1VRUA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
537
structure length
525
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 138
structure length 525
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vruA05
4KB0A 3C6TB 1Z25A 2AX0A 2HB5A 3NGDA 4DL6A 2BANA 2WONB 1JIHA 1WNSA 1ZBIA 2VG6B 5E41A 3AVJA 4OLBA 2YNFA 4ED0A 3ZCMA 1RT3A 3MAQA 2XY5A 4KREA 1NNDA 1T94A 1UOCA 4CFCA 1DLOA 2RDIA 3OYDA 3G0ZA 3VQDA 2BRLA 1BGXT 1RBRA 5KG3A 4KKOA 5KFKA 5HROB 5C42A 2D0AA 1MU2A 2GIQA 1TQLA 1TKDA 3MEEB 5KG4A 1VSLA 5EUHA 2HNZB 4J9NA 4CEEA 3L2WA 3OLBA 3L3UA 1L3SA 3NAEA 1VRTB 2X6NA 3KLEA 3OYEA 3H5XA 2B5JB 4GC6A 4IRKA 3I0SA 4K8ZA 1KHVA 1MMLA 2WTFA 3PX6A 3RMCA 4B9SA 3EPGA 3BSOA 5J2MA 3QEVA 1XWLA 4CF9A 3DMJA 3CDWA 2XO7A 1RT6B 1RT5A 3RRGA 1K1QA 4FLYA 4DSLA 2GBZA 5I3UA 4RNFA 4DFPA 2DY4A 3OL9A 2D5RA 3CFOA 3GIKA 3PVXA 1IKYA 1N5YB 1IKVA 4RZRA 3V1RA 4CGHA 1KLNA 4QWAA 5KI6A 5KFDA 1S4FA 1HQEA 3LP1A 1FK9B 1VSJA 1RYRA 3SFGA 3MR3A 3NH2A 2A1RA 4TYAA 4ECYA 4CIEA 3HVWA 3C95A 1TKTB 2IJFA 1WSFA 3DRSB 4CJPA 3BGRB 3VQCA 3LAKA 4NLVA 5KFHA 4M3RA 3ZSWA 3OL6A 3VQPA 4RUAA 3SZ2A 5KT3A 4ZHRA 5KFEA 1GOAA 4J9QA 4KTZA 1S1VA 4OVLA 3TARA 3SNNA 4FM2A 4EEYA 4F3OA 5J2NA 3LZJA 3DLEB 4JRPA 1RA7A 3GV8B 5DGAA 4BDZA 4K4ZA 3V9XA 3T3FA 1JLEA 4ZVFA 5KFPA 3WNGA 2XY6A 3BQ2A 2QKBA 3C6UA 3IG1A 1RT2A 4J2DA 1GOBA 4QW8A 1RDCA 4R0EA 4OJRA 2JGUA 4E1MA 2B4JA 2YNFB 3T5HA 4OKKA 4DTNA 3SPZA 2HHXA 3GIJA 2HHTA 5HP1B 4IR1A 5HLFB 4H8KA 3RMDA 3AVHA 4C8MA 3RR7A 1NK9A 3QERA 2W9CA 1SKWA 3AVMA 3KK2B 2XHBA 3KLGA 1HNVB 3OS0A 3TQ1A 2DFHA 1C1BA 2P1JA 4QWEA 1U4BA 4J2BA 1J54A 4CEQA 4DG1B 1ASWA 4ID1A 3PW0A 2HW3A 4EP4A 1ZYQA 4ID5B 1QTMA 1RCHA 4ZTJA 2JEIA 4MFBB 