1VRUA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
537
structure length
525
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 138
structure length 525
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vruA05
2RN2A 4O4GB 2IDOA 4WFZA 4EP4A 3SPZA 4RNFA 3N6NA 4BWJA 1D1UA 4MKBA 5KG4A 3TQ1A 2B4JA 2ALZA 2HHTA 4F3TA 3TAFA 4EBEA 4DTRA 2P5OA 4U7CA 4DG1A 4Q8FA 1RDAA 2G8UA 5DQHA 2FVSA 1NOYA 4IKAA 1CLQA 3TR8A 4KAIA 3DRSA 1SH0A 4QWAA 3NFAA 2ATQA 4ECWA 1RTIB 3FFIB 2DPIA 2D5RA 4KREA 2HNYA 3I0SB 4MFBB 5E41A 4Y2CA 4CF0A 3HVTA 3AO4A 1J9AA 3D5MA 1S1UB 1BQNA 2W9BB 2YNIA 2WTFA 4CJ5A 1WSFA 4CJVA 5EWGA 3JSMA 1LAVA 3OYMA 3PX0A 1TK8A 1QE1B 3OY9A 1T3NA 1KTQA 4ECXA 2WOMB 4BDZA 4NLSA 3HPGA 4ZTFA 4W5NA 3SUOA 1U47A 1B9DA 3SUQA 4RUCA 4ZPDA 4QWCA 3KK1B 3K5NA 4HUGA 2Y1JA 3PX6A 4BWMA 1NHUA 3I8DA 1HPZA 4KHSA 4JRPA 3VN5A 3SZ2A 2HW3A 4FVMA 2VWJA 4ZPCA 3AA5X 5DMRA 3KOAA 1TV6B 3T1AA 4NCGB 5J2PB 4PQUA 4CK1A 1OS5A 3T5HA 4KE5A 4NLUA 3SQ4A 1SV5A 3RR8A 1RT4A 4J9LA 5HP1B 3GV7B 3HL8A 5HRPA 3RMCA 1LWFB 1LW0A 4O3SA 1RT2B 1EP4A 4EP5A 1N6QA 3HXMA 3OYGA 1KRPA 4DMNA 1TKTA 5D3GA 4YQWA 3AO3A 4DSIA 5J2NA 3CIZA 4KV8A 4NYFA 2HHQA 3QNNA 4ECUA 4E7LA 3DMJB 5KFNA 3HO1A 4OKKA 5KFOA 3C6TA 1IM4A 3KKRA 3FDSA 4IR9A 3DI6A 4DQRA 1NKCA 4FW1A 1JLFB 3KJVA 1Q9XA 5SZTA 3DOLB 4LD0A 4OKJA 4B9LA 1WNEA 3QO9A 3S3NA 1KVAA 5F8NA 2BDPA 4RNNA 4ED7A 3C6UB 4KRFA 3MFHA 5F8MA 1QUVA 4RW6B 2OPSB 2X6SA 4NCAA 3ALYA 2W8KA 5HBMB 4KB1A 2PYLA 3DLKB 4N5SA 1N4LA 4CIGA 1EX4A 4FJ7A 2GUIA 4C8KA 1S10A 3KLIA 3IN5A 4CIEA 1JKHB 2WRMA 3V9SA 2OPQB 3H5SA 4K8ZA 5I42A 4K4SA 4FJJA 2R8GA 4KHUA 3QGIA 4YMEA 1T05A 3KK3B 4B9TA 3OJSA 4CGIA 2DTUA 4OLAA 4MQ3A 3EPIA 3OYJA 1S6PB 3CFPA 1JLBA 1QSLA 2AQ4A 1SL2A 4GC7A 4K4ZA 4K4TA 4B9UA 5KFEA 4CEZA 3P1GA 1HYSB 1A5XA 3NAEA 4NLRA 4WFXA 3NF8A 4ZVGA 3QIOA 5HLFB 4K4UA 1TL1A 3MF5A 3DLGA 3M8QB 4EBCA 1BCOA 2KTQA 3T5JA 4PUOA 4ZHRB 4CJ3A 1JLCA 4M3UA 2KZZA 1BISA 3QLHB 3BJYA 2WB4A 4OLBA 2LSNA 5F9LA 2IJNA 4E1MA 2I5JB 4B3OB 4IG0B 1NJWA 3QEIA 1ZBHA 4NRUA 5KFKA 3CQ8A 4CK3A 4TN2A 3TAGA 5KFIA 3HPHA 5KFVA 1VSDA 2J6SA 3LP2B 3KMQA 1ZYQA 4J9QA 1KVBA 2BANA 3U3GA 3BGRB 5FRNA 4CGJA 1I6JA 1TKDA 1S1TB 1SH3A 4NLOA 3TAMB 2B6AB 4WFYA 3KK2A 3LALA 3OSNA 4OPKA 4CGGA 1S0NA 4FJXA 2XI3A 3OYEA 1VRTB 4E7KA 2D3ZA 2R8HA 3E51A 3QESA 1ZBUA 3GYNA 3M8PA 2X6NA 4FS1A 3LDSA 2XY5A 4ZVEA 2HHUA 4HVJA 2OYQA 2AJQA 4ECRA 3RB4A 1RT7A 2J6UA 3WNFA 4IFYA 3RAQA 4DLEA 3AO2A 2OH2A 3B6OA 3PR4A 4DU3A 2ITGA 2V9WA 4FZYA 3M8RA 1S9GB 4W5RA 3ITHB 4DQIA 5CYQB 3L8BA 3QNOA 3ZSVA 1RT5B 1S1WA 3OYLA 3NHGA 4LSLA 3H40A 1BI4A 3ZT2A 1WSHA 1GOAA 1L3UA 1C0TA 2YHAA 2ZKUA 2PY5A 2KW4A 3V4IA 2B5JA 5L1KA 1UWBA 3GV8B 3LP1A 4BDYA 4KAZA 1HJRA 3K5LA 1N5YB 4OL8A 2P1JA 2HNDB 3T3FA 3KLHA 4K50A 5KG5A 3K5OA 5JXSA 1TKZB 3IRXA 4CHNA 3KLFA 3PX4A 1RT3B 3OVNA 4FM0A 2V4QA 3D0PA 1WSIA 1BCMA 5I3UB 4DTMA 4RZRA 4RW4A 1DLOA 4IG3B 4R5PA 4FLTA 5DG8A 2HHXA 1JLQA 4NLVA 2ZD1B 2D7SA 4IRKA 1QAJA 4FJ5A 1D8YA 4LQ9A 3PW4A 4H4OA 4EYIB 4FJKA 4Q44A 4ID5B 4ED3A 4HCCA 3Q8SB 4DTUA 1FKOA 1X9WA 1RBTA 3HVRA 5KI6A 4JS4A 4WYWA 1LAWA 2VG7B 4I2QA 1IKYB 4NLYA 4WE1B 2G8HA 3WNEA 1J5OA 3DM2B 1C1AA 1UA1A 1SKWA 5KT7A 3NGDA 1KLMA 2XI2A 5FDLB 3GILA 5HROB 4K4VA 4NLWA 4K4YA 4M94A 1VSJA 1RTHB 3L2WA 4CCHA 2AX0A 2GC8A 3G0ZA 4R8UB 1HNVB 1VRUA 1TK0A 4CJTA 3AA4A 1JLAA 2IM2A 4JRQA 4ECQA 1X9SA 4EO6A 4DSLA 3VQ8A 4BE1A 5KGXA 3DRPA 5KFZA 3CFRA 4DFKA 4DWIA 2ETJA 2YNFA 4KB0A 1S6QB 4FJ8A 2E4LA 2JGUA 5DK5A 4NYNA 4LSNA 4AH9A 4FJNA 4ECVA 5KGWA 4TY8B 4O44A 2NUBA 3S3MA 4F3OA 3RBEA 1RTJB 5L1LA 1B9FA 1DTTA 4CGFA 3V9WA 1IKVB 3NF6A 2CKWA 4CFAA 5C25B 1C0UA 3ICLA 3RMDA 4ED2A 4N76A 4FLVA 2UUWA 1RBSA 3BDPA 2AGQA 1WSGA 3OS2A 3QYYA 4YR2A 2HWHA 4GVMA 2OA8A 1NKEA 4AHUA 1CZBA 3HJFA 3RAXA 1S9EA 5KFUA 4HYKA 1SUQB 3RMAA 3PW0A 4DQPA 5CYMB 2HMIB 5KG0A 4DFMA 4URSA 2AU0A 5EWEA 5KG1A 1T03A 4BE2A 1ITGA 3BREA 4G1QA 2ASDA 1RNHA 3AVJA 3KLGA 3LWMA 3H5XA 2VG6B 2D0BA 4E19A 3PO4A 3V81A 3O3FA 2WONB 4ZPAA 1HYZA 5KFXA 2AX1A 2GIQA 1BIUA 4KBIA 4Z4IA 1REVA 5KRSA 4L8RB 3LP3A 3AVHA 4CJEA 2YKNA 4CJQA 3ISNC 5C42B 2XC9A 1EETB 3HSTB 4BDPA 3MR2A 4IFVB 3EZ5A 3A2FA 4KTZA 2UVUA 5KFPA 4I7FB 4Q43A 3VQ4A 3I0RA 4YR0A 2FVCA 2BE2B 2FVRA 2QK9A 1I39A 4DLGA 2FJXA 3DYAB 4FM2A 4ZP8A 4CHQA 3HPOA 3IS9A 4R0EA 4Y34A 1ZBFA 2UVVA 3NH2A 4Z0UA 3CFOA 4DG1B 3BSOA 4QCLA 2C28A 4OGCA 1TKXA 4PY5A 3OS1A 4E7HA 3DRSB 5EUHA 1BGXT 1LWCA 4Q45A 4W5QA 3CJ2A 5JS2A 5DGBA 2FLPA 3MEGA 2HNYB 1IH7A 3VQ7A 4XPEA 4OVLA 3TI0A 1W25A 1BQNB 4DFPA 4C8LA 4FK2A 2E9RX 3O3GA 3U6FA 4CF9A 4DTPA 5KFQA 3QINA 3JSMB 3KLVA 3GIMA 3THVA 4U6PA 3MR3A 1TVRB 1IKWA 1VSEA 4RW9A 4M3RA 4G3IA 1WAJA 3V6KA 1IG9A 1TL3A 2IA6A 3LPTA 3T5KA 3SQ0A 4QOZB 4CJLA 3HVWA 2EX3A 3BQ2A 3T5LA 3QIPA 1NK4A 3ISND 1RAJA 2WHOA 1NK6A 4MIAA 3M9NB 4RW7A 3OYIA 1HPZB 3OL9A 2A1SA 3KIOA 1HARA 4H54A 2P5GA 5SWMA 3H08A 3LAKA 4ECYA 4FXDA 5KFYA 3NGIA 3UIQA 2D0CA 4TQSA 3M9MB 4AHCA 3H4BA 2W42A 5J2QA 2YHBA 3NH0A 3ZCMA 4PQUB 3NF9A 3F73A 3IGNA 4RUAA 4Q5VA 4IH7A 4TYAA 3VQ9A 1SV5B 3NBPA 3MXJA 1RT4B 5C24A 4AHSA 1LW0B 3TARA 2XGPA 1TK5A 