1VRGA

Crystal structure of propionyl-coa carboxylase, beta subunit (tm0716) from thermotoga maritima at 2.30 a resolution
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
515
structure length
515
Chain Sequence
b'MSLRDKIEELKKIEKEIEQGGGPEKVEKQHRAGKLTAWERLELLLDPGTFVEIDKFVEHRNTYFGLDKVKLPRDGVITGVGEINGRKVAVFSQDFTVMGGSLGEMHAKKIVKLLDLALKMGIPVIGINDSGGARIQEGVDALAGYGEIFLRNTLASGVVPQITVIAGPCAGGAVYSPALTDFIVMVDQTARMFITGPNVIKAVTGEEISQEDLGGAMVHNQKSGNAHFLADNDEKAMSLVRTLLSYLPSNNAEEPPVEDPDTSLETPEDILDILPDNPNKGYDVRDVIKRVVDHGEFFEVQPYFAKNIVIGFARIQGKTVGIVANQPSVLAGVLDIDSSDKAARFIRFLDAFNIPILTFVDTPGYLPGVAQEHGGIIRHGAKLLYAYSEATVPKITVILRKAYGGAYIAMGSKHLGADMVLAWPSAEIAVMGPEGAANIIFKREIEASSNPEETRRKLIEEYKQQFANPYIAASRGYVDMVIDPRETRKYIMRALEVCETKVEYRPKKKHGNIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords propionyl-CoA carboxylase, beta subunit
publication title Crystal structure of propionyl-CoA carboxylase, beta subunit (TM0716) from THERMOTOGA MARITIMA at 2.30 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Ligase
total genus 181
structure length 515
sequence length 515
chains with identical sequence B, C, D, E, F
ec nomenclature ec 6.4.1.2: Acetyl-CoA carboxylase.
pdb deposition date 2005-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01039 Carboxyl_trans Carboxyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1vrgA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1vrgA01
1NZYB 3DJAA 2VSUC 1X0UA 4Z0MA 2ZQQA 4WZ8B 3KTGA 3R9SA 4QIJA 3GLMA 3ZW9A 3P85A 5DU6A 1HNUA 4JSBA 3T89A 3GKBA 4ELXA 5G1QA 1XX4A 4YLHA 2J5SA 1YG6A 3TDCA 3I47A 3Q7HA 4Q1IA 3K8XA 5CTBA 2X58A 4QIIA 3T8AA 3K50A 4JCRA 2WTBA 1FC9A 4FNBA 3N6RB 3PEAA 4U0HA 4FN8A 2ZQRA 1Y7OA 4I52A 4MOUA 3QREA 1Q51A 4FZWA 2IEXA 3Q0JA 3PE8A 3LAOA 3H0UA 3H02A 3QWDA 3H0JA 4QFEA 3RSIA 5INIA 1DCIA 3PZKA 4F47A 4U18A 1EF9A 2W3PA 3U9TB 4I4ZA 3KQFA 4IZCA 3KTIA 3R9QA 5E0SH 1UIYA 1W2XA 3T8BA 2F9YB 2ZL3A 5INFA 4U0GH 4FNDA 3Q0GA 3HRXA 3RSTA 2NP9A 3BPPA 1EY3A 3HE2A 3GMAA 3ZWAA 5DZKH 1HZDA 3STAA 1Q52A 4B3IA 5G1RA 5KDRB 5JBXA 4NEKA 2ZL0A 3MT6A 1SG4A 2EJ5A 2CE3A 5DUCA 2F9IB 4ASIA 3U9SB 2VREA 3T3WA 1N6EA 3TVWA 2X24A 3HLN1 3OC7A 3V5IA 1UYVA 1TYFA 2ZL4A 5DKPA 3TZ3A 1UYSA 4JVTA 2PG8A 4Q0GA 4IZDA 4MXIA 3P2LA 3M6MA 