2R7YA 3GV5B 3PR5B 4OKJA 3M8RA 3OS1A 1W0HA 2YHAA 2IM0A 1C0UB 3GV7B 4I9QA 4BDYA 2HMIB 4DLGA 4C8OA 4IQXA 1EX4A 1S0MA 4RNMA 2CJQA 1BQNB 2ASDA 1YT3A 3AVIA 4DFMA 2W9AA 1VRUA 1RT1A 4CCHA 3HO1A 4CEBA 3LP3A 2XCPA 4CK1A 4CK3A 2C22A 5CZ2A 1HPZB 4NYNA 2KQ2A 4LQ3A 4F4WA 2ILZA 1W25A 2ZD1B 4ZVEA 5DLGA 2V9WA 4FVMA 4PWDB 4TXSA 2BGGA 3BSNA 3V1OA 1C1CB 4KB7A 1VSIA 4AHSA 4EBEA 1D5AA 4GMJB 3TAQA 4K4UA 4I2QB 2XI2A 3OVNA 3UPFA 3CM5A 5CYQA 3RTVA 3HM9A 4RW9A 4ZHRB 1QAIA 5FDLB 3PO4A 2FC0A 1SH3A 4DQQA 4I2PB 3UQSA 4FJGA 5DQHA 3MR2A 3QYYA 1I39A 2WK4A 4HHTA 5J2PB 3OYNA 4R8UB 1RT7B 4PY5A 4ELTA 4RW9B 4FJ5A 3AVNA 4BWMA 4AH9A 4KI6A 3FFIB 3CJ0A 3OJUA 1REVA 4QPXA 4JV1A 4FK4A 5KFYA 2FVSA 4NLQA 1QQCA 1NJWA 3VA0A 5KG5A 1A5XA 3LP1B 4K4XA 4O0IA 3LP0B 5KFGA 5FRMA 1KVAA 3QO9A 4I9LA 1T3NA 2BQ3A 3LP2B 3DLHA 4F2RA 2PZSA 1ZTWA 3KD1E 4QWDA 4N47A 2G8HA 1Q9XA 4HUEA 5I3UB 3HPHA 3AO5A 3OY9A 1KVCA 4CHOA 1TL3A 3MEGB 3MEDB 3T1AA 3KK3B 1NK0A 1YVFA 3QNNA 2F8SA 4IRDA 1T8EA 4ZVGA 2OPRA 3DLKA 3CG7A 1QSLA 3B6OA 5L1LA 4IR9A 2HVHA 2HHVA 5C5JA 4FZXC 4NLPA 2PYLA 2FBXA 2AX1A 3CVKA 1KHWA 1LW2A 4OKEA 4CFDA 5KFXA 1RDBA 1QE1B 5K14B 2ILYA 2R2UA 4J9LA 1RILA 3CM6A 5SZTA 4AILC 3M8QB 1WSEA 1EP4B 1N6QA 2WHOA 4DF8A 3QZ8A 3HHKA 4XIUA 2Z1HA 2AU0A 2XWYA 3O3HA 4M3YA 2J6TA 3JYTA 1S0OA 4TY9A 3SI6A 3U3YA 3MTKA 4M3UA 2G8VA 5JUMA 1G15A 4CF8A 3L2RA 2Y1IA 1NJYA 2QE5A 1CXQA 1S9FA 1X1PA 4WE1A 3CDUA 3PW7A 1S1WA 2UUTA 5HRNA 2QV6A 4CHZA 3QGIA 1X9WA 3OYIA 4KHQA 4F3TA 1T03B 4FBUA 4WFXA 4IH5A 1D8YA 4DLEA 3QNOA 1RTIA 4O3SA 4J9RA 3RMAA 4KV8A 4FLXA 1IKXA 3AA5X 1EETB 4ECVA 4F4KA 3MECA 3K5NA 5KFMA 4RNOA 3SCXA 4ECRA 3PX4A 1RDRA 5J2QA 4CHPA 2OPSB 4AHRA 2HHWA 3HVTA 3SUQA 2G8FA 