRA 1PIXA 3KTIA 3QK8A 4WZ8B 3BPPA 5DU4A 3HE2A 3TV5A 5DL1A 4I4ZA 3ZWCA 4B3IA 5CTCA 3GMAA 3RRVA 2PBPA 5KDRA 3DORA 3P2LA 1ON3A 2DEOA 3HINA 4JCRA 2GTRA 1J7XA 3STAA 3R9SA 1Q52A 3ZW9A 4OG1A 3H0JA 5G1QA 2W3PA 2F9IA 4ELXA 4L8KA 4DI1A 4RYFA 2A7SA 3G64A 4NNQA 1VRGA 1N6DA 3H0QA 4FJWD 3N6RB 5KDRB 4FZWC 2Q34A 2VSUA 1TG6A 3TVWA 4IZCA 3V5IA 3QWDA 3T89A 4K29A 3BEZA 3TZ3A 4ZDBA 5C90A 3KQFA 4JYLA 1W2XA 4MXIA 3GF7A 4GM2A 1Q51A 3TLFA 3OMEA 5DUCA 3SLLA 4KWBA 1EY3A 5MGBA 2A81A 5DZKA 3ZWAA 3SWXA 3IBBA 3QMJA 3RSTA 3U9TB 1UYVA 3K8XA 5DKPA 4OMRA 3R0OA 3ST9A 3PZKA 4RYFH 3GF3A 3TT7A 4IZBA 2FBMA 4I42A 2Q2XA 5INGA 4MOUA 4OLQA 2J5GA 5E0NX 3GLMA 5E0SH 4ELWA 4EMMA 5DZKH 4FN7A 2CBYA 4U0GH 1K32A 1FCFA 1UIYA 1N6EA 4L6WA 3QYRA 2Q35A 5G1RA 2DUBA 3T88A 3VIVA 3HLN1 3BF0A 3KTKA 3ZWBA 3R9TA 4Q0GA 5KJPA 4B3HA 2ZL3A 3LKEA 5JBXA 1EF9A 5FUSA 3GKBA 3LAOA 2PG8A 5DU6A 3Q7HA 3KTJA 4FNDA 2VREA 4G2RA 2ZL0A 1DCIA 4QIJA 1N6FA 4ZDDA 2QQ3A 1O8UA 1XO6A 1NZYB 1OD2A 3H0UA 3TVUA 3MFMA 5IKLB 4WCZA 2NP9A 1TYFA 2PPYA 3QXZA 4IZDA 1MJ3A 3T8AA 3L3SA 3IB9A 2CE3A 3V5EA 3U9SB 2ZQRA 4I52A 1OD4A 1RJNA 3MYBA 3MT6A 1WDLA 1UYTA 2F6QA 1XNYA 2F9IB 2VSUE 2VSSE 4JCQA 3IAVA 3M6NA 4FB8A 4YLHA 2VSUC 4B3JA 3HRXA 4ZDFA 2J5II 2UZFA 2BZRA 1PJHA 4F47A 3MOYA 1HZDA 4ZU2A 3ISAA 3KTHA 4U0GA 4K3WA 3QKAA 1FC6A 2F9YA 4Z0MA 4KNPA 2X24A 1JXZA 4FN8A 4HC8A 3RSIA 3ZW8A 4KPKA 5C9GA 3H0SA 1WDKA 1XNWA 4MI2A 4HNKA 3FF6A 1YG8A 1XX4A 5DU8A 3K50A 4QIIA 4ASIA 1EF8A 1WZ8A 2WTBA 3H81A 4U0HA 5DTWA 2A7KA 1UYSA 1NZYA 1FC7A 3P5MA 3TT6A 4U18A 4ELSA 2X58A 5INIA 4ZDCA 4U19A 5E0SA 2C8TA 2ZL2A 2F6IA 1WDMA 2J5SA 2VSUF 3OT6A 2D3TA 1SG4A 2VSSA 3Q0JA 2J5IB 3NJBA 3T3WA 4ZDEA 2F9YB 1HNOA 4FNBA 2FW2A 3QREA 2ZL4A 4JFCA 4EMPA 4JVTA 4KD6A 2FZSA 4U1AA 3Q1TA 4JCTA 1YG6A 3PE8A 5DTPA 4RCNA 3DJAA 3FDUA 3Q0GA 3HP0A 4EMLA 4JWVA 4FZWA 4JSBA 4JJTA 1X0UA 4WYOB 3H02A 3PGQA 5G1SA 3T8BA
chains in the Genus database with same CATH superfamily