4RYFA 4FJWD 2J5IA 3V5EA 3BF0A 3KTKA 3H0SA 4U1AA 4ZDDA 5DUFA 3PGQA 4OLQA 1JXZA 4WYOB 4GHNA 5C9GA 1XO6A 3NJDA 4ELWA 3IAVA 3TVUA 1PJHA 3QYRA 3R9TA 2PBPA 4RCNA 2DUBA 3MFMA 4JYJA 4L8KA 4OMRA 5CTCA 4JCSA 4IZBA 1WZ8A 1XNYA 4K3WA 4MI2A 4LK5A 1XNWA 1WDMA 1EF8A 3LKEA 4JYLA 5E0NX 3TV5A 1ON3A 4JCQA 3SLLA 3OT6A 5DL1A 2VSUF 4JJTA 3Q1TA 4FZWC 3ZWCA 2J5GD 1N6DA 4G2RA 1OD4A 4ZDCA 4DI1A 1FCFA 3ZWBA 3QXIA 3MYBA 1FC6A 4FN7A 3MOYA 1PIXA 3ZW8A 2Q35A 2UZFA 3L3SA 3T88A 3HP0A 1J7XA 3H0QA 3U9RB 4I42A 2J5GA 2HW5A 4B3JA 5DU8A 5FUSA 4GM2A 4OG1A 4WCZA 2FZSA 3G64A 3R6HA 1O8UA 4JFCA 3ISAA 1K39A 2VSUA 4NNQA 3QMJA 2ZL2A 3OMEA 2VSSA 2F6IA 5MGBA 3FDUA 1NZYA 3DORA 5IKLB 4ZU2A 1FC7A 3IBBA 5C90A 2FBMA 4JCTA 4ZDEA 1N6FA 2C8TA 3M6NA 4EMMA 3GF7A 4U19A 3SWXA 1K32A 2A7SA 3H81A 2Q34A 5E0SA 4KWBA 3QKAA 4B3HA 3IB9A 2CBYA 3JU1A 4U0GA 4ZDBA 2DEOA 5DTWA 2J5IB 3BEZA 4FB8A 2A81A 1SZOA 5DZKA 5INGA 4EMPA 5FIFA 1UYTA 1VRGA 3HINA 4L6WA 1XNVA 4EMLA 1YG8A 3RRVA 2VSUE 3R0OA 2VSSE 2J5II 3TT6A 5DU4A 3TLFA 2D3TA 4KPKA 3QK8A 4JOTA 1OD2A 1WDKA 2VX2A 2VSSF 4HC8A 4KD6A 1MJ3A 2GTRA 1HNOA 2QQ3A 2F6QA 5KJPA 3GF3A 2F9YA 5JBWA 3TRRA 4ELSA 3NJBA 4RYFH 3P5MA 3ST9A 2PPYA 3WG5A 3FF6A 3TT7A 2A7KA 1UYRA 5KDRA 4K2NA 5G1SA 3KTJA 3QXZA 3KTHA 2BZRA 2Q2XA 2F9IA 5DTPA 4KNPA 1DUBA 4JWVA 1ON9A 3VIVA 1RJNA 4K29A 2FW2A 1RJMA 4HNKA 1TG6A 1WDLA 4ZDFA
chains in the Genus database with same CATH superfamily
1NZYB 3DJAA 2VSUC 1X0UA 4HDTA 4Z0MA 2ZQQA 4WZ8B 3KTGA 3R9SA 4QIJA 3GLMA 3ZW9A 3P85A 5DU6A 1HNUA 4JSBA 3T89A 3GKBA 4ELXA 5G1QA 1XX4A 4YLHA 2J5SA 1YG6A 3TDCA 3I47A 3Q7HA 4Q1IA 3K8XA 5CTBA 2X58A 4QIIA 3T8AA 3K50A 4JCRA 2WTBA 1FC9A 4FNBA 3N6RB 3PEAA 4U0HA 4FN8A 4J2UA 2ZQRA 1Y7OA 4I52A 4MOUA 3QREA 1Q51A 4FZWA 2IEXA 3Q0JA 3PE8A 3LAOA 3H0UA 3H02A 3QWDA 3H0JA 4QFEA 3RSIA 5INIA 1DCIA 3PZKA 4F47A 4U18A 1EF9A 2W3PA 3U9TB 4I4ZA 3KQFA 4IZCA 3KTIA 3R9QA 5E0SH 1UIYA 1W2XA 3T8BA 2F9YB 2ZL3A 5INFA 4U0GH 4FNDA 3Q0GA 3HRXA 3RSTA 2NP9A 3BPPA 1EY3A 3HE2A 3GMAA 3ZWAA 5DZKH 1HZDA 3STAA 1Q52A 4B3IA 5G1RA 5KDRB 5JBXA 4NEKA 2ZL0A 3MT6A 1SG4A 2EJ5A 2CE3A 5DUCA 2F9IB 4ASIA 3U9SB 2VREA 3T3WA 1N6EA 3TVWA 2X24A 3HLN1 3OC7A 3BPTA 3V5IA 1UYVA 1TYFA 2ZL4A 5DKPA 3TZ3A 1UYSA 4JVTA 2PG8A 4Q0GA 4IZDA 4MXIA 3P2LA 3M6MA 4RYFA 4FJWD 2J5IA 3V5EA 3BF0A 3KTKA 