1EP4B 4CEEA 4CEFA 4J9OA 1TKTB 5D3GB 2ASJA 5J2NB 4E3SA 1GX6A 2R2UA 4KV8B 2AGPA 4TSXA 2FLNA 1YVUA 4KO0B 3RMBA 3OL7A 2KFNA 3DOKA 4NLTA 2F96A 1I3AA 3L2UA 3KNAA 3C6TB 4CJPA 3VA0A 4DSFA 2CJQA 4FCYA 2PYJA 1NK5A 1O1WA 3KJVB 2VA2A 1RTDB 3ZSZA 1Q9YA 3QO9B 1D9DA 4Z4FA 2W9CA 3RB6A 5KT5A 1XHXA 1JXBA 4HTUA 5F8LA 3RWUA 1VK0A 3MAQA 4KTWA 4JUZA 4J9PA 4J9RA 4CF1A 4CJWA 4F4ZA 1HQEA 3AV9A 3HKWA 1NOZA 3KLIB 3EY1A 3LWLA 4M42A 3O4QA 5I42B 4KPYA 3GQCA 2BQ3A 3CM6A 2R2SA 1T05B 2RPIA 2GIRA 4CEDA 5KTQA 3LZIA 4AHTA 4XIUA 5KFFA 3FRZA 1JLBB 2HNZB 1RDCA 1TV6A 4NZ0A 4LY7A 1JX4A 4OKEA 1NNDA 4PA1A 3KLEA 4NYZA 2O5DA 2FC0A 4W5OA 3NMAA 2BRLA 3ZSYA 1SL0A 4B9NA 3KHLA 2YNGB 3AVIA 4RG8A 2YV0X 1U09A 4DF8A 2RF2A 2IC3B 4IDKA 3NGYA 3HHKA 4DTJA 1JLEA 1RCHA 4DQSA 3DLGB 3JYTA 1SL1A 4WXWA 4URQU 1VSKA 1A5WA 3AO5A 1YTUA 4PUOB 4FYDA 3TWHA 1LW2A 1TGOA 4NLXA 1JLCB 4I9QA 3OSPA 4HUEA 4FBTA 3F9KA 4QWEA 4DTXA 1U48A 3DLHA 5DG9A 3UR0A 1R0AB 2ATLA 1IKXA 4WZQA 3PUFA 2QKBA 2FBYA 2Z1GA 4EZ9A 3D28A 1RT1B 1BHLA 2BQUA 3RBDA 4CECA 3ZT3A 2Y1IA 4FLWA 4TLRA 1KHVA 2BANB 4RU9A 4MK9A 4E89A 3K2PA 4QWBA 5HRNA 1VSLA 1ZBLA 4TXSA 1U49A 4HUFA 1RBUA 1C1CA 2Q3SA 1JIHA 4CK2A 4ELUA 4CF2A 4RW6A 1Z4UA 4H8KA 4FJLA 3G6VA 4FLYA 1D9FA 3M8SA 2D3UA 1DTQB 2BQRA 1XR6A 3M8PB 1RYRA 4IBNA 4O3NA 3E01A 4FS2A 3K57A 5KFJA 4FZZA 3L2QA 4CGDA 1L3TA 3CVKA 4OJRA 4CHPA 1JKHA 4O3PA 4IFYB 3SI6A 1LV5A 3MEDA 4ED6A 3TANA 3LP0A 5KRTA 4M3WA 2F8TA 1LWEA 2R8IA 3O3HA 3KK3A 3QIDA 1S1WB 4E1NA 1WNSA 2D0AA 4LSLB 1BI4B 2RDIA 4DL7A 1GX5A 2V4RA 3V4IB 4Z4GA 2B5JB 5KG7A 1UWBB 3LP1B 2ASLA 1ASVA 3OJUA 3RRHA 4DTSA 1HYSA 4N41A 3RR7A 4LH5A 2FBXA 4KHQA 1F21A 4RW8B 4ZMMA 2VWKA 3GV5B 4FJMA 3BSCA 3KLHB 1RA6A 4F4KA 2C2RA 2IAJB 1JLGA 4CGHA 4M41A 4CFCA 3KLFB 4DL5A 3SPYA 4YR3A 1EKEA 4FJGA 3NDKA 4H4MA 4ZHRA 4RW4B 1DLOB 3AVFA 4R5PB 1KFDA 3VQPA 3V1OA 1JLQB 1S0MA 3DDKA 4K4XA 3C94A 3V9ZA 1BIZA 3SFGA 3V6HA 4H4OB 1WN7A 1SKSA 5KFTA 1J53A 3V6DA 1QAIA 4O0JA 4CHOA 3I5BA 5DQIA 3BSNA 3DLBA 1FKOB 3LP2A 2R8KA 3IG1A 1S5JA 3OYFA 2ZE2A 3V9UA 3AO1A 3OYHA 1UA0A 1T8EA 4IRDA 1U4BA 3OYNA 4I2QB 4AHVA 2QV6A 1NK0A 2D41A 3HP9A 1N48A 3VQCA 1JXEA 1SKRA 4EZ6A 1WAFA 2WCXA 1J5OB 1KCFA 1XWLA 4O3OA 3VQEA 3MTKA 5F8IA 1FKPA 3NKYA 1A5VA 1NK8A 1KLMB 4W5TA 5KG6A 4B9SA 4O5BA 2YKMB 3HK2A 2R8JA 4M3XA 4I2PB 5JS1A 5L1IA 2QXFA 1S9GA 1FXXA 4J9NA 3MEEA 2BR0A 2YNHA 1VRUB 2W9AA 3KD5E 1JLAB 2RKIB 3NF7A 4MKAA 4J2AA 3P5JA 3DRPB 1NJZA 2HHWA 3KMSA 2YNFB 3AVAA 3AVCA 3AVLA 3MXIA 3EYZA 5JUMA 2ILZA 2Z1HA 4O44B 3CJ0A 2XGQA 2DFFA 5KFAA 3EPGA 1TKZA 1DTTB 3VQSA 3PV8A 4FW2A 4KI6A 3AA2A 1CXQA 4KSEB 2X78A 1C0UB 1XR5A 3QGHA 4XO0A 2O4IA 1IO2A 3CG7A 4O3QA 4DTOA 2OZSA 1RDRA 2ZD1A 1S9EB 1T94A 3L3UA 4JV1A 4LH4A 1TP7A 3DLRA 1ASWA 4B9MA 3AVMA 3SCXA 4QPXA 4ECZA 2J6TA 1S1XB 5EDWA 4G1QB 2UVRA 3QEVA 3KLGB 4M3ZA 4AHRA 4KKOB 3PJXA 3V81B 3TAEA 4QW8A 3GIIA 1BQMA 3TVKA 3BR9A 3SV4A 3BSAA 4JS5A 1J54A 4OGEA 3KHGA 1HQUB 1REVB 3DRRA 3QGGA 2YKNB 3AVBA 1RT6A 4URGA 4GW6A 3NAHA 1FK9A 4ICLA 4KFBA 1HMVA 2GBZA 2OPRA 4I9LA 3NE6A 5DLFA 4Y3CA 2JLEA 3I0RB 1ZETA 3SUPA 3H59A 4JLHA 2E6MA 3MECA 4GMJB 3IS9B 4ED0A 2G8WA 4FJ9A 4ECSA 4CE9A 4EBDA 3LPUA 5EU7A 2FVQA 4JV0A 5KFHA 2E6LA 1L5UA 1VSFA 2XY8A 3TAPA 3OYDA 4CJFA 2QKKA 4J9MA 1TKXB 5L1JA 3LANA 2G8IA 1LWCB 2BGGA 3K58A 2G8FA 2C2DA 5T7BA 3MEGB 5KFRA 2F8SA 4M45A 2ZQBA 3SV3A 4MK8A 4PWDA 1SUQA 2OPPA 2VG5A 3NCIA 3Q8RB 1ZBIA 2HAIA 4AILC 1UOCA 4J9KA 3K59A 1IKWB 3RRGA 3PW7A 4RW9B 3UQSA 4DL3A 5K14A 2E9ZA 1HNIA 3G6XA 2XHBA 4J2DA 2IGIA 1MMLA 2WONA 5J2MA 2DFHA 3QIPB 4ZPBA 3CDWA 3ZSWA 4RW7B 3DLEA 4DSJA 4CEQA 1C1BA 4CF8A 3VQQA 3HVTB 2ILYA 2YNIB 1C6VA 4Z4EA 1KLNA 1MU2A 1NK7A 2AWZA 5J2QB 4MIBA 4ID1A 4CERA 4C8NA 4DF4A 4WXOA 4CHYA 2R2TA 4I7FA 4NLPA 2Z1JA 1NK9A 2BE2A 4J2EA 3NBPB 1D5AA 4EO8A 3DYAA 5C24B 4MK7A 2WK4A 4M3TA 4CFDA 4Y1DA 2HVIA 4Q0BA 2JC1A 5J1EA 4NRTA 4KHYA 1QHTA 2IM0A 2JEFA 4E0DA 3OYCA 3CM5A 3ZT0A 4HHTA 2DPJA 2UVWA 4DQQA 4K4WA 3M9OB 2IOCA 3DOKB 1W9HA 3L2VA 1U45A 1C0MA 4Y2AA 3GIJA 1S1VA 4B8CA 1W0HA 4O4GA 5DG7A 4CJUA 3OL6A 3V6JA 4Z4HA 1KSPA 3TABA 2XWYA 1B92A 4M95A 3S9HA 2W9CB 4ED1A 4MH8A 1N6QB 3G10A 4O0IA 1HYVA 3CWJA 1TVRA 3OYBA 3PW2A 3LAMA 3CJ3A 3SFUA 4DU4A 5KFGA 4KHWA 1HQEB 2XY7A 1ZTWA 1WSEA 3FQLA 1RTIA 3FFIA 3PZPA 3DI6B 1YT3A 4DL6A 3I0SA 3NH1A 4C8OA 2XRIA 4MFBA 5CY4A 1S1UA 2W9BA 2W7OA 1Z25A 1XR7A 4UQGA 2IM3A 3S3OA 1NHVA 3OS0A 2IS3A 2RDJA 3BQ1A 3H2LA 4DSEA 1QE1A 5KFMA 5KT4A 2P51A 3KLEB 3UPFA 2HB5A 3SUNA 2WOMA 3WNHA 3I5CA 4NCBA 2JC0A 2PZSA 4YNQA 5KT6A 4OPJA 2W8LA 3B6PA 2RF2B 2EC0A 4IDKB 3QEXA 3KK1A 1ASUA 1JLEB 1XC9A 3JYTB 1D0EA 4F4YA 3EZUA 4EYHB 1UAXA 3AVGA 2UUTA 4WYLA 1HRHA 1LW2B 4DS5A 4M3YA 4IR1A 4O55A 3CYMA 4KO0A 2KZMA 4NLGA 4FBUA 1S9FA 1IKXB 4NCGA 5J2PA 1TAUA 3P83D 3GIKA 4ED8A 4FM1A 1QSSA 4TYBA 1RTDA 2G8VA 3CDEA 4KI4A 5HP1A 4CIFA 1QTMA 2IMWP 1LWFA 1TL1B 5KT2A 1RT2A 1C1CB 2C2EA 3VQBA 3QERA 4FLUA 2R7YA 5EWFA 3ZSOA 3KHHA 1VSHA 2HHVA 5CZ1A 5L9XA 1S49A 4B08A 5FRMA 3CDUA 4F2RA 3OHAA 3PR5B 1X1PA 3E01B 1NJYA 3DMJA 4ELTA 4FZXC 3MEDB 3LP0B 2FJVA 1LWEB 3PW5A 1JLFA 3SYZA 3VQAA 2W7PA 