5DUFA 2VX2A 1FC9A 2HW5A 4Q1IA 1HNUA 1K39A 1XNVA 1SZOA 2VSSF 4JCSA 3TRRA 3OC7A 1Y7OA 4QFEA 2IEXA 4GHNA 5CTBA 3I47A 3PEAA 3M6MA 4JOTA 3NJDA 2J5IA 5JBWA 3WG5A 5INFA 3R6HA 1RJMA 4NEKA 3KTGA 2EJ5A 3JU1A 5FIFA 3TDCA 4LK5A 4K2NA 2J5GD 3R9QA 4JYJA 3QXIA 1ON9A 3P85A 2ZQQA 1DUBA 3U9RB 1UYRA 1PIXA 3KTIA 3QK8A 4WZ8B 3BPPA 5DU4A 3HE2A 3TV5A 5DL1A 4I4ZA 3ZWCA 4B3IA 5CTCA 3GMAA 3RRVA 2PBPA 5KDRA 3DORA 3P2LA 1ON3A 2DEOA 3HINA 4JCRA 2GTRA 1J7XA 3STAA 3R9SA 1Q52A 3ZW9A 4OG1A 3H0JA 5G1QA 2W3PA 2F9IA 4ELXA 4L8KA 4DI1A 4RYFA 2A7SA 3G64A 4NNQA 1VRGA 1N6DA 3H0QA 4FJWD 3N6RB 5KDRB 4FZWC 2Q34A 2VSUA 1TG6A 3TVWA 4IZCA 3V5IA 3QWDA 3T89A 4K29A 3BEZA 3TZ3A 4ZDBA 5C90A 3KQFA 4JYLA 1W2XA 4MXIA 3GF7A 4GM2A 1Q51A 3TLFA 3OMEA 5DUCA 3SLLA 4KWBA 1EY3A 5MGBA 2A81A 5DZKA 3ZWAA 3SWXA 3IBBA 3QMJA 5HUQA 3RSTA 3U9TB 1UYVA 3K8XA 5DKPA 4OMRA 3R0OA 3ST9A 3PZKA 4RYFH 3GF3A 3TT7A 4IZBA 2FBMA 4I42A 2Q2XA 4MOUA 5INGA 4OLQA 2J5GA 5E0NX 3GLMA 5E0SH 4ELWA 4EMMA 5DZKH 4FN7A 2CBYA 4U0GH 1K32A 1FCFA 4HDTA 1UIYA 1N6EA 4L6WA 3QYRA 2Q35A 5G1RA 2DUBA 3T88A 3VIVA 3HLN1 3BF0A 3KTKA 3ZWBA 3R9TA 4Q0GA 5KJPA 4B3HA 2ZL3A 3LKEA 5JBXA 1EF9A 5FUSA 3GKBA 3LAOA 2PG8A 5DU6A 3Q7HA 3KTJA 4FNDA 2VREA 4G2RA 2ZL0A 1DCIA 4QIJA 1N6FA 4ZDDA 2QQ3A 4J2UA 1O8UA 3BPTA 1XO6A 1NZYB 1OD2A 3H0UA 4NARA 3TVUA 3MFMA 5IKLB 4WCZA 2NP9A 1TYFA 2PPYA 3QXZA 4IZDA 1MJ3A 3T8AA 3L3SA 3IB9A 2CE3A 3V5EA 3U9SB 2ZQRA 4I52A 1OD4A 1RJNA 3MYBA 3MT6A 1WDLA 1UYTA 2F6QA 1XNYA 2F9IB 2VSUE 2VSSE 4JCQA 3IAVA 3M6NA 4FB8A 4YLHA 2VSUC 4B3JA 3HRXA 4ZDFA 2J5II 2UZFA 2BZRA 1PJHA 4F47A 3MOYA 1HZDA 4ZU2A 3ISAA 3KTHA 4U0GA 4K3WA 3QKAA 1FC6A 2F9YA 4Z0MA 4KNPA 2X24A 1JXZA 4FN8A 4HC8A 3RSIA 3ZW8A 4KPKA 5C9GA 3H0SA 1WDKA 1XNWA 4MI2A 4HNKA 3FF6A 1YG8A 1XX4A 5DU8A 3K50A 4QIIA 4ASIA 1EF8A 1WZ8A 2WTBA 3H81A 4U0HA 5DTWA 2A7KA 1UYSA 1NZYA 1FC7A 3P5MA 3TT6A 4U18A 4ELSA 2X58A 5INIA 4ZDCA 4U19A 5E0SA 2C8TA 2ZL2A 2F6IA 1WDMA 2J5SA 2VSUF 3OT6A 2D3TA 1SG4A 2VSSA 3Q0JA 2J5IB 3NJBA 3T3WA 4ZDEA 2F9YB 1HNOA 4FNBA 2FW2A 3QREA 2ZL4A 4JFCA 4EMPA 4JVTA 2YJGA 4KD6A 2FZSA 4U1AA 3Q1TA 4JCTA 1YG6A 3PE8A 5DTPA 4RCNA 3DJAA 3FDUA 3Q0GA 3HP0A 4EMLA 4JWVA 4FZWA 4JSBA 4JJTA 1X0UA 4WYOB 3H02A 3PGQA 5G1SA 3T8BA