3H0SA 4U1AA 4ZDDA 5DUFA 3PGQA 4OLQA 1JXZA 4WYOB 4GHNA 5C9GA 1XO6A 3NJDA 4ELWA 3IAVA 3TVUA 1PJHA 3QYRA 3R9TA 2PBPA 4RCNA 2DUBA 3MFMA 4JYJA 4L8KA 4OMRA 5CTCA 4JCSA 4IZBA 1WZ8A 1XNYA 4K3WA 4MI2A 4LK5A 1XNWA 1WDMA 1EF8A 3LKEA 4JYLA 5E0NX 3TV5A 1ON3A 4JCQA 3SLLA 3OT6A 5DL1A 2VSUF 4JJTA 3Q1TA 4FZWC 3ZWCA 2J5GD 1N6DA 4G2RA 1OD4A 4ZDCA 4DI1A 1FCFA 3ZWBA 3QXIA 3MYBA 1FC6A 4FN7A 3MOYA 1PIXA 3ZW8A 2Q35A 2UZFA 3L3SA 3T88A 3HP0A 1J7XA 4NARA 3H0QA 3U9RB 4I42A 2J5GA 2HW5A 4B3JA 5DU8A 5FUSA 4GM2A 4OG1A 4WCZA 2FZSA 3G64A 3R6HA 1O8UA 4JFCA 3ISAA 1K39A 2VSUA 4NNQA 3QMJA 2ZL2A 3OMEA 2VSSA 2F6IA 5MGBA 3FDUA 1NZYA 5HUQA 3DORA 5IKLB 4ZU2A 1FC7A 3IBBA 5C90A 2FBMA 4JCTA 4ZDEA 1N6FA 2C8TA 3M6NA 4EMMA 3GF7A 4U19A 3SWXA 1K32A 2A7SA 3H81A 2Q34A 5E0SA 4KWBA 3QKAA 4B3HA 3IB9A 2CBYA 3JU1A 4U0GA 4ZDBA 2DEOA 5DTWA 2J5IB 3BEZA 4FB8A 2A81A 1SZOA 2YJGA 5DZKA 5INGA 4EMPA 5FIFA 1UYTA 1VRGA 3HINA 4L6WA 1XNVA 4EMLA 1YG8A 3RRVA 2VSUE 3R0OA 2VSSE 2J5II 3TT6A 5DU4A 3TLFA 2D3TA 4KPKA 3QK8A 4JOTA 1OD2A 1WDKA 2VX2A 2VSSF 4HC8A 4KD6A 1MJ3A 2GTRA 1HNOA 2QQ3A 2F6QA 5KJPA 3GF3A 2F9YA 5JBWA 3TRRA 4ELSA 3NJBA 4RYFH 3P5MA 3ST9A 2PPYA 3WG5A 3FF6A 3TT7A 2A7KA 1UYRA 5KDRA 4K2NA 5G1SA 3KTJA 3QXZA 3KTHA 2BZRA 2Q2XA 2F9IA 5DTPA 4KNPA 1DUBA 4JWVA 1ON9A 3VIVA 1RJNA 4K29A 2FW2A 1RJMA 4HNKA 1TG6A 1WDLA 4ZDFA
chains in the Genus database with same CATH topology
1NZYB 3DJAA 2VSUC 1X0UA 4HDTA 4Z0MA 2ZQQA 4WZ8B 3KTGA 3R9SA 4QIJA 3GLMA 3ZW9A 3P85A 5DU6A 1HNUA 4JSBA 3T89A 3GKBA 4ELXA 5G1QA 1XX4A 4YLHA 2J5SA 1YG6A 3TDCA 3I47A 3Q7HA 4Q1IA 3K8XA 5CTBA 2X58A 4QIIA 3T8AA 3K50A 4JCRA 2WTBA 1FC9A 4FNBA 3N6RB 3PEAA 4U0HA 4FN8A 4J2UA 2ZQRA 1Y7OA 4I52A 4MOUA 3QREA 1Q51A 4FZWA 2IEXA 3Q0JA 3PE8A 3LAOA 3H0UA 3H02A 3QWDA 3H0JA 4QFEA 3RSIA 5INIA 1DCIA 3PZKA 4F47A 4U18A 1EF9A 2W3PA 3U9TB 4I4ZA 3KQFA 4IZCA 3KTIA 3R9QA 5E0SH 1UIYA 1W2XA 3T8BA 2F9YB 2ZL3A 5INFA 4U0GH 4FNDA 3Q0GA 3HRXA 3RSTA 2NP9A 3BPPA 1EY3A 3HE2A 3GMAA 3ZWAA 5DZKH 1HZDA 3STAA 1Q52A 4B3IA 5G1RA 5KDRB 5JBXA 4NEKA 2ZL0A 3MT6A 1SG4A 2EJ5A 2CE3A 5DUCA 2F9IB 4ASIA 3U9SB 2VREA 3T3WA 1N6EA 3TVWA 2X24A 3HLN1 3OC7A 3BPTA 3V5IA 1UYVA 1TYFA 2ZL4A 5DKPA 3TZ3A 1UYSA 4JVTA 2PG8A 4Q0GA 4IZDA 4MXIA 3P2LA 3M6MA 4RYFA 4FJWD 2J5IA 3V5EA 3BF0A 3KTKA 3H0SA 4U1AA 4ZDDA 