3DOLA 1S4FA 2X74A 2B43A 1GOBA 4ZP7A 4B9VA 4K8XA 3AVKA 4O3RA 5DGAA 2HNZA 3C6UA 3KK2B 1QSYA 3H5UA 3ULDA 3Q8PB 3ASMA 3MXMA 2OPSA 3QZ7A 2IBKA 4RNHA 4ELVA 5KG2A 4CESA 4FK0A 5HBMA 4GC6A 2YNGA 3DLKA 3Q8QB 3IGVA 2KFZA 2EHGA 3RB3A 4KTQA 2IC3A 1JLGB 3MFIA 4BACA 1RT7B 2Z1IA 2I1RA 2OPQA 2XCPA 4IH5A 1YTAA 4H4MB 4X2BA 3IAYA 3PY8A 3ZT4A 4QW9A 1C0TB 1S6PA 1R0AA 3H98A 2VA3A 3UDLA 3V6DB 2HHSA 4TY9A 1RT1A 3G86A 3NAIA 4FLXA 1XHZA 1N56A 3IG1B 2ZE2B 4IOBA 3MR5A 1RILA 1RBVA 5HLFA 1X9MA 3IRXB 4DSKA 3AVNA 3M8QA 4LQ3A 4B8AB 3LZJA 3PJWA 4FLZA 1TQLA 1CZ9A 3OYKA 1Z26A 1RBRA 4F4XA 3HYFA 2R2RA 1DTQA 1FKPB 4N56A 4QWDA 3QLHA 3CJ5A 4IH6A 1Q8IA 2F8EX 3ZSQA 2I5JA 4B3OA 4IG0A 3V9XA 1WLJA 4Y1CA 2FVPA 1L3VA 2OZMA 4DL4A 4F2SA 3KD1E 5KG3A 3MEEB 2YNHB 5KFWA 3BGRA 1XI1A 4KHNA 5T14A 4YP3A 1S1TA 1WSJA 3O4NA 3TAMA 2B6AA 3WNGA 4CHZA 4DU1A 2O4GA 4BE0A 4ZVHA 5KFDA 1VRTA 3TAQA 4N47A 2HWIA 3NGZA 1KFSA 4RW8A 4J9SA 4E7IA 4CEOA 4DTNA 1K1SA 2FBVA 2IAJA 2G8KA 3I5AA 5DQGA 2E9TA 2DFEA 1TAQA 4ZVFA 3HP6A 4HKQA 3SNNA 4RNOA 4CFBA 3H5YA 5FROA 3ITHA 1NKBA 3ZT1A 4CJKA 5CYQA 2QE5A 1RT5A 3PO5A 5KFBA 3V1QA 4WZMA 3SI8A 1N5YA 5DLGA 2A1RA 4LSNB 1YVFA 4CEAA 3MR6A 3T19A 4CEBA 4Q8EA 2HNDA 3HVAA 1K1QA 3V1RA 4Z4CA 1CSJA 3OLAA 1K6YA 4KB7A 1RT3A 4O4RA 4QAGA 4DEZA 4ZTJA 1BQMB 5I3UA 5HRRA 4DL2A 4IG3A 1RYSA 3L3VA 3DRRB 1BL3A 4NLDA 3SQ2A 2YKMA 1RA7A 3G6YA 1RT6B 5CZ2A 4ID5A 1FK9B 4ICLB 4KFBB 1HMVB 2OPRB 4I2PA 1CXUA 1T03B 3D45A 1QS4A 1Y97A 4CJ4A 1KVCA 3QETA 2RKIA 4FJIA 3H4DA 3KKSA 2VG7A 1ZTTA 5HRSA 4JV2A 1IKYA 4E7JA 4IQXA 4DS4A 3NL0A 3VQ5A 3MECB 5F8HA 4ZP9A 4WE1A 3U3YA 3C95A 2FJWA 1T7PA 3DM2A 4FK4A 4KHRA 4CJRA 3OYAA 5F9NA 1SH2A 5FDLA 5HROA 1RDDA 3AA3A 1RTHA 2AGOA 2JEJA 1EXQA 5KFCA 4CJSA 1VSMA 3RB0A 4DFJA 4R8UA 1HNVA 1VSIA 1GOCA 4RNMA 2JEGA 3OL8A 4FJHA 3OLBA 4NLQA 1S48A 3BQ0A 4PWDB 2OPPB 3N6LA 2V0NA 2VG5B 3KTQA 1S6QA 3RTVA 1G15A 1S1XA 1JL1A 4TY8A 1U04A 2IJFA 3OHBA 1RTJA 4TQRA 3VQ6A 5K14B 4HCBA 1HNIB 4KKOA 5KT3A 1IKVA 2XY6A 4YFUA 5C25A 5J2MB 1C2PA 2GV9A 4ECTA 3PHEA 1L3SA 4IKFA 3DLEB 2XO7A 3PVXA 4C8MA 1C1BB 3FQKA 4F50A 3SJJA 5KFLA 1HQUA 3HT3A 2DY4A 1NJXA 3QZ8A 3ZSRA 3N6MA 4ZP6A 5CYMA 2HMIA 1MU2B 3VA3A 2KQ2A 4KHMA 3CO9A 5F8GA 1KHWA 1JL2A 1S0OA 3HM9A 1TL3B 2VG6A 3L2RA 3VQDA 2IM1A 4F8RA 1JXLA 2FBTA 3ZSXA 4IRCA 1RDBA 2XCAA 5KFSA 4Q0BB 2HVHA 5J1EB 3K5MA 4J2BA 3QEWA 3KHRA 4EEYA 3FSIA 2JEIA 4XPCA 1QQCA 2BRKA 5C42A 3QEPA 2C22A 1EETA 4IFVA 2FLLA 5F8JA 5C5JA 3CJ4A 3SQ1A 4F4WA 1S97A 1S1VB
chains in the Genus database with same CATH superfamily
1XNQK 1RXOB 5AJ3J 3H2VE 3RSEA 2WBNA 4RNFA 4Z2XA 4PKHA 2ALZA 4GVBB 2Y8YA 4F3TA 5M2UA 3SEOA 2J76E 2P5OA 1Z2ZA 3ZETA 1E6YA 1V5VA 2O8EA 2XMWA 3D4JA 1EKSA 4USVA 1WELA 2ZM6J 2VICA 2BJ7A 1SH0A 2VB6A 3H42A 1S5ZA 4UZCA 3R7BB 4CF0A 3HVTA 2EXUA 3AO4A 3D5MA 2W9BB 1WSFA 2BOAA 4K5SA 2LCWA 2JNJA 3MN7A 3EEQA 1IJFB 4FXVA 3OY9A 5J1NA 4OZ2A 1WJ9A 4ECXA 2WOMB 4ZTFA 2DXFA 2ZC3A 3W3DA 1TYQB 1U47A 3POTA 1B9DA 1RAAB 2HWTA 3H3NO 3PX6A 3DKDA 2BZ2A 2VWJA 1PILA 3VGTA 2MQQA 3AA5X 1CLFA 3MPUB 4HTIA 2HFZA 3D6FB 1ZM4A 4WFBQ 4FDFA 4ZLLA 3OUYB 3MMCB 1RZMA 2NPIA 2PA8D 3KDNA 2KHCA 2DNKA 4UY8T 2J9CA 3WXMB 5HRPA 1LWFB 4LSZB 1CC7A 1EP4A 1HLUA 2JLGA 1VI7A 3M1VA 3IR5B 3GLJA 2FGOA 4GKKJ 4AM7A 4NYFA 2HHQA 3QNNA 4OX9J 5KFNA 3HO1A 3ZLJA 4OKKA 3Q22A 3C6TA 4WIQA 1BLUA 2AYGA 4RWWA 4F04B 3FDSA 3KJVA 2G2YA 1P1TA 4BC9A 2V5HG 1KAXA 2F4FA 3VAKA 5F8NA 4ED7A 2NQPA 4FPIA 2EEYA 3C6UB 1LXNA 1TFYA 4RW6B 2X6SA 3NNCA 1SQKA 4YOTA 1MA9B 4BC3A 2PYLA 3DLKB 3R7NB 3A5OC 4FJ7A 3J7AP 4C8KA 4B3RJ 4WPAA 6FDRA 2MJNA 3KLIA 3IN5A 4CIEA 1YKWA 2CJYB 2HURA 3FNNA 2HBKA 4K8ZA 2OPQB 3H5SA 1WDTA 4FJJA 3E2EA 2E5LK 4YMEA 3KK3B 2FJAB 4CGIA 4OLAA 3WBZA 2GX8A 3EPIA 5LXYA 1S6PB 2GIFA 1IBKF 1DZ5A 1JJ4A 2AQ4A 2ROGA 2C3YA 4U96A 2GVDB 4AQYJ 4CEZA 1A5XA 4ZVOB 5GAEU 1HLWA 3HHLA 4ZVGA 3QIOA 4DUZK 1NMEB 1RAOA 3CJQA 3HM8A 3I55S 4IO9L 1TL1A 3KUEA 3DLGA 4ZVSB 1WOSA 2X51A 1Q82T 2KTQA 3IR7B 3EO3A 5FLXU 3N0VA 4CJ3A 1V4SA 3GDQA 2ZJRQ 3ET6A 5AQKA 4QIVA 1FJGK 2I5JB 4B3OB 3M2UA 1WHWA 3J7ZO 1R7IA 4Z7CA 3I55N 2XS5A 3R5GA 4NEYA 4DUYF 3QFWA 1M5KC 3TA1A 4X62J 2N7YA 2OAUA 2GO8A 5BYRA 3PKYA 5AZIB 4YB5A 5CE3A 1VRTB 2P2CB 4E7KA 5D4PA 1UFKA 4FOEA 2HBMA 1TL4A 3IO1A 3GYNA 2XY5A 4C0BA 3TUIC 4AL6A 2HHUA 5KQDA 2QT7A 3AD9C 4HVJA 1ATSA 1X4CA 5F0XA 4DLEA 1GK8A 3JAMO 3B6OA 1TL7A 4DU3A 3G8SA 4W5RA 3WIUA 3ITHB 2P9IA 4A8FA 3L8BA 1S1WA 3OYLA 1X3MA 2YHYA 1N34K 3NG8A 1C0TA 2ZKUA 3UW1A 1Y4ZB 4JI0K 4FSVA 5L1KA 3GV8B 2VBXA 1B0TA 4BDYA 3D68A 3K5LA 4OJ3A 1N5YB 2P1JA 3C16B 4LF5J 3KLHA 4QZVB 1OPIA 4A8OA 1U1OA 3PX4A 3FGUA 3OVNA 2V4QA 3P45B 1DFDA 4DTMA 4GO7X 3Q2SC 2XMUA 2K7KA 3ZZ0A 3LTOA 5DG8A 1TMJA 1N36F 4QU6A 4OV6A 4DR7F 3SCKE 3H46O 1D8YA 2AJ4A 4H4OA 4Q44A 2OO4A 3J7ZT 2BXJA 2KVQE 4FWLA 4JS4A 4WYWA 2DYAA 1NMNA 3JQMA 2L3MA 4DR4K 4I2QA 1CJKB 1IKYB 2UUBF 1VQNS 5BR9A 3I56S 2XZWA 3H6EA 1MG7A 1J5OA 3DM2B 4RUHA 5KT7A 3C7NA 1KLMA 2XI2A 1WKLA 3KVGA 5BN8A 4K4YA 1VSJA 3L2WA 3U1NA 2GC8A 3G0ZA 3I9ZA 2WVFA 1TK0A 4JI6F 3HZEA 4CJTA 1JLAA 2IM2A 4JRQA 1X9SA 4C3KA 3CFRA 4CBUA 2ETJA 