chains in the Genus database with same CATH topology
5DUFA 2VX2A 1FC9A 2HW5A 4Q1IA 1HNUA 1K39A 1XNVA 1SZOA 2VSSF 4JCSA 3TRRA 3OC7A 1Y7OA 4QFEA 2IEXA 4GHNA 5CTBA 3I47A 3PEAA 3M6MA 4JOTA 3NJDA 2J5IA 5JBWA 3WG5A 5INFA 3R6HA 1RJMA 4NEKA 3KTGA 2EJ5A 3JU1A 5FIFA 3TDCA 4LK5A 4K2NA 2J5GD 3R9QA 4JYJA 3QXIA 1ON9A 3P85A 2ZQQA 1DUBA 3U9RB 1UYRA 1PIXA 3KTIA 3QK8A 4WZ8B 3BPPA 5DU4A 3HE2A 3TV5A 5DL1A 4I4ZA 3ZWCA 4B3IA 5CTCA 3GMAA 3RRVA 2PBPA 5KDRA 3DORA 3P2LA 1ON3A 2DEOA 3HINA 4JCRA 2GTRA 1J7XA 3STAA 3R9SA 1Q52A 3ZW9A 4OG1A 3H0JA 5G1QA 2W3PA 2F9IA 4ELXA 4L8KA 4DI1A 4RYFA 2A7SA 3G64A 4NNQA 1VRGA 1N6DA 3H0QA 4FJWD 3N6RB 5KDRB 4FZWC 2Q34A 2VSUA 1TG6A 3TVWA 4IZCA 3V5IA 3QWDA 3T89A 4K29A 3BEZA 3TZ3A 4ZDBA 5C90A 3KQFA 4JYLA 1W2XA 4MXIA 3GF7A 4GM2A 1Q51A 3TLFA 3OMEA 5DUCA 3SLLA 4KWBA 1EY3A 5MGBA 2A81A 5DZKA 3ZWAA 3SWXA 3IBBA 3QMJA 5HUQA 3RSTA 3U9TB 1UYVA 3K8XA 5DKPA 4OMRA 3R0OA 3ST9A 3PZKA 4RYFH 3GF3A 3TT7A 4IZBA 2FBMA 4I42A 2Q2XA 4MOUA 5INGA 4OLQA 2J5GA 5E0NX 3GLMA 5E0SH 4ELWA 4EMMA 5DZKH 4FN7A 2CBYA 4U0GH 1K32A 1FCFA 4HDTA 1UIYA 1N6EA 4L6WA 3QYRA 2Q35A 5G1RA 2DUBA 3T88A 3VIVA 3HLN1 3BF0A 3KTKA 3ZWBA 3R9TA 4Q0GA 5KJPA 4B3HA 2ZL3A 3LKEA 5JBXA 1EF9A 5FUSA 3GKBA 3LAOA 2PG8A 5DU6A 3Q7HA 3KTJA 4FNDA 2VREA 4G2RA 2ZL0A 1DCIA 4QIJA 1N6FA 4ZDDA 2QQ3A 4J2UA 1O8UA 3BPTA 1XO6A 1NZYB 1OD2A 3H0UA 4NARA 3TVUA 3MFMA 5IKLB 4WCZA 2NP9A 1TYFA 2PPYA 3QXZA 4IZDA 1MJ3A 3T8AA 3L3SA 3IB9A 2CE3A 3V5EA 3U9SB 2ZQRA 4I52A 1OD4A 1RJNA 3MYBA 3MT6A 1WDLA 1UYTA 2F6QA 1XNYA 2F9IB 2VSUE 2VSSE 4JCQA 3IAVA 3M6NA 4FB8A 4YLHA 2VSUC 4B3JA 3HRXA 4ZDFA 2J5II 2UZFA 2BZRA 1PJHA 4F47A 3MOYA 1HZDA 4ZU2A 3ISAA 3KTHA 4U0GA 4K3WA 3QKAA 1FC6A 2F9YA 4Z0MA 4KNPA 2X24A 1JXZA 4FN8A 4HC8A 3RSIA 3ZW8A 4KPKA 5C9GA 3H0SA 1WDKA 1XNWA 4MI2A 4HNKA 3FF6A 1YG8A 1XX4A 5DU8A 3K50A 4QIIA 4ASIA 1EF8A 1WZ8A 2WTBA 3H81A 4U0HA 5DTWA 2A7KA 1UYSA 1NZYA 1FC7A 3P5MA 3TT6A 4U18A 4ELSA 2X58A 5INIA 4ZDCA 4U19A 5E0SA 2C8TA 2ZL2A 2F6IA 1WDMA 2J5SA 2VSUF 3OT6A 2D3TA 1SG4A 2VSSA 3Q0JA 2J5IB 3NJBA 3T3WA 4ZDEA 