5DUFA 3PGQA 4OLQA 1JXZA 4WYOB 4GHNA 5C9GA 1XO6A 3NJDA 4ELWA 3IAVA 3TVUA 1PJHA 3QYRA 3R9TA 2PBPA 4RCNA 2DUBA 3MFMA 4JYJA 4L8KA 4OMRA 5CTCA 4JCSA 4IZBA 1WZ8A 1XNYA 4K3WA 4MI2A 4LK5A 1XNWA 1WDMA 1EF8A 3LKEA 4JYLA 5E0NX 3TV5A 1ON3A 4JCQA 3SLLA 3OT6A 5DL1A 2VSUF 4JJTA 3Q1TA 4FZWC 3ZWCA 2J5GD 1N6DA 4G2RA 1OD4A 4ZDCA 4DI1A 1FCFA 3ZWBA 3QXIA 3MYBA 1FC6A 4FN7A 3MOYA 1PIXA 3ZW8A 2Q35A 2UZFA 3L3SA 3T88A 3HP0A 1J7XA 4NARA 3H0QA 3U9RB 4I42A 2J5GA 2HW5A 4B3JA 5DU8A 5FUSA 4GM2A 4OG1A 4WCZA 2FZSA 3G64A 3R6HA 1O8UA 4JFCA 3ISAA 1K39A 2VSUA 4NNQA 3QMJA 2ZL2A 3OMEA 2VSSA 2F6IA 5MGBA 3FDUA 1NZYA 5HUQA 3DORA 5IKLB 4ZU2A 1FC7A 3IBBA 5C90A 2FBMA 4JCTA 4ZDEA 1N6FA 2C8TA 3M6NA 4EMMA 3GF7A 4U19A 3SWXA 1K32A 2A7SA 3H81A 2Q34A 5E0SA 4KWBA 3QKAA 4B3HA 3IB9A 2CBYA 3JU1A 4U0GA 4ZDBA 2DEOA 5DTWA 2J5IB 3BEZA 4FB8A 2A81A 1SZOA 2YJGA 5DZKA 5INGA 4EMPA 5FIFA 1UYTA 1VRGA 3HINA 4L6WA 1XNVA 4EMLA 1YG8A 3RRVA 2VSUE 3R0OA 2VSSE 2J5II 3TT6A 5DU4A 3TLFA 2D3TA 4KPKA 3QK8A 4JOTA 1OD2A 1WDKA 2VX2A 2VSSF 4HC8A 4KD6A 1MJ3A 2GTRA 1HNOA 2QQ3A 2F6QA 5KJPA 3GF3A 2F9YA 5JBWA 3TRRA 4ELSA 3NJBA 4RYFH 3P5MA 3ST9A 2PPYA 3WG5A 3FF6A 3TT7A 2A7KA 1UYRA 5KDRA 4K2NA 5G1SA 3KTJA 3QXZA 3KTHA 2BZRA 2Q2XA 2F9IA 5DTPA 4KNPA 1DUBA 4JWVA 1ON9A 3VIVA 1RJNA 4K29A 2FW2A 1RJMA 4HNKA 1TG6A 1WDLA 4ZDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZY B;  3DJA A;  2VSU C;  1X0U A;  4Z0M A;  2ZQQ A;  4WZ8 B;  3KTG A;  3R9S A;  4QIJ A;  3GLM A;  3ZW9 A;  3P85 A;  5DU6 A;  1HNU A;  4JSB A;  3T89 A;  3GKB A;  4ELX A;  5G1Q A;  1XX4 A;  4YLH A;  2J5S A;  1YG6 A;  3TDC A;  3I47 A;  3Q7H A;  4Q1I A;  3K8X A;  5CTB A;  2X58 A;  4QII A;  3T8A A;  3K50 A;  4JCR A;  2WTB A;  1FC9 A;  4FNB A;  3N6R B;  3PEA A;  4U0H A;  4FN8 A;  2ZQR A;  1Y7O A;  4I52 A;  4MOU A;  3QRE A;  1Q51 A;  4FZW A;  2IEX A;  3Q0J A;  3PE8 A;  3LAO A;  3H0U A;  3H02 A;  3QWD A;  3H0J A;  4QFE A;  3RSI A;  5INI A;  1DCI A;  3PZK A;  4F47 A;  4U18 A;  1EF9 A;  2W3P A;  3U9T B;  4I4Z A;  3KQF A;  4IZC A;  3KTI A;  3R9Q A;  5E0S H;  1UIY A;  1W2X A;  3T8B A;  2F9Y B;  2ZL3 A;  5INF A;  4U0G H;  4FND A;  3Q0G A;  3HRX A;  3RST A;  2NP9 A;  3BPP A;  1EY3 A;  3HE2 A;  3GMA A;  3ZWA A;  5DZK H;  1HZD A;  3STA A;  1Q52 A;  4B3I A;  5G1R A;  5KDR