4KO0B 4TY8B 3OYMA 3QLHA 2BR0A 3PW5A 4K50A 4CIFA 3HT3A 1NHVA 3VQSA 1RDAA 3RBDA 3DLRA 4LH5A 3M8PB 1O1WA 1C2PA 2W8LA 2PY5A 5KFCA 3KK1B 3O4NA 1ZBHA 3CJ2A 1RBSA 1LWEA 3S3OA 4URSA 3QEPA 2OPSA 4OL8A 4E7HA 3VQ9A 4CGFA 4CGJA 3QESA 1WSHA 3CWJA 3AVKA 3GIMA 1RTJB 2IGIA 1GOCA 4FLUA 1TKXB 2VG7B 1XR5A 5T14A 4EP5A 1D1UA 5KFAA 3RWUA 1RT6A 5F8HA 5J2MB 4YR3A 3AA4A 5J2QB 2G8KA 2BDPA 4URGA 3I0RB 4AHCA 1WNEA 2KFNA 1ZBUA 3NKYA 5DG8A 4W5NA 1BI4A 4QOZB 4JLHA 3AO2A 4J2EA 2GV9A 3LWLA 1S1XA 1WSJA 4QCLA 5C42B 4NLWA 3OYBA 3MR5A 1RTIB 4RUCA 4J2AA 3H08A 2R8IA 1C0MA 3K58A 1UA0A 4KFBB 5F8IA 2FLLA 1S1WB 5L1IA 2JLEA 1RT3B 4E1NA 1WN7A 3C94A 4HCBA 1Y97A 3N6NA 1YVUA 3IS9B 1J9AA 3KOAA 4N56A 4KAZA 4CHNA 4TYBA 2Q3SA 3SQ0A 4J9PA 3MEGA 3FQKA 4FLTA 3KJVA 3H98A 3TANA 5FRNA 5KFSA 1N6QB 4R5PA 4QAGA 4E7LA 3M8QA 4KAIA 1TL1A 4OPJA 1S1XB 1RT2B 2E4LA 5EU7A 1TAUA 3NF6A 2W7OA 1XR7A 4DL5A 4I7FA 4ECTA 4LY7A 4AHTA 3L2QA 2E9ZA 3SPYA 2R8HA 2OPRB 3DLKB 1NKCA 4KPYA 4KBIA 4YNQA 4DL7A 1K1SA 2I1RA 3MEDA 1ASVA 4O44B 3P83D 4URQU 4K4VA 3DI6B 3MR6A 3BQ0A 4H54A 2HNDA 3I5BA 1L3UA 5HBMA 1UWBB 1REVB 4Q44A 1XHXA 1NOZA 3G6YA 3V6KA 3HSTB 3ISNC 4JRQA 4DTXA 5CYQB 4KE5A 4N76A 3ZT3A 5L1JA 1D9DA 3QGGA 5KG7A 4DQIA 1TKZB 3QO9B 4CJSA 1U09A 3PJWA 1TK0A 1JLAB 4GVMA 4Z4GA 2P51A 4NCGA 4RNHA 3KKSA 4DU3A 4FW2A 1SKSA 1RT7A 3ITHB 3G6VA 4KV8B 4KI4A 1NK5A 4KHNA 3LZIA 4KO0A 2ZKUA 1A5VA 1GX5A 3F9KA 1HARA 4B3OB 2FVRA 5CZ1A 3OHAA 3ZSRA 4B9NA 2XRIA 3F73A 1TP7A 1BCMA 1RT4B 1DTQB 3AV9A 4FBTA 1HQUA 4J9SA 2Y1JA 4WXWA 5L1KA 1K6YA 4IRCA 3E51A 3M9MB 1N56A 5KT7A 4CJ5A 4FZYA 5KFUA 4M94A 3SUNA 4DSEA 2HMIA 3MEEA 2E6LA 1C0UA 1S9EA 5F8NA 1TL1B 2IM2A 4PA1A 2HHQA 2IBKA 2IOCA 4MH8A 3MXMA 1RT1B 