2F9YB 1HNOA 4FNBA 2FW2A 3QREA 2ZL4A 4JFCA 4EMPA 4JVTA 2YJGA 4KD6A 2FZSA 4U1AA 3Q1TA 4JCTA 1YG6A 3PE8A 5DTPA 4RCNA 3DJAA 3FDUA 3Q0GA 3HP0A 4EMLA 4JWVA 4FZWA 4JSBA 4JJTA 1X0UA 4WYOB 3H02A 3PGQA 5G1SA 3T8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DUF A;  2VX2 A;  1FC9 A;  2HW5 A;  4Q1I A;  1HNU A;  1K39 A;  1XNV A;  1SZO A;  2VSS F;  4JCS A;  3TRR A;  3OC7 A;  1Y7O A;  4QFE A;  2IEX A;  4GHN A;  5CTB A;  3I47 A;  3PEA A;  3M6M A;  4JOT A;  3NJD A;  2J5I A;  5JBW A;  3WG5 A;  5INF A;  3R6H A;  1RJM A;  4NEK A;  3KTG A;  2EJ5 A;  3JU1 A;  5FIF A;  3TDC A;  4LK5 A;  4K2N A;  2J5G D;  3R9Q A;  4JYJ A;  3QXI A;  1ON9 A;  3P85 A;  2ZQQ A;  1DUB A;  3U9R B;  1UYR A;  1PIX A;  3KTI A;  3QK8 A;  4WZ8 B;  3BPP A;  5DU4 A;  3HE2 A;  3TV5 A;  5DL1 A;  4I4Z A;  3ZWC A;  4B3I A;  5CTC A;  3GMA A;  3RRV A;  2PBP A;  5KDR A;  3DOR A;  3P2L A;  1ON3 A;  2DEO A;  3HIN A;  4JCR A;  2GTR A;  1J7X A;  3STA A;  3R9S A;  1Q52 A;  3ZW9 A;  4OG1 A;  3H0J A;  5G1Q A;  2W3P A;  2F9I A;  4ELX A;  4L8K A;  4DI1 A;  4RYF A;  2A7S A;  3G64 A;  4NNQ A;  1VRG A;  1N6D A;  3H0Q A;  4FJW D;  3N6R B;  5KDR B;  4FZW C;  2Q34 A;  2VSU A;  1TG6 A;  3TVW A;  4IZC A;  3V5I A;  3QWD A;  3T89 A;  4K29 A;  3BEZ A;  3TZ3 A;  4ZDB A;  5C90 A;  3KQF A;  4JYL A;  1W2X A;  4MXI A;  3GF7 A;  4GM2 A;  1Q51 A;  3TLF A;  3OME A;  5DUC A;  3SLL A;  4KWB A;  1EY3 A;  5MGB A;  2A81 A;  5DZK A;  3ZWA A;  3SWX A;  3IBB A;  3QMJ A;  3RST A;  3U9T B;  1UYV A;  3K8X A;  5DKP A;  4OMR A;  3R0O A;  3ST9 A;  3PZK A;  4RYF H;  3GF3 A;  3TT7 A;  4IZB A;  2FBM A;  4I42 A;  2Q2X A;  5ING A;  4MOU A;  4OLQ A;  2J5G A;  5E0N X;  3GLM A;  5E0S H;  4ELW A;  4EMM A;  5DZK H;  4FN7 A;  2CBY A;  4U0G H;  1K32 A;  1FCF A;  1UIY A;  1N6E A;  4L6W A;  3QYR A;  2Q35 A;  5G1R A;  2DUB A;  3T88 A;  3VIV A;  3HLN 1;  3BF0 A;  3KTK A;  3ZWB A;  3R9T A;  4Q0G A;  5KJP A;  4B3H A;  2ZL3 A;  3LKE A;  5JBX A;  1EF9 A;  5FUS A;  3GKB A;  3LAO A;  2PG8 A;  5DU6 A;  3Q7H A;  3KTJ A;  4FND A;  2VRE A;  