B;  5JBX A;  4NEK A;  2ZL0 A;  3MT6 A;  1SG4 A;  2EJ5 A;  2CE3 A;  5DUC A;  2F9I B;  4ASI A;  3U9S B;  2VRE A;  3T3W A;  1N6E A;  3TVW A;  2X24 A;  3HLN 1;  3OC7 A;  3V5I A;  1UYV A;  1TYF A;  2ZL4 A;  5DKP A;  3TZ3 A;  1UYS A;  4JVT A;  2PG8 A;  4Q0G A;  4IZD A;  4MXI A;  3P2L A;  3M6M A;  4RYF A;  4FJW D;  2J5I A;  3V5E A;  3BF0 A;  3KTK A;  3H0S A;  4U1A A;  4ZDD A;  5DUF A;  3PGQ A;  4OLQ A;  1JXZ A;  4WYO B;  4GHN A;  5C9G A;  1XO6 A;  3NJD A;  4ELW A;  3IAV A;  3TVU A;  1PJH A;  3QYR A;  3R9T A;  2PBP A;  4RCN A;  2DUB A;  3MFM A;  4JYJ A;  4L8K A;  4OMR A;  5CTC A;  4JCS A;  4IZB A;  1WZ8 A;  1XNY A;  4K3W A;  4MI2 A;  4LK5 A;  1XNW A;  1WDM A;  1EF8 A;  3LKE A;  4JYL A;  5E0N X;  3TV5 A;  1ON3 A;  4JCQ A;  3SLL A;  3OT6 A;  5DL1 A;  2VSU F;  4JJT A;  3Q1T A;  4FZW C;  3ZWC A;  2J5G D;  1N6D A;  4G2R A;  1OD4 A;  4ZDC A;  4DI1 A;  1FCF A;  3ZWB A;  3QXI A;  3MYB A;  1FC6 A;  4FN7 A;  3MOY A;  1PIX A;  3ZW8 A;  2Q35 A;  2UZF A;  3L3S A;  3T88 A;  3HP0 A;  1J7X A;  3H0Q A;  3U9R B;  4I42 A;  2J5G A;  2HW5 A;  4B3J A;  5DU8 A;  5FUS A;  4GM2 A;  4OG1 A;  4WCZ A;  2FZS A;  3G64 A;  3R6H A;  1O8U A;  4JFC A;  3ISA A;  1K39 A;  2VSU A;  4NNQ A;  3QMJ A;  2ZL2 A;  3OME A;  2VSS A;  2F6I A;  5MGB A;  3FDU A;  1NZY A;  3DOR A;  5IKL B;  4ZU2 A;  1FC7 A;  3IBB A;  5C90 A;  2FBM A;  4JCT A;  4ZDE A;  1N6F A;  2C8T A;  3M6N A;  4EMM A;  3GF7 A;  4U19 A;  3SWX A;  1K32 A;  2A7S A;  3H81 A;  2Q34 A;  5E0S A;  4KWB A;  3QKA A;  4B3H A;  3IB9 A;  2CBY A;  3JU1 A;  4U0G A;  4ZDB A;  2DEO A;  5DTW A;  2J5I B;  3BEZ A;  4FB8 A;  2A81 A;  1SZO A;  5DZK A;  5ING A;  4EMP A;  5FIF A;  1UYT A;  1VRG A;  3HIN A;  4L6W A;  1XNV A;  4EML A;  1YG8 A;  3RRV A;  2VSU E;  3R0O A;  2VSS E;  2J5I I;  3TT6 A;  5DU4 A;  3TLF A;  2D3T A;  4KPK A;  3QK8 A;  4JOT A;  1OD2 A;  1WDK A;  2VX2 A;  2VSS F;  4HC8 A;  4KD6 A;  1MJ3 A;  2GTR A;  1HNO A;  2QQ3 A;  2F6Q A;  5KJP A;  3GF3 A;  2F9Y A;  5JBW A;  3TRR A;  4ELS A;  3NJB A;  4RYF H;  3P5M A;  3ST9 A;  2PPY A;  3WG5 A;  3FF6 A;  3TT7 A;  2A7K A;  1UYR A;  5KDR A;  4K2N A;  5G1S A;  3KTJ A;  3QXZ A;  3KTH A;  2BZR A;  2Q2X A;  2F9I A;  5DTP A;  4KNP A;  1DUB A;  4JWV A;  1ON9 A;  3VIV A;  1RJN A;  4K29 A;  2FW2 A;  1RJM A;  4HNK A;  1TG6 A;  1WDL A;  4ZDF A; 