4F25A 2J0SD 1S6QB 3PG9A 2E7WA 2B4UA 4AH9A 2MQ8A 3QGPA 4ECVA 5KGWA 5AQMA 1S6OA 5LMNF 4OHWA 4CGFA 4DV6F 4DKWA 1LNQA 1FWKA 2PC6A 1LEOA 5C25B 3ICLA 3RMDA 1LXJA 2JFKA 4ED2A 3KWMA 1RBSA 3U1LA 2AGQA 1BU6O 5GMKa 3QYYA 1HWLA 2OA8A 5SUHA 3HJFA 4AHUA 2MKCA 3UO0A 1S9EA 2JX2A 5AFUH 2NRZA 2W2NP 2B4OA 1GTEA 4DQPA 3C6AA 4DFMA 2HMIB 2GJIA 4Z37A 4CTAA 3PYEA 4YEAA 2AU0A 4YY3J 3NS6A 2VOPA 2YWFA 1CS4A 5FPDA 4G1QA 1XERA 5IWAK 3KLGA 3LWMA 4E19A 3PO4A 3V81A 3O3FA 4CLLA 5CYJA 1XUPO 4HT5A 3C19A 1FFGB 4BRFA 5HANA 3FCWA 2VPXB 1D4XA 2MQPA 3MR2A 3I9V9 3TSQA 3A2FA 3T41A 2Q0RA 3VQ4A 4FN5A 2BE2B 2QC3A 2G4BA 1LKZA 2QK9A 3RSEB 4DLGA 4FM2A 3QJLA 3HCXA 1BDGA 3VETA 3CFOA 1E6YB 1D09B 3Q83A 4RBTA 1OMSA 2O8EB 5ADXH 4P2SA 1TKXA 3OS1A 4JI7J 1Y10A 1NRKA 3I8BA 2QA4G 3MEGA 4M5HA 3OVSA 1IH7A 3VQ7A 3TI0A 2RU3A 1HBOA 3NLCA 4UOHA 4CF9A 4DTPA 1OH7A 5KFQA 3W64A 4BRCA 1WBDA 3G9CA 1Q79A 4OZLA 3KLVA 3GIMA 3THVA 6FD1A 1Q95G 3LQVA 1VSEA 4RW9A 4M3RA 2A10A 4LF9J 1IG9A 1TUVA 3CPWM 4QOZB 3POTB 1FNOA 4KIAA 3WQPA 1U26A 2CPFA 2WHOA 3O80A 1S76D 2ASYA 5GMEA 3H08A 3LAKA 4WQ5C 4FXDA 2UUAJ 1YBAA 1VFJA 2D0CA 4TQSA 1HNZF 1PG5B 5FLXY 5J2QA 2G1DA 2YHBA 1WBBA 1GLAG 3ZCMA 3W1YC 1VMBA 3F73A 2ZH3A 1Y9OA 3IGNA 1PKUA 2MZRA 3K9KA 1DURA 1VJWA 4RUAA 2IVFB 2QX0A 2PSZA 4CLPA 3VQ9A 4AHSA 4NXNF 3TARA 1EP4B 2RQ4A 3M1VB 2RD5C 4J9OA 1N8RO 4DV7K 2P5VA 2AGPA 2DVIA 3AFGA 1NPKA 2FLNA 1YVUA 3RMBA 2DNRA 5B7WA 3C6TB 2O8DA 4CJPA 4DSFA 3VA0A 3DGPA 3KJVB 1RK8A 2E7XA 2VA2A 2V69A 1E6VA 3AB2B 3ZSZA 4KHPJ 2MKYA 1RHRB 2W9CA 4OYXA 3RB6A 2CGJA 1VK0A 1CJUA 4JUZA 2PBDA 2LXIA 2HFSA 3OTCA 1ZM9A 1BHNA 4A47A 4F4ZA 1HQEA 1EWRA 3AV9A 3HKWA 3HI0A 1NOZA 4P74A 3KLIB 1AFJA 4NA2A 1QJHA 3IUCA 2CPJA 1QVFM 4L72B 2BQ3A 2ZH9A 2LYVA 1FEHA 5EVZA 5KTQA 3LZIA 5A8KA 4AHTA 3TUZC 5KFFA 1FFSB 3A13A 2VDIA 1RDCA 1TV6A 3B4DA 3OT9A 3KLEA 3MDFA 2BRLA 3N9UC 2GHVC 1T44A 3S8SA 4ZLPA 4PG8A 1JLEA 3DLGB 1SL1A 1YG0A 3AO5A 1IBCB 1S6UA 4FYDA 4OFZA 4BR9A 3ULHA 2KYZA 4NLXA 2D4WA 3W5ZA 4P9SA 4C3LA 4DR1K 4QWEA 3H3OB 2AW0A 3UR0A 3M2UB 2FBYA 4EZ9A 4A2BA 1RT1B 3THTA 1HJOA 2B7BB 1X9JA 3ZT3A 2OTLS 4FLWA 1JJ2R 4IOXA 1R8CA 1U24A 3Q24A 3DU5A 4MK9A 4E89A 1Q53A 3GMGA 3SBMA 1U49A 1RBUA 4CZJA 3NS5A 7FDRA 1Z4UA 2EFNA 3X1LB 3R3TA 4FLYA 1D9FA 3M8SA 2D3UA 1DTQB 1YQHA 3X3UA 4AF1A 2OTLN 3K57A 2MPUA 1JB0C 5D0EA 1L3TA 4CGDA 3CDAA 1FXDA 5KRTA 3BO3A 1TL7B 1EWQA 3L09A 3CQYA 2P9IB 1VIOA 3SAFA 4RJVA 2XZDB 3RU0A 1S1WB 3ZTRA 2KM8B 3EGZA 5IXUA 4FWMA 2DR7A 1ASVA 2VGMA 3OJUA 1QQNA 1RBOB 4DPUA 2ZGYA 1KXPA 2DNPA 3HOTA 4WF9L 2VYPA 3CCVN 2VWKA 4FJMA 1WHXA 3KLHB 1RA6A 3OTEA 4F4KA 4LFCF 1JLGA 4CGHA 2HRTA 4CFCA 5AQVA 4DL5A 2XMAA 3SPYA 2Q79A 4FJGA 3NDKA 1NPPA 3EM1A 1L3KA 3EKSA 2K8GA 3T1HK 1KFDA 1BOTO 1IN0A 2AJFE 3V1OA 4QR2A 2DT9A 3J81O 2V67A 1BIZA 2GMJA 3NCPA 4H4OB 1SKSA 2G13A 4C1NI 2K1RA 1YGYA 1S79A 1QAIA 3I5BA 4LJMA 1RP5A 3LP2A 3IG1A 5HQMA 3HHLD 2ZE2A 1UA0A 4IFEA 3OYNA 4OZ5A 2WVCA 4I2QB 3KJFB 3MM8A 2CGKA 2A6MA 4A8KA 2E5HA 2PMZD 1SKRA 1F0XA 4B1UB 1W2BM 3HRGA 2MKIA 1J5OB 4OJ1A 4O3OA 3QJJA 1FA0A 5JVGL 1KLMB 2MTLA 4I68A 1U2CA 4QU7A 3WEEA 2YKMB 4GKKF 4OZ3A 1CJTA 1J5EF 5AQGA 1ZZFA 1IR0A 3H1VX 4CI6A 1ZAWA 1FERA 5JVHQ 1ZM2A 2IFXA 1FXXA 3AHPA 2VD3A 1KBRA 3TA0A 1OH8A 4GRSA 2W9AA 1JLAB 2RKIB 1APSA 4LBPA 2PGCA 1RWNB 4MT1A 3MCAB 1DT9A 2FHJD 3OFGA 4HTJA 2U2FA 2DB1A 2Y8WA 3TOQA 3CJ0A 3QNWB 1RKJA 2EBGA 2XGQA 2DFFA 3US5A 3VQSA 5BN9A 1B3TA 4FW2A 4RKUC 4CVNE 3B82A 3ZO7A 5DM7Q 1IO2A 3CG7A 4DTOA 4B9QA 2OZSA 1HIYA 1RDRA 2G2OA 2KJWA 2ZD1A 2ZNZA 1S9EB 3CD6S 3L3UA 3KUGA 4JV1A 4LH4A 1ASWA 2DH7A 3EGWB 3P5BP 4B9MA 2HQ3A 4CTAB 4QPXA 4ECZA 3UD4P 1RABB 1CS4B 2JWNA 4PHTX 1XQIA 1RDUA 4G1QB 3O9TA 3KLGB 4H0TB 1PAUB 1WC5A 1K47A 2ADCA 2QJ3A 2UUCJ 4BR2A 4L3NA 2DNZA 3V81B 3SDEA 3OTOJ 3EDQB 3TAEA 4QW8A 3AQOA 2VQEF 2CQBA 3BR9A 2X1FA 1J54A 3B8AX 2IVYA 3FSYA 3VGVA 2HZAA 4L73A 3A8IA 4LFBF 2QRRA 2E2PA 2B9EA 3L9ZA 3NAHA 4KFBA 3W60A 2CXEA 4UT4A 5D0HA 3D2FA 1ZETA 3HI9A 4HL9A 4NYOA 1ELOA 2BM1A 4PXCA 2Q43A 1SJ3P 2D1CA 4JV5F 1FTCA 4PG5A 3T1YF 3FZFA 2FPHX 2WSCC 2HF3A 1W7AA 4FJ9A 4ECSA 4EBDA 2YTCA 3CULA 5KFHA 1NSQA 1L5UA 3PLAA 4DB3A 3TAPA 3ZNJ1 1LK5A 4J9MA 1TKXB 4DPYA 3LANA 1A9NB 2KXNB 1KQFB 5T7BA 5LJWA 3MEGB 4XH5A 4M45A 2ZQBA 2B0GA 2GAHC 4MK8A 1HBOB 1IBKK 4PWDA 1RWXB 2CZ4A 4HLBA 2E2NA 2O8CA 1RHQB 2AP1A 2D3OR 1W2IA 1UOCA 4J9KA 4ZOSA 1FE4A 3RRGA 2HFNA 4RW9B 4IUFA 5KQ8A 5K14A 2E9ZA 2V2KA 2QWLA 2IGIA 1MMLA 4M5DA 3K8VA 1OSCA 4L75A 3T9ZA 2MGZA 3ZSWA 3W65A 3DLEA 2BH1A 4FWSA 1VQ8N 1C1BA 1FEEA 5LM7E 2VONA 3GG4A 1C6VA 5ETSA 1MROA 5J2QB 4CERA 1EX8A 4WP3A 1RAGB 1ATNA 3N5BA 4DUYK 4K2XA 1NK9A 2XULA 2CADA 2WVBA 2FSNA 2OGUA 1H7XA 5B09A 4J2EA 5F0UA 1D5AA 4EO8A 5M1QA 2IRXA 3MMBA 4X64F 4ITSA 1WC0A 3OD2A 3LGHA 3R7SB 2IM0A 1E4FT 2E29A 2DTJA 1YK9A 5HVGA 4K4WA 1XNQJ 4O8UA 3D1QA 3VVUA 2O8DB 2A3JA 2OI2A 1O13A 2A2CA 4EIAA 3UD5A 3GIJA 3DGPB 1S1VA 1EQYA 1E6VB 2J0QD 1KSPA 5AR0A 2W9CB 2DR5A 3Q23A 2P9LA 3OTDA 1N6QB 4O0IA 2QWQA 2HOEA 2NREA 4B3MF 1CJUB 3OYBA 4WWSA 3PW2A 3LAMA 3ID8A 3NVMA 3GR0A 1X4HA 1HQEB 2MYFA 1ZTWA 2ASPA 1WSEA 4F3QA 5DETA 