4G2R A;  2ZL0 A;  1DCI A;  4QIJ A;  1N6F A;  4ZDD A;  2QQ3 A;  1O8U A;  1XO6 A;  1NZY B;  1OD2 A;  3H0U A;  3TVU A;  3MFM A;  5IKL B;  4WCZ A;  2NP9 A;  1TYF A;  2PPY A;  3QXZ A;  4IZD A;  1MJ3 A;  3T8A A;  3L3S A;  3IB9 A;  2CE3 A;  3V5E A;  3U9S B;  2ZQR A;  4I52 A;  1OD4 A;  1RJN A;  3MYB A;  3MT6 A;  1WDL A;  1UYT A;  2F6Q A;  1XNY A;  2F9I B;  2VSU E;  2VSS E;  4JCQ A;  3IAV A;  3M6N A;  4FB8 A;  4YLH A;  2VSU C;  4B3J A;  3HRX A;  4ZDF A;  2J5I I;  2UZF A;  2BZR A;  1PJH A;  4F47 A;  3MOY A;  1HZD A;  4ZU2 A;  3ISA A;  3KTH A;  4U0G A;  4K3W A;  3QKA A;  1FC6 A;  2F9Y A;  4Z0M A;  4KNP A;  2X24 A;  1JXZ A;  4FN8 A;  4HC8 A;  3RSI A;  3ZW8 A;  4KPK A;  5C9G A;  3H0S A;  1WDK A;  1XNW A;  4MI2 A;  4HNK A;  3FF6 A;  1YG8 A;  1XX4 A;  5DU8 A;  3K50 A;  4QII A;  4ASI A;  1EF8 A;  1WZ8 A;  2WTB A;  3H81 A;  4U0H A;  5DTW A;  2A7K A;  1UYS A;  1NZY A;  1FC7 A;  3P5M A;  3TT6 A;  4U18 A;  4ELS A;  2X58 A;  5INI A;  4ZDC A;  4U19 A;  5E0S A;  2C8T A;  2ZL2 A;  2F6I A;  1WDM A;  2J5S A;  2VSU F;  3OT6 A;  2D3T A;  1SG4 A;  2VSS A;  3Q0J A;  2J5I B;  3NJB A;  3T3W A;  4ZDE A;  2F9Y B;  1HNO A;  4FNB A;  2FW2 A;  3QRE A;  2ZL4 A;  4JFC A;  4EMP A;  4JVT A;  4KD6 A;  2FZS A;  4U1A A;  3Q1T A;  4JCT A;  1YG6 A;  3PE8 A;  5DTP A;  4RCN A;  3DJA A;  3FDU A;  3Q0G A;  3HP0 A;  4EML A;  4JWV A;  4FZW A;  4JSB A;  4JJT A;  1X0U A;  4WYO B;  3H02 A;  3PGQ A;  5G1S A;  3T8B A; 
#chains in the Genus database with same CATH topology
 5DUF A;  2VX2 A;  1FC9 A;  2HW5 A;  4Q1I A;  1HNU A;  1K39 A;  1XNV A;  1SZO A;  2VSS F;  4JCS A;  3TRR A;  3OC7 A;  1Y7O A;  4QFE A;  2IEX A;  4GHN A;  5CTB A;  3I47 A;  3PEA A;  3M6M A;  4JOT A;  3NJD A;  2J5I A;  5JBW A;  3WG5 A;  5INF A;  3R6H A;  1RJM A;  4NEK A;  3KTG A;  2EJ5 A;  3JU1 A;  5FIF A;  3TDC A;  4LK5 A;  4K2N A;  2J5G D;  3R9Q A;  4JYJ A;  3QXI A;  1ON9 A;  3P85 A;  2ZQQ A;  1DUB A;  3U9R B;  1UYR A;  1PIX A;  3KTI A;  3QK8 A;  4WZ8 B;  3BPP A;  5DU4 A;  3HE2 A;  3TV5 A;  5DL1 A;  4I4Z A;  3ZWC