#chains in the Genus database with same CATH topology
 1NZY B;  3DJA A;  2VSU C;  1X0U A;  4HDT A;  4Z0M A;  2ZQQ A;  4WZ8 B;  3KTG A;  3R9S A;  4QIJ A;  3GLM A;  3ZW9 A;  3P85 A;  5DU6 A;  1HNU A;  4JSB A;  3T89 A;  3GKB A;  4ELX A;  5G1Q A;  1XX4 A;  4YLH A;  2J5S A;  1YG6 A;  3TDC A;  3I47 A;  3Q7H A;  4Q1I A;  3K8X A;  5CTB A;  2X58 A;  4QII A;  3T8A A;  3K50 A;  4JCR A;  2WTB A;  1FC9 A;  4FNB A;  3N6R B;  3PEA A;  4U0H A;  4FN8 A;  4J2U A;  2ZQR A;  1Y7O A;  4I52 A;  4MOU A;  3QRE A;  1Q51 A;  4FZW A;  2IEX A;  3Q0J A;  3PE8 A;  3LAO A;  3H0U A;  3H02 A;  3QWD A;  3H0J A;  4QFE A;  3RSI A;  5INI A;  1DCI A;  3PZK A;  4F47 A;  4U18 A;  1EF9 A;  2W3P A;  3U9T B;  4I4Z A;  3KQF A;  4IZC A;  3KTI A;  3R9Q A;  5E0S H;  1UIY A;  1W2X A;  3T8B A;  2F9Y B;  2ZL3 A;  5INF A;  4U0G H;  4FND A;  3Q0G A;  3HRX A;  3RST A;  2NP9 A;  3BPP A;  1EY3 A;  3HE2 A;  3GMA A;  3ZWA A;  5DZK H;  1HZD A;  3STA A;  1Q52 A;  4B3I A;  5G1R A;  5KDR B;  5JBX A;  4NEK A;  2ZL0 A;  3MT6 A;  1SG4 A;  2EJ5 A;  2CE3 A;  5DUC A;  2F9I B;  4ASI A;  3U9S B;  2VRE A;  3T3W A;  1N6E A;  3TVW A;  2X24 A;  3HLN 1;  3OC7 A;  3BPT A;  3V5I A;  1UYV A;  1TYF A;  2ZL4 A;  5DKP A;  3TZ3 A;  1UYS A;  4JVT A;  2PG8 A;  4Q0G A;  4IZD A;  4MXI A;  3P2L A;  3M6M A;  4RYF A;  4FJW D;  2J5I A;  3V5E A;  3BF0 A;  3KTK A;  3H0S A;  4U1A A;  4ZDD A;  5DUF A;  3PGQ A;  4OLQ A;  1JXZ A;  4WYO B;  4GHN A;  5C9G A;  1XO6 A;  3NJD A;  4ELW A;  3IAV A;  3TVU A;  1PJH A;  3QYR A;  3R9T A;  2PBP A;  4RCN A;  2DUB A;  3MFM A;  4JYJ A;  4L8K A;  4OMR A;  5CTC A;  4JCS A;  4IZB A;  1WZ8 A;  1XNY A;  4K3W A;  4MI2 A;  4LK5 A;  1XNW A;  1WDM A;  1EF8 A;  3LKE A;  4JYL A;  5E0N X;  3TV5 A;  1ON3 A;  4JCQ A;  3SLL A;  3OT6 A;  5DL1 A;  2VSU F;  4JJT A;  3Q1T A;  4FZW C;  3ZWC A;  2J5G D;  1N6D A;  4G2R A;  1OD4 A;  4ZDC A;  4DI1 A;  1FCF A;  3ZWB A;  3QXI A;  3MYB A;  1FC6 A;  4FN7 A;  3MOY A;  1PIX A;  3ZW8 A;  2Q35 A;  2UZF A;  3L3S A;  3T88 A;  3HP0 A;  1J7X A;  4NAR A;  3H0Q A;  3U9R B;  4I42 A;  2J5G A;  2HW5 A;  4B3J A;  5DU8 A;  5FUS A;  4GM2 A;  4OG1 A;  4WCZ A;  2FZS A;  3G64 A;  3R6H A;  1O8U A;  4JFC A;  3ISA A;  1K39 A;  2VSU