4OYBA 2GO9A 4LF8F 4JNEA 3NH1A 4C8OA 2F3JA 1N36K 5CY4A 4ATNA 1S1UA 4DR7K 5AQSA 5A8KB 4WQ4A 4DR2F 2XB2D 3OS0A 2IS3A 4G1PA 1Y5NB 4MYTA 3P49B 3H2LA 2YX1A 1QE1A 2MZJA 3VEZA 2DNHA 2J7KA 2X1GA 3KLEB 3UPFA 4FWNA 3WNHA 3GYXB 4NCBA 4OPJA 2CQPA 2W8LA 2PEHA 2QA4S 1WKJA 5EGYA 3P39A 4W90B 1JWWA 2F9WA 2UUBK 4JK7A 3KK1A 1OO0B 1JLEB 3CMAS 2QWRA 1D0EA 2GV1A 4F4YA 3EZUA 4ES2A 3WT0A 3AVGA 2J7WA 2E2OA 4DS5A 3SSSA 3AODA 3LA0A 4A8YA 1IJEB 3F0NA 2VFUA 2BE7D 2QA4N 4BG9A 1QTNB 3PYDA 2QTDA 4FM1A 3P4UB 1P8GA 1QSSA 5ITHA 4ILJA 3CMAN 3M6UA 4E2FB 4USKA 5HP1A 3FZMA 1QTMA 2F5GA 2Y1RI 1RT2A 4IOCQ 3TEHB 3D0IE 3L4IA 3KHHA 1VSHA 4I6AA 5LMNK 2CZ9A 1TZ0A 1X1PA 4DV6K 4J90A 3HD2A 3S41A 1RUSA 2V34A 2CQCA 2UXBF 3J81U 3PW5A 3CQXA 3TUPA 3VQAA 2W7PA 2HKEA 1X4BA 2XTJP 3BR8A 3SSRA 2WW8A 2FY8A 2FC8A 1FFWB 4B9VA 3AVKA 1QSYA 4BS2A 4PQAA 3H5UA 2Y1LB 3ULDA 2MQLA 2OPSA 3QRPA 4P2XA 2IBKA 2HEKA 4EWTA 4ZJQA 5KG2A 5HBMA 3Q8QB 5AQIA 4DZDA 2HGMA 1SQGA 1NBEB 3I87A 1IQTA 2EHGA 2Q36A 3RB3A 2IC3A 1JLGB 3MFIA 1KN6A 2Z1IA 4K41A 4A46A 1R43A 1YTAA 4XEIA 4J5OA 2LQBA 4ZITA 3VAJA 1PGZA 1GXLA 3QICA 2XBPA 2O67A 3H98A 5F3ZA 4DUZJ 2K1RB 4TY9A 3G86A 1CEZA 3M6GA 1N56A 3IG1B 3ZX0A 3CCZA 4X65F 4BC4A 2ZE2B 5E33A 5ETOA 3AXMA 3IRXB 3AD7C 3SMZA 4DV3J 4J9UE 1TR0A 3MM8B 3AVNA 4L76A 4CLFA 1CZ9A 2QL5B 1WF0A 4CNYA 3ZTPA 1FJGJ 5L39A 3HYFA 1HW8A 4HACA 1EARA 2AJ2A 3W9JA 2DIUA 4BR7A 3WEEB 4OYWA 1BA0A 3A0IX 4P10A 2IBOA 5KG3A 1T6DA 2KL8A 4W98A 5CHIA 3BGRA 1XI1A 2QLBB 1S1TA 4ZLJA 3WNGA 4CHZA 1PBAA 2WAQD 2D69A 2V4JA 5KFDA 4KHPF 1Q8LA 1PJ5A 8ATCB 3SIPB 1OH6A 4RW8A 3NOCA 2KM8C 4DTNA 2IAJA 2G8KA 3I5AA 5DQGA 4JI3J 2E9TA 2DFEA 1TAQA 4JYAK 4HKQA 1VJQA 1N34J 3SNNA 2OKQA 1U02A 3MAHA 4JI0J 2R42A 1NKBA 4Z7YA 1RT5A 2FGCA 2OTJS 4FOIA 3UB5A 1VLYA 1WI6A 1XC3A 4LSNB 1YVFA 1S77D 2J7UA 2QA2A 3OR2A 2UP1A 2WFBA 4CEBA 1FRXA 1K1QA 4NXNK 3OLAA 1S59A 2ZH4A 2OTJN 2MSSA 3G6ES 3OXLA 1XIQA 3PKMA 3GJSB 2DO0A 1Z2LA 4IG3A 2YQ3A 4KY3A 3GSDA 4OYZA 2UYTA 1MWKA 3SQ2A 2PDAA 4YDXA 4KFBB 4DR4J 3BKFA 5ADZA 1CXUA 2ZJQQ 3G6EN 3D2FB 1SZ2A 2AYMA 1X0PA 5A2QO 2J4RA 3K17A 3KKSA 2WBMA 2CPIA 4C9DA 1FD2A 2YX6A 4DS4A 1VHXA 3MCOA 4ZP9A 1NGJA 3MR7A 2J9EA 3QRQA 3OTBA 3OYAA 1NGFA 4LFAF 2HLUA 5HROA 9RUBA 4UZBA 4DR5F 1JJHA 1BWEA 1RFQA 3BKTA 1SC6A 5HMWA 3CCRS 5AQJA 3RB0A 2EFVA 2GS8A 4PXBA 2R7WA 1NB2A 1VSIA 4EGLA 3ONQA 3CXCM 3OLBA 4PWDB 2W4DA 5A0YA 2O8CB 5AQLA 1DQAA 3M6VA 3NMUA 1JL1A 4TY8A 3CCQS 4MLHA 2XYHB 3CCRN 3VR1A 5K14B 4BRKA 4KKOA 5K20B 1IKVA 2B9XA 1HHTP 2R7XA 4RWXA 1WOOA 4M5DB 4ECTA 2ZWPA 2MGZB 4IKFA 3DLEB 1T95A 2V50A 1C1BB 2ZFHA 4F50A 3SJJA 2WTUA 3TEGA 1GEHA 3HT3A 3LDPA 2DY4A 4J9VA 2YY3A 3ZZRA 1JJCB 3QZ8A 3ZSRA 3PIOL 5IWAJ 3CD5A 1MROB 1K0VA 3UKRA 4KHMA 3BZQA 3VEXA 4YUDA 2H4WB 5HAOA 3DCAA 2MY7A 1TL3B 3L2RA 1MN9A 5CQGA 2AP6A 2FBTA 3MMBB 1X8DA 3F41A 3K5MA 3QT7A 4LF7F 4CO1A 3KHRA 1KC8O 4EEYA 1NGAA 3FSIA 4WYBA 2GUPA 1IG8A 1HD0A 4DBQA 4JI2F 4X4NA 4CLYA 1RCXB 1U1RA 2FLLA 3CJKA 2ZM6K 1S97A 1S1VB 3MN5A 3PSIA 3PYGA 3VEWA 4WFZA 2QEXN 3CERA 4ILLA 2DXEA 4BWJA 4MKBA 5KG4A 3RG6A 1ZC6A 3J81Y 2P9LB 2HHTA 3MN9A 3NGRA 4J7CA 4DTRA 3HULA 3TZXA 3EZWA 4DG1A 2FVSA 1NOYA 4IKAA 2CAJA 4M5NA 4KAIA 4HR2A 3FGVA 3NFAA 4ECWA 1H2VZ 2IJRA 4Y2KA 4KREA 2FC9A 5E41A 2H3GX 2R7OA 3MUTP 2GJFA 1MSWD 5ETRA 1S1UB 2NSBA 1BQNA 2YNIA 2QIFA 3UKUA 4XH4A 3JSMA 5LT5A 1YTYA 3DU6A 3MAAB 2P9CA 5E3RA 5BYQA 5CZVA 1QE1B 1T3NA 2J0XA 3QWPA 4HI2A 1FRJA 4BDZA 4NLSA 2H5EA 4W5NA 1GLDG 1VDHA 3SUOA 3U1MA 3SUQA 4Y00A 1SCJB 4RUCA 2O8FA 2IDLA 3KK1B 4HUGA 2MZQA 4KQZA 4Q2LA 3VTIA 2LXUA 4PRFA 1HPZA 2LDIA 1OYDA 3VN5A 1F9EB 4JRPA 2OEKA 5A8RA 4ZPCA 4GMKA 2YJEA 1KOHA 1KONA 4GKKK 1J5EK 4IOAQ 3KOAA 1HHSA 5G0RA 1QLNA 4U95A 4CK1A 4WK1A 2ZHOA 1OS5A 3PNIA 3T5HA 4KE5A 1SV5A 1F3FA 3VEOA 3G71S 2XMJA 5HP1B 3RMCA 2FHMA 4DV7J 3AJ2A 1RT2B 2NRHA 3G25A 1KRPA 3D3CJ 4IO8A 1RWMB 2GAGC 4DMNA 1TKTA 3AO3A 4ER8A 3BYPA 3CTRA 2KH9A 5HJXA 4USJC 5D4NA 1IM4A 5HVHA 3Q2TC 3G71N 1KKHA 1FDDA 3HD1A 3MCNA 4CIOA 3DI6A 1G4CA 4ANEA 1Q9XA 3P38A 5SZTA 5HL7L 2CIMA 1NGDA 2OMOA 3QO9A 2Z2MA 1KQKA 4RNNA 4TNOA 3AY0A 3WDOA 3KJQB 5F8MA 2OPSB 4NCAA 3ALYA 4L3QA 4LC9B 2Z2YB 5HBMB 1YI2N 1U0SA 4N5SA 2YWKA 1N4LA 2HYIB 4CIGA 2F9TA 4OPHA 3SK3A 5DDRC 1S10A 4F4AA 5DM6Q 4AQYK 3EE3A 5ETVA 1VS3A 4LR9A 5KOWA 1UL3A 4F0MA 2VQEK 1JKHB 5I42A 3WXKA 3QGIA 2SXLA 4LFBK 2DTUA 2DGVA 2OFHX 4MQ3A 3OYJA 1ACMB 4ID8A 4LRCA 3HSDA 1YIJN 2KT3A 4CO4A 4K4ZA 4QOTA 4K4TA 4DHVA 1UZDA 2CGLA 3P1GA 2HGNA 1DQ9A 2A3ZA 4WFXA 3OR1A 1UEUA 2E88A 4JV5K 4Q7AA 2Z30B 3TP2A 2JFDA 3RW7A 1DRZA 3T1YK 1BQXA 4DR1J 5IV4A 2LMIA 1X4GA 2XYPB 3IWLA 4DV1F 2KZZA 1BISA 4HACB 3UN5A 2WB4A 4P72A 5F9LA 4C6AA 2VPWB 1NJWA 1ZBHA 1FESA 4NASA 4NRUA 3CQ8A 3ENOA 4X84A 5KFIA 3HPHA 2NYHA 5KFVA 1VSDA 2J6SA 3CMQA 2V8VA 2H4YB 3CJSA 4DX8H 3BGRB 2H3EB 2DH8A 1I6JA 1TKDA 1S1TB 4NLOA 4B3SF 3KK2A 3KWIA 3OSNA 4OPKA 3KKFA 3QMQA 2QM1A 3UCZP 1S0NA 3UCGA 2V4JB 4CDIA 3OFFA 2D3ZA 3G4SS 3QESA 5M1PA 1KP6A 3L7PA 3M8PA 2X6NA 3LDSA 4BRGA 2AD9A 3EGVA 3FUYA 3HBTA 1YJVA 4ZKAA 2J6UA 3RAQA 3M8RA 4DQIA 3QNOA 2MSTA 1RT5B 3ZSVA 3E66A 