A;  4B3I A;  5CTC A;  3GMA A;  3RRV A;  2PBP A;  5KDR A;  3DOR A;  3P2L A;  1ON3 A;  2DEO A;  3HIN A;  4JCR A;  2GTR A;  1J7X A;  3STA A;  3R9S A;  1Q52 A;  3ZW9 A;  4OG1 A;  3H0J A;  5G1Q A;  2W3P A;  2F9I A;  4ELX A;  4L8K A;  4DI1 A;  4RYF A;  2A7S A;  3G64 A;  4NNQ A;  1VRG A;  1N6D A;  3H0Q A;  4FJW D;  3N6R B;  5KDR B;  4FZW C;  2Q34 A;  2VSU A;  1TG6 A;  3TVW A;  4IZC A;  3V5I A;  3QWD A;  3T89 A;  4K29 A;  3BEZ A;  3TZ3 A;  4ZDB A;  5C90 A;  3KQF A;  4JYL A;  1W2X A;  4MXI A;  3GF7 A;  4GM2 A;  1Q51 A;  3TLF A;  3OME A;  5DUC A;  3SLL A;  4KWB A;  1EY3 A;  5MGB A;  2A81 A;  5DZK A;  3ZWA A;  3SWX A;  3IBB A;  3QMJ A;  5HUQ A;  3RST A;  3U9T B;  1UYV A;  3K8X A;  5DKP A;  4OMR A;  3R0O A;  3ST9 A;  3PZK A;  4RYF H;  3GF3 A;  3TT7 A;  4IZB A;  2FBM A;  4I42 A;  2Q2X A;  4MOU A;  5ING A;  4OLQ A;  2J5G A;  5E0N X;  3GLM A;  5E0S H;  4ELW A;  4EMM A;  5DZK H;  4FN7 A;  2CBY A;  4U0G H;  1K32 A;  1FCF A;  4HDT A;  1UIY A;  1N6E A;  4L6W A;  3QYR A;  2Q35 A;  5G1R A;  2DUB A;  3T88 A;  3VIV A;  3HLN 1;  3BF0 A;  3KTK A;  3ZWB A;  3R9T A;  4Q0G A;  5KJP A;  4B3H A;  2ZL3 A;  3LKE A;  5JBX A;  1EF9 A;  5FUS A;  3GKB A;  3LAO A;  2PG8 A;  5DU6 A;  3Q7H A;  3KTJ A;  4FND A;  2VRE A;  4G2R A;  2ZL0 A;  1DCI A;  4QIJ A;  1N6F A;  4ZDD A;  2QQ3 A;  4J2U A;  1O8U A;  3BPT A;  1XO6 A;  1NZY B;  1OD2 A;  3H0U A;  4NAR A;  3TVU A;  3MFM A;  5IKL B;  4WCZ A;  2NP9 A;  1TYF A;  2PPY A;  3QXZ A;  4IZD A;  1MJ3 A;  3T8A A;  3L3S A;  3IB9 A;  2CE3 A;  3V5E A;  3U9S B;  2ZQR A;  4I52 A;  1OD4 A;  1RJN A;  3MYB A;  3MT6 A;  1WDL A;  1UYT A;  2F6Q A;  1XNY A;  2F9I B;  2VSU E;  2VSS E;  4JCQ A;  3IAV A;  3M6N A;  4FB8 A;  4YLH A;  2VSU C;  4B3J A;  3HRX A;  4ZDF A;  2J5I I;  2UZF A;  2BZR A;  1PJH A;  4F47 A;  3MOY A;  1HZD A;  4ZU2 A;  3ISA A;  3KTH A;  4U0G A;  4K3W A;  3QKA A;  1FC6 A;  2F9Y A;  4Z0M A;  4KNP A;  2X24 A;  1JXZ A;  4FN8 A;  4HC8 A;  3RSI A;  3ZW8 A;  4KPK A;  5C9G A;  3H0S A;  1WDK A;  1XNW A;  4MI2 A;  4HNK A;  3FF6 A;  