A;  4NNQ A;  3QMJ A;  2ZL2 A;  3OME A;  2VSS A;  2F6I A;  5MGB A;  3FDU A;  1NZY A;  5HUQ A;  3DOR A;  5IKL B;  4ZU2 A;  1FC7 A;  3IBB A;  5C90 A;  2FBM A;  4JCT A;  4ZDE A;  1N6F A;  2C8T A;  3M6N A;  4EMM A;  3GF7 A;  4U19 A;  3SWX A;  1K32 A;  2A7S A;  3H81 A;  2Q34 A;  5E0S A;  4KWB A;  3QKA A;  4B3H A;  3IB9 A;  2CBY A;  3JU1 A;  4U0G A;  4ZDB A;  2DEO A;  5DTW A;  2J5I B;  3BEZ A;  4FB8 A;  2A81 A;  1SZO A;  2YJG A;  5DZK A;  5ING A;  4EMP A;  5FIF A;  1UYT A;  1VRG A;  3HIN A;  4L6W A;  1XNV A;  4EML A;  1YG8 A;  3RRV A;  2VSU E;  3R0O A;  2VSS E;  2J5I I;  3TT6 A;  5DU4 A;  3TLF A;  2D3T A;  4KPK A;  3QK8 A;  4JOT A;  1OD2 A;  1WDK A;  2VX2 A;  2VSS F;  4HC8 A;  4KD6 A;  1MJ3 A;  2GTR A;  1HNO A;  2QQ3 A;  2F6Q A;  5KJP A;  3GF3 A;  2F9Y A;  5JBW A;  3TRR A;  4ELS A;  3NJB A;  4RYF H;  3P5M A;  3ST9 A;  2PPY A;  3WG5 A;  3FF6 A;  3TT7 A;  2A7K A;  1UYR A;  5KDR A;  4K2N A;  5G1S A;  3KTJ A;  3QXZ A;  3KTH A;  2BZR A;  2Q2X A;  2F9I A;  5DTP A;  4KNP A;  1DUB A;  4JWV A;  1ON9 A;  3VIV A;  1RJN A;  4K29 A;  2FW2 A;  1RJM A;  4HNK A;  1TG6 A;  1WDL A;  4ZDF A; 
#chains in the Genus database with same CATH homology
 1NZY B;  3DJA A;  2VSU C;  1X0U A;  4HDT A;  4Z0M A;  2ZQQ A;  4WZ8 B;  3KTG A;  3R9S A;  4QIJ A;  3GLM A;  3ZW9 A;  3P85 A;  5DU6 A;  1HNU A;  4JSB A;  3T89 A;  3GKB A;  4ELX A;  5G1Q A;  1XX4 A;  4YLH A;  2J5S A;  1YG6 A;  3TDC A;  3I47 A;  3Q7H A;  4Q1I A;  3K8X A;  5CTB A;  2X58 A;  4QII A;  3T8A A;  3K50 A;  4JCR A;  2WTB A;  1FC9 A;  4FNB A;  3N6R B;  3PEA A;  4U0H A;  4FN8 A;  4J2U A;  2ZQR A;  1Y7O A;  4I52 A;  4MOU A;  3QRE A;  1Q51 A;  4FZW A;  2IEX A;  3Q0J A;  3PE8 A;  3LAO A;  3H0U A;  3H02 A;  3QWD A;  3H0J A;  4QFE A;  3RSI A;  5INI A;  1DCI A;  3PZK A;  4F47 A;  4U18 A;  1EF9 A;  2W3P A;  3U9T B;  4I4Z A;  3KQF A;  4IZC A;  3KTI A;  3R9Q A;  5E0S H;  1UIY A;  1W2X A;  3T8B A;  2F9Y B;  2ZL3 A;  5INF A;  4U0G H;  4FND A;  3Q0G A;  3HRX A;  3RST A;  2NP9 A;  3BPP A;  1EY3 A;  3HE2 A;  3GMA A;  3ZWA A;  5DZK H;  1HZD A;  3STA A;  1Q52 A;  4B3I A;  5G1R A;  5KDR B;  5JBX A;  4NEK A;  2ZL0 A;  3MT6 A;  1SG4 A;  2EJ5 A;  2CE3 A;  5DUC A;  2F9I B;  4ASI A;  3U9S B;  2VRE A;  3T3W A;  1N6E A;  3TVW A;  