3NHGA 3G4SN 1BI4A 3ZT2A 1WSHA 1NSKL 1L3UA 1IR1A 2YHAA 4U7BA 2PFUA 2FJBB 2QLWA 1T9VA 4DI6A 3V4IA 2B5JA 1UWBA 3WQTA 2XYGB 3GPAA 4DX7A 2VODA 3CJ8A 1EQ0A 3OR2B 4ILMA 2NXJA 4K50A 3WC2A 2BJDA 5IC6B 1IBLF 3KLFA 3HLUA 4O0NA 4X64K 2AEJA 4BRNA 1Y00A 2XNQA 2ZH8A 5FPEA 2DHAA 4IOCL 4MIWA 4IG3B 4NZ6A 4FLTA 1OVQA 3PIPQ 2HHXA 4NLVA 2D7SA 4KH1B 2NLXA 2HGLA 4FJ5A 4LQ9A 3R8EA 4KGMA 4ES1A 5LJ3Y 2J5AA 4ED3A 2GZOA 4I56A 4A2AA 4I6WA 1X9WA 4CWBA 1RBTA 5KI6A 2IVPA 4BG8A 2RQMA 1GQEA 1MWZA 2A0FB 3I32A 3EE9A 4B3MK 3MGJA 2G8HA 1KVIA 1CQNA 2O66A 1WSVA 1C1AA 3A8EA 4FVUA 4Y2MA 3NGDA 4D3GA 4DU7A 4UW2A 2F8HA 5HROB 4K4VA 4JP8A 3OPKA 3M5RA 2BJ8A 3BO2A 3GWCA 2AX0A 2GWJA 4LF8K 5AQPA 2P9PB 3GR1A 2AV5A 2E1AA 4UOGA 1IBMF 1FRIA 4ECQA 4DR2K 3QFPA 1GTHA 3TJ9A 1H6KX 2Z56B 4DWIA 5A0YB 2JGUA 3IA0A 2G0CA 4KGXB 5AQRA 4TY8B 4O44A 1AFIA 2XWXA 3DAWA 1K73O 3MD1A 2NRTA 2HVDA 3A1YG 1IKVB 4NYPA 2CKWA 5CD4A 3CB4A 1QM9A 4B3TF 4FLVA 2UUWA 1NZ8A 1Q18A 3BO4A 1WC6A 3G2XA 2HWHA 3VWSA 2P6TA 3RAXA 4NX9A 4U67L 4C11A 2LQ5A 1SUQB 3RMAA 3PW0A 3HSGA 4RPFA 2MXYA 3UKRB 1NM2A 4PKDB 3VESA 5KG1A 1W26A 3D6RA 1VK8A 3EL2A 2VC0A 3AVJA 1IVZA 1NB7A 4CLTA 5IV3A 4KBOA 1U1MA 5DZ7A 2WONB 2YHWA 5KFXA 5IOLA 4NE9C 1RAHB 2GIQA 4EAHD 4EU0A 2KG1A 4CH0S 4DV3F 4N77A 1UAWA 2IVOA 4KBIA 1REVA 4L8RB 1IWAA 3LP3A 4CJEA 1V3ZA 4CJQA 1WWHA 2C2ZB 3VF2A 2UXBK 3EZ5A 2OSRA 4JI8F 5KFPA 4I7FB 3CJKB 2KXHA 4JOUA 3E3XA 2YPYA 1GMWA 1PJ7A 4KGZB 5AXNA 3CD7A 2VDHA 4Y6IA 2WB1D 2FJXA 4C23A 4ZP8A 3ZYYX 3HPOA 2HS3A 4Q2MA 2BM0A 2F4VF 2IRUA 4Z0UA 2HQGA 2RS2A 1U2VA 4DG1B 3C46A 3FBBA 3BSOA 1H0HB 3KXDA 2Z8QA 2CJBA 4DR3F 2R7UA 4OGCA 1M5VC 4RO0A 4PY5A 2DKOB 3FKBA 3GJRB 5IZHA 5JS2A 1IBKJ 1FJEB 2FF6A 1GFWB 1BQNB 4CP5A 3D6TB 4FK2A 2ZEJA 3O3GA 3HSZA 3UKUB 1ZM3A 3JSMB 1PO6A 1TVRB 2CNNB 2HFOA 1UVNA 1EAYC 3MPYA 4G3IA 4X65K 1WAJA 2I0XA 3N01A 3LPTA 2M2BA 4WQ5A 3HVWA 2O8FB 3BQ2A 3T5LA 1NK4A 3ISND 1RAJA 4ZCLA 1NK6A 4MIAA 2AYBA 3CHWA 4RW7A 1HPZB 3OL9A 3QATA 3KIOA 4G6VB 4PEOA 1HARA 2P5GA 3GU0A 5A8RB 4CD3A 4ECYA 2D74B 2MKKA 4HH1A 3UIQA 4DUYJ 2P9KA 4LF1A 3NH0A 3O6QA 5G0RB 4HHUA 3IBFB 1JCEA 3RJMB 4IO9Q 4YN3B 2P9GA 1SV5B 1RHMB 3D3BJ 5LJ5Y 2M8DB 2XGPA 2BBEA 1TK5A 3TU5A 1R6YA 4KHPK 5D4LA 5C2FA 1NU4A 3KNGA 1TKTB 3VALA 1V9OA 4BVOA 3CCSS 2R2UA 2LFVA 2B4PA 3NS7B 1JQGA 1SS6A 4RX6A 1DQ8A 3OL7A 4GY2B 4K5RA 4NLTA 2F96A 1I3AA 3L2UA 4GKJF 3UDEA 1FDNA 2CJQA 2NZCA 1KVKA 2N4DA 1OQ3A 5C10A 3MTJA 5AQXA 1UVJA 1RTDB 4FKYA 5U47A 4OI1A 1QVGR 3QO9B 4H5VA 2ROPA 3CCSN 4DJBA 1JXBA 1BG3A 2RIJA 5F8LA 4QIGA 3RWUA 3R9PA 4KH6A 5DJBA 2L41A 3TTCA 5HATA 2Q1NA 2W24A 1R8HA 2Z4PA 1N36J 1AT1B 4OI0A 2XMMA 4DR7J 4M42A 3BY5A 2QGFB 4GVLA 2YQ0A 3MHYA 5I42B 4X4RA 4KPYA 3JS9A 2R2SA 3QT6A 2RPIA 2LXFA 2GIRA 2VJUA 2AZ1A 1ILYA 3I96A 2HNZB 3CSKA 4EFAC 4OKEA 3OHRA 5FJ4A 1G3OA 4CO5A 1P27B 4NYZA 2O5DA 4FF4A 2UUBJ 1NDKA 4C98A 3KHLA 3E1YA 3OR1B 3O8WA 4DF8A 2CPHA 3PCOB 3LUYA 2ZWHA 2MHNA 3A3PB 3HHKA 4JD2A 3DGVA 1RCHA 2AMCB 4WXWA 3NRBA 3TWHA 1MNEA 1TGOA 2V6AA 4I9QA 3F9KA 4CW7B 3HF5A 4LFAK 4DTXA 1U48A 1M0SA 5DG9A 4JI6J 1FCAA 4UF4A 2ATLA 1IKXA 4WZQA 3VAMA 1HI8A 2Z1GA 1YHQS 5CABA 2BQUA 4CECA 2CH6A 3C3LA 5EX3A 1HI0P 3MMAA 4CLSA 1R59O 4QWBA 4TU7A 5HRNA 1ZBLA 4TXSA 1PC4A 2Q3SA 2RVJA 4ELUA 4CK2A 1V4TA 4CF2A 4RW6A 1R0BG 3ULEA 4DV6J 2KI2A 4RUBA 4FJLA 3A4TA 4JI4F 3G6VA 4QR1A 1F60B 3M8PB 4O3NA 4A8MP 1YHQN 2OLWA 4FS2A 3Q8UA 3M6WA 4FZZA 3L2QA 4OJRA 4CHPA 2GWKA 2V8GA 4O3PA 1LV5A 3TANA 3AT1B 3CE8A 2VCPA 1LWEA 4NXMF 3KK3A 1WNSA 4PAAA 1BI4B 1V3SA 4QYZJ 2RDIA 3O9QA 2A1BA 1FRLA 2V4RA 3CC7S 3V4IB 2B5JB 1RWOB 1UWBB 1Q8KA 3RRHA 5EN1A 2VU5A 2MKJA 4N41A 4LH5A 3K8WA 1F21A 4CO0A 4ZMMA 3GV5B 1SIZA 3MDQA 3TSUA 2DGOA 4GV9A 4WIIA 1HBNA 3KLFB 2W2QP 1EKEA 1EB0A 4LF7K 1DBDA 1VQYA 2RDDA 2KB2A 5JMVA 5EX0A 1SKUB 3DDKA 4K4XA 3V9ZA 2ZUGA 2PFFB 3LOUA 4YOWA 3V6HA 5KFTA 1J53A 1RSCA 4ZJOA 4O0JA 4CHOA 3BSNA 1Q7YO 5I9EB 1TTHB 2NUUG 2R8KA 1S5JA 2DR6A 3HTVA 2CRLA 3PM9A 3AO1A 4B1YB 3OYHA 3V9UA 1VR6A 2DXDA 3D7SB 2D1KA 1F5CA 1JK9B 5GIOA 4AHVA 1YJRA 2QV6A 4UY85 1JXEA 3RUBL 2XS7A 4AXJA 1KCFA 1XWLA 5ETMA 3WXJA 3AY9A 3MUMP 4W5TA 3BZCA 4B9SA 4X66F 4PZVA 3EZOA 4JI5F 3BPSP 2ZH6A 4M3XA 3B4MA 4CLZA 4I2PB 1ZAVA 5AE2A 1YRUA 4J9NA 3VTHA 3MEEA 5E0OA 4MKAA 1A7GE 4IXCA 3QQCD 1NJZA 1WHVA 2C3MA 2BOPA 4F9OA 2EW9A 3M7VA 1UKUA 2HRUA 4OIXA 3AVLA 2ZVIA 3EYZA 4BRMA 4O44B 2DRAA 3OV7A 2RH3A 4PXEA 3EPGA 4UUXA 4PCQA 4KI6A 3AA2A 1CXQA 4KSEB 1HKGA 1XR5A 1Z05A 1HNZJ 4NEZA 2O4IA 2C2NA 3ZTQA 2AEFA 4OHXA 1RGIA 3ILIA 1QDUB 3FMWA 1XMQF 4C11B 4L6V3 4NI2A 3DLRA 4U9RA 2VKRA 2UU9F 2CUYA 5AQTA 3FBFA 5L9NA 4NXNJ 2G0IA 1O8BA 2Y3YA 2VIHA 1NGCA 2UVRA 3QEVA 2DGXA 1Q7YT 1GLLO 4M3ZA 4AHRA 1N32F 1ZXOA 3P8BB 2R9LA 1PSDA 4H0XB 3GIIA 1N54B 2YKPA 3TVKA 2LU1A 3SV4A 4BBYA 4NZ7A 3KHGA 3CC2N 1REVB 3QGGA 3CJTA 2OANA 1PJ6A 3AVBA 1RT6A 4FWOA 1HMVA 2GBZA 2OPRA 2O8BA 2M7SA 3DRYA 3ATUA 2JVOA 3UN3A 2C2OB 3PSFA 4ZIWA 3EJMA 5AT1B 2EBEA 1T9YA 4LUBA 2EPIA 2M88A 3MECA 4GMJB 3EMTA 3OFEA 4HHHA 4ED0A 2BYCA 5D77A 1RGVA 2ZJPL 3DXSX 1U2VB 1LOUA 1XNRF 4JV0A 3ELHA 1VSFA 3VZIA 4BQLA 5H1SQ 2G8IA 