1YG8 A;  1XX4 A;  5DU8 A;  3K50 A;  4QII A;  4ASI A;  1EF8 A;  1WZ8 A;  2WTB A;  3H81 A;  4U0H A;  5DTW A;  2A7K A;  1UYS A;  1NZY A;  1FC7 A;  3P5M A;  3TT6 A;  4U18 A;  4ELS A;  2X58 A;  5INI A;  4ZDC A;  4U19 A;  5E0S A;  2C8T A;  2ZL2 A;  2F6I A;  1WDM A;  2J5S A;  2VSU F;  3OT6 A;  2D3T A;  1SG4 A;  2VSS A;  3Q0J A;  2J5I B;  3NJB A;  3T3W A;  4ZDE A;  2F9Y B;  1HNO A;  4FNB A;  2FW2 A;  3QRE A;  2ZL4 A;  4JFC A;  4EMP A;  4JVT A;  2YJG A;  4KD6 A;  2FZS A;  4U1A A;  3Q1T A;  4JCT A;  1YG6 A;  3PE8 A;  5DTP A;  4RCN A;  3DJA A;  3FDU A;  3Q0G A;  3HP0 A;  4EML A;  4JWV A;  4FZW A;  4JSB A;  4JJT A;  1X0U A;  4WYO B;  3H02 A;  3PGQ A;  5G1S A;  3T8B A; 
#chains in the Genus database with same CATH homology
 5DUF A;  2VX2 A;  1FC9 A;  2HW5 A;  4Q1I A;  1HNU A;  1K39 A;  1XNV A;  1SZO A;  2VSS F;  4JCS A;  3TRR A;  3OC7 A;  1Y7O A;  4QFE A;  2IEX A;  4GHN A;  5CTB A;  3I47 A;  3PEA A;  3M6M A;  4JOT A;  3NJD A;  2J5I A;  5JBW A;  3WG5 A;  5INF A;  3R6H A;  1RJM A;  4NEK A;  3KTG A;  2EJ5 A;  3JU1 A;  5FIF A;  3TDC A;  4LK5 A;  4K2N A;  2J5G D;  3R9Q A;  4JYJ A;  3QXI A;  1ON9 A;  3P85 A;  2ZQQ A;  1DUB A;  3U9R B;  1UYR A;  1PIX A;  3KTI A;  3QK8 A;  4WZ8 B;  3BPP A;  5DU4 A;  3HE2 A;  3TV5 A;  5DL1 A;  4I4Z A;  3ZWC A;  4B3I A;  5CTC A;  3GMA A;  3RRV A;  2PBP A;  5KDR A;  3DOR A;  3P2L A;  1ON3 A;  2DEO A;  3HIN A;  4JCR A;  2GTR A;  1J7X A;  3STA A;  3R9S A;  1Q52 A;  3ZW9 A;  4OG1 A;  3H0J A;  5G1Q A;  2W3P A;  2F9I A;  4ELX A;  4L8K A;  4DI1 A;  4RYF A;  2A7S A;  3G64 A;  4NNQ A;  1VRG A;  1N6D A;  3H0Q A;  4FJW D;  3N6R B;  5KDR B;  4FZW C;  2Q34 A;  2VSU A;  1TG6 A;  3TVW A;  4IZC A;  3V5I A;  3QWD A;  3T89 A;  4K29 A;  3BEZ A;  3TZ3 A;  4ZDB A;  5C90 A;  3KQF A;  4JYL A;  1W2X A;  4MXI A;  3GF7 A;  4GM2 A;  1Q51 A;  3TLF A;  3OME A;  5DUC A;  3SLL A;  4KWB A;  1EY3 A;  5MGB A;  2A81 A;  5DZK A;  3ZWA A;  3SWX A;  3IBB A;  3QMJ A;  5HUQ A;  3RST A;  3U9T B;  1UYV A;  3K8X A;  5DKP A;  4OMR A;  3R0O A;  3ST9 A;  