2X24 A;  3HLN 1;  3OC7 A;  3BPT A;  3V5I A;  1UYV A;  1TYF A;  2ZL4 A;  5DKP A;  3TZ3 A;  1UYS A;  4JVT A;  2PG8 A;  4Q0G A;  4IZD A;  4MXI A;  3P2L A;  3M6M A;  4RYF A;  4FJW D;  2J5I A;  3V5E A;  3BF0 A;  3KTK A;  3H0S A;  4U1A A;  4ZDD A;  5DUF A;  3PGQ A;  4OLQ A;  1JXZ A;  4WYO B;  4GHN A;  5C9G A;  1XO6 A;  3NJD A;  4ELW A;  3IAV A;  3TVU A;  1PJH A;  3QYR A;  3R9T A;  2PBP A;  4RCN A;  2DUB A;  3MFM A;  4JYJ A;  4L8K A;  4OMR A;  5CTC A;  4JCS A;  4IZB A;  1WZ8 A;  1XNY A;  4K3W A;  4MI2 A;  4LK5 A;  1XNW A;  1WDM A;  1EF8 A;  3LKE A;  4JYL A;  5E0N X;  3TV5 A;  1ON3 A;  4JCQ A;  3SLL A;  3OT6 A;  5DL1 A;  2VSU F;  4JJT A;  3Q1T A;  4FZW C;  3ZWC A;  2J5G D;  1N6D A;  4G2R A;  1OD4 A;  4ZDC A;  4DI1 A;  1FCF A;  3ZWB A;  3QXI A;  3MYB A;  1FC6 A;  4FN7 A;  3MOY A;  1PIX A;  3ZW8 A;  2Q35 A;  2UZF A;  3L3S A;  3T88 A;  3HP0 A;  1J7X A;  4NAR A;  3H0Q A;  3U9R B;  4I42 A;  2J5G A;  2HW5 A;  4B3J A;  5DU8 A;  5FUS A;  4GM2 A;  4OG1 A;  4WCZ A;  2FZS A;  3G64 A;  3R6H A;  1O8U A;  4JFC A;  3ISA A;  1K39 A;  2VSU A;  4NNQ A;  3QMJ A;  2ZL2 A;  3OME A;  2VSS A;  2F6I A;  5MGB A;  3FDU A;  1NZY A;  5HUQ A;  3DOR A;  5IKL B;  4ZU2 A;  1FC7 A;  3IBB A;  5C90 A;  2FBM A;  4JCT A;  4ZDE A;  1N6F A;  2C8T A;  3M6N A;  4EMM A;  3GF7 A;  4U19 A;  3SWX A;  1K32 A;  2A7S A;  3H81 A;  2Q34 A;  5E0S A;  4KWB A;  3QKA A;  4B3H A;  3IB9 A;  2CBY A;  3JU1 A;  4U0G A;  4ZDB A;  2DEO A;  5DTW A;  2J5I B;  3BEZ A;  4FB8 A;  2A81 A;  1SZO A;  2YJG A;  5DZK A;  5ING A;  4EMP A;  5FIF A;  1UYT A;  1VRG A;  3HIN A;  4L6W A;  1XNV A;  4EML A;  1YG8 A;  3RRV A;  2VSU E;  3R0O A;  2VSS E;  2J5I I;  3TT6 A;  5DU4 A;  3TLF A;  2D3T A;  4KPK A;  3QK8 A;  4JOT A;  1OD2 A;  1WDK A;  2VX2 A;  2VSS F;  4HC8 A;  4KD6 A;  1MJ3 A;  2GTR A;  1HNO A;  2QQ3 A;  2F6Q A;  5KJP A;  3GF3 A;  2F9Y A;  5JBW A;  3TRR A;  4ELS A;  3NJB A;  4RYF H;  3P5M A;  3ST9 A;  2PPY A;  3WG5 A;  3FF6 A;  3TT7 A;  2A7K A;  1UYR A;  5KDR A;  4K2N A;  5G1S A;  3KTJ A;  3QXZ A;  3KTH A;  2BZR A;  2Q2X A;  2F9I A;  5DTP A;  4KNP A;  1DUB A;  4JWV A;  1ON9 A;  3VIV A;  1RJN A;  4K29 A;  2FW2 A;  1RJM A;  4HNK A;  1TG6 A;  1WDL A;  4ZDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...