4OHVA 3FBEA 3EVOA 3IRWP 1GLFO 2ADBA 1U2RA 3K58A 3QB0A 2G8FA 2GGPA 3FZ2A 2MLXA 4CZEA 1PYOB 4K42A 2GHPA 5C7PA 3NCIA 1I94F 2FXUA 4USWA 1DEJA 1NWKA 1SIWB 5LL6Z 1VQ9S 1IM6A 2X3DA 2P9EA 4OYAA 5AQYA 2Z57B 2HMPA 5BRFA 3CCJS 2YWWA 2DFHA 4KH0B 4USTA 3R5AA 4ZPBA 1UPPA 3CDWA 1Q81T 4RW7B 2CFXA 2N4CA 1FW6A 4DV1K 2FJDB 2A42A 3P96A 4PWUA 3VQQA 1CJVA 1VQ9N 3BN7A 3TPQA 5LOQA 5K5MA 1KLNA 2P9KB 1MU2A 1Q16B 3N5FA 1X0FA 3EGNA 4N7TA 1UCNA 3R6GB 1FRHA 3CCJN 2Z1JA 1VC6A 4F02A 2BE2A 5FPMA 3LO3A 3KJNB 1VIXA 3J7Z5 3TO8A 4B3SK 2NNWA 3N28A 4MK7A 2WK4A 3ZX2A 2MZTA 2QTWA 4FYWB 2YWHA 3FCHA 4CFDA 2ABYA 4WP9A 2HVIA 4Q0BA 2ZOFA 2RSQA 4KHYA 4LF6F 1T0TV 5JLFA 1FVQA 1QHTA 2HHHF 4FO0A 4LRAA 3OYCA 1K44A 3ZT0A 1G2EA 2DPJA 3M9OB 1U25A 2CNOB 3W61A 1UFLA 3DHWC 4BY9C 3NCQA 1W9HA 3L2VA 1VHIA 1SBRA 1RAEB 2YKAA 4K43A 2A18A 3OL6A 3V6JA 4OYMA 1HFEL 2ZBQA 4M95A 3S9HA 4JK8A 5BXIA 2NLWA 3D2EB 4I69A 4LFCJ 2J0WA 3FZLA 3R5BA 3SFUA 5KFGA 5M1OA 1IBLK 3RBZA 3R5DA 2XY7A 4OLPA 2R4FA 3DNCA 3FFIA 3O5TB 3PZPA 3PHTA 4DL6A 3I0SA 3GCXP 1OWXA 4MFBA 3CCUS 3GIRA 3FMBA 4A8XA 5CR4A 4ANDA 4XDDA 2D9PA 2M4MA 3BQ1A 4WF9Q 4DSEA 2W4CA 2OJ3A 4YOEA 5KT4A 2HB5A 1YZ6A 3W8PA 5GAHI 4A8QA 3CW2C 4CZIA 1R8AA 1F9FA 3ZZUA 2ZDOA 2EC0A 2A6AA 1RWWB 2KYXA 3CCUN 5B08A 2I2YA 1Q82O 4JD2B 2PT0A 4ZK7M 2QG9B 4OMFG 4EYHB 1J5EJ 2Z58B 4WYLA 4Y28C 4M3YA 4J91A 2XLJA 4DX6A 4O55A 3CYMA 4OYIA 4NLGA 4FBUA 4D3HA 5I3QA 1IKXB 2YKOA 5J2PA 4NA1A 2BACA 1WC1A 3GIKA 3W7BA 2MB0B 3BGFA 1RCOB 1R8PA 2CZVC 3W5XA 2DHGA 3CDEA 4ZN3A 1IBMK 4KI4A 3MMAB 5CXTA 3QBWA 3D7EO 2C2EA 1H98A 3KDOA 1ITPA 3ULEB 5JVGQ 2A6OA 2GMLA 1YBTA 1YBUA 2HHVA 3GBTA 4CI0B 1R0CB 1S49A 5L8RC 2MDAA 3MURP 5M1NA 1NBWA 3DMJA 2G2ZA 1BWVA 3E9OA 4K0KF 4B3TK 2DHHA 3EDRB 1LWEB 2KKZA 1JLFA 3SYZA 3JQKA 2GEMA 1S4FA 5IFMA 2NZTA 1HWUA 3CJ9A 4ZP7A 3Q8YA 4QPTA 4CZMA 4O3RA 5DGAA 2HQFA 3Q8PB 3MXMA 1YJUA 3QZ7A 4FK0A 2R7RA 1HR0F 4OI6A 4G9ZA 1HNXF 4A61A 2VQEJ 3IGVA 5HJYA 1NGEA 4BACA 1HBNB 1RT7B 3D2WA 4LFBJ 1RWVB 1WB9A 3QWUA 2UXCF 4DV3K 5B0GA 5AE3A 4QW9A 4K59A 4PYDA 1YXQA 4CM2A 4YOVA 2RB7A 4JI8K 3HT0A 3UDLA 2HHSA 4JV5J 1RT1A 3NAIA 3VAFA 1HW9A 1MW7A 5IQQA 3T1YJ 1RBVA 1VQ5N 5HLFA 2V9KA 5GADU 3UVJA 2B9YA 2D0PA 1URNA 3M8QA 4LQ3A 3HHDA 3NEKA 1OYEA 4DPWA 3PJWA 4FLZA 1TQLA 2F4VK 3AARA 1P90A 1ZA1B 5AXKA 1IV0A 1Z26A 1RBRA 2R2RA 1DTQA 4N56A 3KHYA 5GAHP 3QLHA 1Q8IA 4DR3K 4YDUC 2J8SA 3GTYX 4AUKA 2YX4A 2FTRA 4LIRA 2FVPA 3S01A 1S57A 2DRDA 3KD1E 4JI3K 3MEEB 2BX6A 1FXRA 1UEVA 5T14A 3BBCA 3U7JA 3UWTA 1QQMA 1X4FA 2OIHA 2CPEA 4BE0A 2R7SA 2K2PA 2VJVA 1KFSA 1Q5VA 4HTLA 3FK4A 4CEOA 4JI1F 4ZCMA 3F9MA 3HP6A 1U1LA 1XN9A 1W97L 2M0GB 2DO4A 4RNOA 4CFBA 5FROA 1CZAN 2CDRB 3ZT1A 2FUG9 2FZCB 3PO5A 4KPCA 4K8RA 2KDOA 1XMBA 2DH9A 3FZHA 4NI2B 3V1QA 2ERRA 3IDHA 3EUNA 1T9UA 4FP9A 5DLGA 2VWBA 4H5WA 3VAIA 3T19A 4X64J 3HFVA 3HVAA 2ALYB 2DY9A 2LA4A 4C3MA 4FYXB 4KB7A 1RT3A 4QAGA 2DGQA 1S4EA 4DEZA 4ZTJA 5AQQA 5I3UA 4PR6A 4XK8C 3TUJC 2CH5A 4DL2A 3CCWA 4ZS6A 2HIYA 3FR0A 3GG1A 3JSRA 4FNHA 2YKMA 1YJTA 2HVZA 5K8NA 4GKJK 3G6YA 1RT6B 2Q6CA 5CZ2A 2I9SA 1HMVB 2OPRB 4YHHF 1T03B 1Q86T 3D45A 1TUGB 1Y97A 3RYLA 2O8BB 2RAQA 2J8AA 4B3MJ 1KVCA 2RKIA 2F40A 1NGHA 3R8YA 3IWXA 2YCHA 4JV2A 4KH5A 2W01A 4IQXA 3L4QA 3MECB 4U7UK 4WE1A 4DPXA 3NGSA 1U1KA 4OHZA 1WEYA 4FK4A 2E5LF 3AGRA 4LF8J 5F9NA 2AA4A 3CJCA 5RUBA 2BVZA 1RDDA 2UXDF 1RTHA 2FF3B 2AGOA 3CIMA 5KFCA 4DR2J 1V6HA 4QS7A 2GGPB 4DFJA 3IAM9 4R8UA 5BYSA 1UJ4A 1X31C 2LP4A 2V8DA 5A6PA 4FJHA 3BQ0A 3K89A 2JDJA 1U2FA 2DGUA 3KTQA 3RTVA 1G15A 2MMYA 1RISA 5E3CA 4MDBA 2GA7A 1U04A 1TUYA 1RTJA 4AXIA 4K2JA 5KT3A 2QW9A 4DV5F 1WF1A 1C2PA 4PKGA 2VPZB 4BRIA 1L3SA 1O5JA 2VC1A 2V8HA 1N33F 1DAXA 3A8YA 4HH0A 2RS8A 3QJPA 5KFLA 4YOUA 1GLCG 3BB5A 1CJVB 3P4IA 3KZBA 3HSJA 1NJXA 4LMZA 2KHOA 5LJVA 4P2FA 3MD3A 5CYMA 1MU2B 4X4VA 4ZVPB 2DNMA 3ENHA 3CO9A 1Q7LB 5CAAA 4PXDA 1KHWA 4DUTA 3G87A 1S0OA 5AQNA 2IM1A 1UVIA 4F8RA 4ZDNA 1JXLA 3ZSXA 1RDBA 3OW2R 4OQJA 5CCLA 4Q0BB 1FJ7A 2HVHA 4JI4K 2EFQA 4I1TA 4J2BA 2UXBJ 2JEIA 1QQCA 3VQTA 4AL5A 1EETA 2JJ4D 2GHWA 2FZGB 4IFVA 3MPWA 5AZJA 5F8JA 5C5JA 4NXMK 2IDOA 4RR5A 1RQ0A 1BUXA 3N6NA 2B4JA 3D6MB 2F7VA 3TAFA 2OHDA 4EBEA 2N7CA 3LDOA 4ISFA 4U7CA 4Q8FA 2G8UA 2QLJB 5DQHA 5B0EA 1Q78A 2BKPA 2NXEA 4WBFA 3WC0A 1CLQA 3L7UA 2DNNA 2ZWOA 3FFIB 1GH8A 3SCJE 3I0SB 4MFBB 1GLJO 1PBUA 4Y2CA 4UQTA 2XM3A 2WTFA 4CJVA 3NWGA 4DU8A 4DOZA 4X65J 3OYMA 3JSBA 2CQGA 3AAQA 1TK8A 3RZAA 1KTQA 3M3ZA 4GV3A 3DDIA 4ZPDA 4IJAA 3K5NA 5G4DA 5LSLA 2Y1JA 1FX4A 3Q89A 1NHUA 3I8DA 3M2RB 1PIEA 2HW3A 4FVMA 2ZZTA 3G8QA 5FPNA 2POKA 4X66K 5DMRA 5HQ8A 4JI5K 2YH1A 4ISEA 3T1AA 5J2PB 4FVCA 4YOXA 5E2QA 1FO1A 3VHQA 3GP9A 2LDYA 1RWPB 3A8KA 3WZ0A 5B0DA 1S22A 5M1KA 4C8YA 2CJKA 5LL6d 3PFOA 2YXLA 1LW0A 4O3SA 3FE1A 1HWKA 4EP5A 1N6QA 3I6PA 2XZTB 3HXMA 2ZDPA 2IYGA 4YQWA 4DSIA 1NXIA 4KV8A 2N3LA 4FWKA 4NL5A 2K7JA 2D9OA 1XBWA 3DMJB 4DN0A 4ZLNA 5KFOA 5E26A 1N0VC 4JKEA 4IR9A 2DEIA 4FW1A 2L48A 4DMZA 1V3RA 1JLFB 3D0HE 4LD0A 1XMQK 3D1OA 4B9LA 2V8PA 1KVAA 2BDPA 2Y0SD 1R6VA 2OCEA 2UU9K 5D78A 3PTWA 4G65A 1QUVA 3NGTA 1ICEB 3DXBA 