3PZK A;  4RYF H;  3GF3 A;  3TT7 A;  4IZB A;  2FBM A;  4I42 A;  2Q2X A;  4MOU A;  5ING A;  4OLQ A;  2J5G A;  5E0N X;  3GLM A;  5E0S H;  4ELW A;  4EMM A;  5DZK H;  4FN7 A;  2CBY A;  4U0G H;  1K32 A;  1FCF A;  4HDT A;  1UIY A;  1N6E A;  4L6W A;  3QYR A;  2Q35 A;  5G1R A;  2DUB A;  3T88 A;  3VIV A;  3HLN 1;  3BF0 A;  3KTK A;  3ZWB A;  3R9T A;  4Q0G A;  5KJP A;  4B3H A;  2ZL3 A;  3LKE A;  5JBX A;  1EF9 A;  5FUS A;  3GKB A;  3LAO A;  2PG8 A;  5DU6 A;  3Q7H A;  3KTJ A;  4FND A;  2VRE A;  4G2R A;  2ZL0 A;  1DCI A;  4QIJ A;  1N6F A;  4ZDD A;  2QQ3 A;  4J2U A;  1O8U A;  3BPT A;  1XO6 A;  1NZY B;  1OD2 A;  3H0U A;  4NAR A;  3TVU A;  3MFM A;  5IKL B;  4WCZ A;  2NP9 A;  1TYF A;  2PPY A;  3QXZ A;  4IZD A;  1MJ3 A;  3T8A A;  3L3S A;  3IB9 A;  2CE3 A;  3V5E A;  3U9S B;  2ZQR A;  4I52 A;  1OD4 A;  1RJN A;  3MYB A;  3MT6 A;  1WDL A;  1UYT A;  2F6Q A;  1XNY A;  2F9I B;  2VSU E;  2VSS E;  4JCQ A;  3IAV A;  3M6N A;  4FB8 A;  4YLH A;  2VSU C;  4B3J A;  3HRX A;  4ZDF A;  2J5I I;  2UZF A;  2BZR A;  1PJH A;  4F47 A;  3MOY A;  1HZD A;  4ZU2 A;  3ISA A;  3KTH A;  4U0G A;  4K3W A;  3QKA A;  1FC6 A;  2F9Y A;  4Z0M A;  4KNP A;  2X24 A;  1JXZ A;  4FN8 A;  4HC8 A;  3RSI A;  3ZW8 A;  4KPK A;  5C9G A;  3H0S A;  1WDK A;  1XNW A;  4MI2 A;  4HNK A;  3FF6 A;  1YG8 A;  1XX4 A;  5DU8 A;  3K50 A;  4QII A;  4ASI A;  1EF8 A;  1WZ8 A;  2WTB A;  3H81 A;  4U0H A;  5DTW A;  2A7K A;  1UYS A;  1NZY A;  1FC7 A;  3P5M A;  3TT6 A;  4U18 A;  4ELS A;  2X58 A;  5INI A;  4ZDC A;  4U19 A;  5E0S A;  2C8T A;  2ZL2 A;  2F6I A;  1WDM A;  2J5S A;  2VSU F;  3OT6 A;  2D3T A;  1SG4 A;  2VSS A;  3Q0J A;  2J5I B;  3NJB A;  3T3W A;  4ZDE A;  2F9Y B;  1HNO A;  4FNB A;  2FW2 A;  3QRE A;  2ZL4 A;  4JFC A;  4EMP A;  4JVT A;  2YJG A;  4KD6 A;  2FZS A;  4U1A A;  3Q1T A;  4JCT A;  1YG6 A;  3PE8 A;  5DTP A;  4RCN A;  3DJA A;  3FDU A;  3Q0G A;  3HP0 A;  4EML A;  4JWV A;  4FZW A;  4JSB A;  4JJT A;  1X0U A;  4WYO B;  3H02 A;  3PGQ A;  5G1S A;  3T8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...