2Z2ZA 1EX4A 4EK2A 3A3OB 1M1GA 1OQ6A 1S12A 1G1XA 3RVCA 5D8HB 3T69A 4HI1A 3BH7B 3OJSA 1NU0A 1HKAA 3JAMU 1ZH5A 3DJCA 3CFPA 1JLBA 1QSLA 2Q3PA 1JNZB 5KFEA 1HYSB 3W2VA 3NAEA 2XSFA 2XEXA 3HFKA 1SXLA 2G9OA 5HLFB 2V51B 3UVJB 5AQHA 3C14A 3MF5A 3M8QB 4EBCA 1KAZA 3TJAA 4LFAJ 3CJ7A 1BCOA 4DR5J 4PUOA 1B0VA 2CDQA 4ZHRB 1XNRK 2V68A 1JLCA 2ZBRA 3O1LA 3QLHB 3BJYA 4PYAA 2IJNA 4UTGA 2O3DA 1H73A 4E1MA 3MUVP 2G0JA 2JLFA 3F44A 2VL1A 3FVYA 3NNAA 4B1XB 5KFKA 3CCVS 4H5TA 3TAGA 1MMNA 3ILJA 2IHR1 2DGWA 2LU2A 1KVBA 2BANA 1JCFA 4G1IA 3L3CA 5FRNA 4JK9A 1SH3A 4WFYA 3MPVA 1I94K 2IDEA 4CGGA 2DGTA 4FJXA 2XI3A 3KG1A 2R8HA 3E51A 8RUCA 2NCKL 4ZVEA 2OYQA 1AZSA 2AJQA 1RB0A 4ECRA 3RB4A 1HKBA 4IFYA 3BGOP 3TA2A 3BF3A 1NSAA 3GE1A 1S9GB 3RW6A 1Y0HA 5TKWA 2PY5A 2KW4A 4ZN1A 3CD0A 3LP1A 4RU2A 2VF3A 3BUZB 2V2VA 2V7ZA 1FXLA 2LECA 3MOZA 2YWEA 1TKZB 5FLXO 3IRXA 4LF7J 4CHNA 4F7VA 3HMJG 1NDCA 1RT3B 4M5JA 2PAVA 2YVSA 3O3LA 4FM0A 3DRXA 1WSIA 1BCMA 5GVQA 5THWA 4LF6K 5I3UB 4JI2J 1S99A 4N8OA 3R97A 4RZRA 2HHHK 4R5PA 1F3VA 1NG9A 1HQ2A 3PIOQ 1EQMA 4IRKA 1QAJA 2XLIA 1YAGA 3PW4A 1RHJB 4LR7A 4EYIB 4FJKA 2HQDA 3Q8SB 1FKOA 5T41A 1WG1A 5I3PA 3ILLA 4RBVA 3CJAA 2E1CA 1LAWA 1YVNA 4V19J 1CPZA 1NGGA 3P3DA 4CNZA 4WE1B 4ILGB 4IDHA 1NM1A 5A76A 1NHKL 1SKWA 2QMWA 3I31A 2RMLA 3GILA 1VQPN 4NLWA 4M94A 3D66A 1RTHB 2Q2RA 1O0PA 4C0OC 1X7VA 2RUGA 4R8UB 1SJ4P 1VRUA 3AA4A 1X5SA 1GAOA 4BE1A 2ROEA 2E1MC 3M32A 4DFKA 1CULA 2YNFA 2BJEA 2FIUA 5DK5A 4OZJA 4LSNA 4A5AA 4LF2A 4FJNA 4F3OA 3RBEA 1RTJB 2KO1A 1DTTA 3GOIA 3NF6A 3ENVA 4CFAA 1U1QA 3BDPA 2WBRA 1WSGA 3OS2A 4DV4F 3FEXB 2EC2A 2H65B 5E5NA 1CZBA 3WX4A 5KFUA 4HYKA 2FQQB 5CYMB 5KG0A 3TVZA 4M1KA 3MOJB 4BE2A 1R3NA 2ASOA 3O8MA 1ZAXA 1RNHA 4J37A 2RRNA 4C48A 2D0BA 5B0FA 1AB8A 1YX2A 3UNYA 4FWQA 4ZPAA 3EE8A 5GAHU 5HK4A 1HD1A 3HX9A 2XMVA 3IMQJ 5KRSA 3U9ZA 2YKNA 3ISNC 1FTRA 1EETB 3HSTB 4K0KK 5C2CA 2W25A 4IFVB 4A62A 5AZJB 2UVUA 2DJWA 4Q43A 1MLAA 3D54A 4YR0A 2OFGX 2FVRA 2BA9A 2FLOA 3DYAB 2D0OA 4Y0FA 3AA9A 4V1Ak 3ZZOA 2F7TA 4CHQA 1VQ8S 3IS9A 3R9LA 4R0EA 4KJIA 1ZBFA 4OPAA 3NH2A 1HR0K 1UZHA 1HNXK 5GINA 4QCLA 2ZBIA 1F2HA 1WEZA 1TELA 7AT1B 2NRWA 2HRYA 3VPZA 2F8MA 1URRA 2YH0A 1B0PA 4TVAB 2XSJA 5HL7Q 4W5QA 3CJ2A 5B0AA 4Z94A 2UXCK 2FLPA 3LDNA 2QL9B 3R1LA 1W25A 3CMES 4DR6F 1BUPA 2GMHA 2Q66A 2EKNA 2HBQB 2OUGA 3QINA 3AOCA 2ZF5O 1RHUB 5DRKA 4U6PA 3JAMY 4IWVA 3VGMA 3V6KA 4RWTA 1TL3A 1YF5L 2QA1A 3T5KA 3ATVA 3C0BA 3SQ0A 3VF6A 2EX3A 4DV1J 3CMEN 3SSQA 3QIPA 3IM8A 4DPTA 1Q8BA 4FF3A 3I4PA 4DPOA 2NRXA 3OYIA 2A1SA 2LQJA 5IQ6A 1B4SA 2DNLA 4B1WB 3Q8VA 5KFYA 2C1EB 3NGIA 1KNZA 1TFWA 3M9MB 4AHCA 5D0GA 2W42A 1B99A 4LRBA 4B3SJ 1WORA 4IH7A 4TYAA 1U6BA 6AT1B 1VQ7S 3NBPA 3MXJA 4LVNP 2UZAA 5IT4A 1LW0B 2R7QA 3CGIA 1HHQA 4DCOB 3RBXA 1SJRA 2HIQA 1FWPA 1AW0A 3UDCA 4E3SA 4OX7A 2FSKA 4KV8B 4JI1K 4WKYA 2GTDA 4KO0B 3W0LA 1TL5A 1VQ7N 4DN9A 2V2QA 2PYJA 4FCYA 1NK5A 1LQ9A 2CJXB 4CZCA 1K9MO 2O1PA 1O1WA 2DNGA 2B8QA 1JNRB 3HHNB 4BQZA 1WC4A 4Z4FA 1VOMA 5KT5A 1XHXA 3OA9A 3VF4A 3MAAA 5T7LA 1IBLJ 2ZZNA 4J9PA 3LDQA 1LOTB 2E5GA 4CF1A 2QLXA 4U8VA 2W2PP 3EY1A 1WG4A 3VAHA 3O4QA 3CCTA 2HBJA 1TU0B 5AQOA 3GQCA 1M5SA 1NJIO 1A0OB 2HF4A 4CEDA 3W63A 5H9FK 4XIUA 3A5NC 1I1GA 3FRZA 1JLBB 4GNIA 4FNIA 4BR5A 2GW8A 1RTZA 1VBXA 1JX4A 1ROFA 4YHHK 3TVYA 4PA1A 1FHTA 2FC0A 2Q97A 4W5OA 3BEXA 3NMAA 3W2VB 3D6HB 2YNGB 4JI6K 2M52A 4RG8A 2YV0X 2RF2A 2HS4A 3QBXA 1MN7A 5IT0A 2BUNA 4IDKA 3NP5A 3NGYA 1X4EA 1DARA 4W92B 4DTJA 3PRDA 3C14B 1HL6A 1YTUA 4PUOB 4P52A 1LW2A 1JLCB 4MJKA 5FIIA 4HUEA 3ZXWA 3K9JA 5BPNA 5AQUA 3VGLA 2UXDK 1R0AB 4AD6A 1VQ4S 4C8ZA 1IBMJ 3QFHA 1RWUA 3BBBA 4C97A 4PWWA 1J2VA 1BHLA 3DFEA 1KHVA 3FC9A 2BANB 1NCLA 1K9MT 3TZWA 4WU3A 3K2PA 4P73A 1WSRA 4TU9A 4H03B 5LSRA 1REGX 1JIHA 3CT9A 1SQFA 4QYZK 1VQ4N 4B3TJ 1YLXA 3PRVA 1XR6A 1RYRA 4IBNA 3O4WA 3E01A 2ZGZA 3BZKA 4O5FA 5IM0A 2KT5A 3HJVA 3THPA 5KFJA 1AZSB 1VQOS 4DV5K 1JKHA 3SI6A 4IFYB 3MEDA 5KPTA 5AXLA 1KEKA 2W4PA 1N33K 2F8TA 2R8IA 3QIDA 2JWKA 1U6FA 1NJIT 5KG7A 3LP1B 1Y64A 2FHJA 2VQFF 1X5TA 2KFYA 1VQON 4DTSA 2BTFA 2FBXA 4KHQA 4A5BA 1IUJA 3BSCA 2E7VA 4BVPA 2C2RA 2JSXA 3TX8A 2MQNA 2DK2A 2OELA 2JHEA 3ZZTA 3MX2A 1OY6A 3M2VB 5MLCQ 4U67Q 4CT9A 3AVFA 4R5PB 3VQPA 4JI8J 1S0MA 4E8UA 3NMRA 3IC1A 3SFGA 2HZVA 1WN7A 4FKXA 5DQIA 1I5OB 3DLBA 1FKOB 2R3VA 1H72C 4LF4F 3OYFA 1N5VA 2F4VJ 5A6WA 1U4BA 3VEYA 4ILRA 5D0RA 4EHUA 1NK0A 3HP9A 1N48A 2QZ8A 3PDNA 4DR3J 4M5KA 1FKAF 3L7OA 2WCXA 4JN4A 2ASMA 3O9UA 2OD4A 3VQEA 3MTKA 2AKWB 1FKPA 2BE9B 4CT8A 2ZZMA 1AUSL 5IS2A 1NK8A 5KG6A 1H1VA 1KAYA 1OY9A 4DV2F 3HK2A 3B8HA 3R6LB 2QXFA 4WFAL 5BRHA 1D3WA 1VRUB 2ZH5A 1HNZK 3P5JA 3M32B 1CULB 3KMSA 2YNFB 4ED5A 1Y11A 4I0WA 1LCUA 1VC0A 3MXIA 2A41A 1YRTA 2ILZA 3SQGA 4LIWA 4K7QA 4IYQA 3GCWP 2DR9A 5KFAA 1DTTB 3PV8A 2AJ1A 4XTTA 2WW4A 1U1NA 3QGHA 4FF1A 3ISZA 3J8AA 1VQNN 4O3QA 5LMUF 4FPBA 2LEBA 2E44A 3I56N 1H7WA 3DLLL 4CQ1A 1M1HA 4CZLA 2YPZA 3CJBA 3RAMA 3D1HA 1HKCA 1PC5A 5CD4H 1TP7A 3E9LA 3SBTA 3AVMA 3SCXA 1S1XB 2F65A 3SAGA 5EDWA 1QAYA 3ZTSA 4RL1A 3CEDA 3NXZA 2OD6A 3PJXA 3EKUA 1GLBG 3JQJA 2BUPA 3BSAA 4JS5A