1QUVA 2NUBA 4C8LA 4RW6B 2FVPA 1HRHA 4Z4CA 5KFNA 1TAQA 3EY1A 4FJ8A 3IS9A 3HP6A 2R2TA 3OJSA 3D0PA 4J9MA 3RRHA 3M9NB 3QINA 3OS2A 4DU1A 4EYIB 4DMNA 3KLGB 5KFLA 1TK8A 4HKQA 3JYTB 2OPQA 3C6TA 1SH2A 2VA2A 4CJTA 4YP3A 3KHGA 3HPOA 2O5DA 2OZSA 4Y1CA 4HVJA 4RW6A 3NAHA 1Q9YA 1Z4UA 3V81A 1S9EB 4O3OA 3OL7A 2YNHB 4FJIA 2RF2B 3OSNA 2O4IA 5DK5A 4Y34A 3GQCA 4KHSA 3SQ4A 2RPIA 4PQUB 5C25A 5KFFA 4CF2A 1RTDA 1S5JA 3P5JA 4X2BA 4U6PA 2B43A 1JLEB 1LWEB 3H5UA 1ZBFA 2KFZA 3L8BA 4AHVA 2XGQA 1RT4A 1HMVB 3AVCA 3KKRA 1I3AA 3L2VA 4W5TA 5KFIA 2C2DA 2WRMA 3T19A 3HL8A 4B9TA 1T05B 1YTUA 3QLHB 4NCAA 1S0NA 3G6XA 2ASJA 4K4TA 4Z4FA 3ITHA 5FDLA 3QGHA 3LP0A 4DSJA 3DRRB 4XO0A 2ZQBA 3VQEA 5EWFA 3AA2A 4RW4B 3FQLA 4IG3A 4E89A 4XPCA 1VK0A 3PY8A 1JLAA 2FVQA 1N48A 1VSEA 4Q0BB 3T5KA 4ED8A 3DRRA 3CYMA 4Z0UA 4DSIA 1ZETA 3NGYA 1L5UA 1T05A 4CJ4A 2HNDB 1SL0A 4ECSA 3T5JA 3ZSXA 4Z4IA 3VQ4A 4DQRA 3SQ1A 1NK7A 4KTWA 3KLHA 3CFRA 1LAVA 5DMRA 2YKMB 4LSNB 4K4YA 5KRTA 3AO3A 1VRTA 3RB0A 1KTQA 4CIGA 1D9FA 4FJHA 3ZSZA 3BJYA 3HPGA 3V9SA 4H4MA 1W9HA 1BIZA 2VWKA 1BISA 4O4RA 4O3RA 4HTUA 4LH4A 3PW4A 4I7FB 1JL1A 4KFBA 4O3NA 4UQGA 2DFEA 1HPZA 5EWEA 4ECUA 2YNIA 3TAEA 1RT5B 3ZSVA 3KD5E 3SI8A 1EXQA 4TLRA 2D3UA 2AGQA 1VRUB 3NCIA 4CF0A 4DL3A 3BR9A 2JEFA 5HRRA 4NRUA 3HXMA 4WE1B 3O4QA 3LANA 2C2RA 4CJRA 3I0SB 3SFUA 5T7BA 3RR8A 4JV0A 3Q8RB 1S9GA 2F96A 3OHBA 4M45A 1IO2A 1WSIA 5KFTA 2F8TA 1RAJA 5HLFA 3RB6A 1SH0A 3L2UA 4CEFA 1TL3B 4BWJA 4M3TA 1VSFA 5HROA 1RBTA 3A2FA 1KLMA 5CY4A 3OSPA 1LWCB 2Z1JA 3EYZA 2R2SA 1HNVA 1BHLA 3KK2A 3UDLA 2BQUA 2FLPA 3NAIA 1BI4B 5DGBA 1CLQA 2J6SA 3BSAA 1VSDA 3KK3A 3WNHA 3DOLA 4FJNA 4FK0A 4ZPAA 5C24B 4LSNA 2ITGA 4ED1A 2YKMA 1T7PA 2C28A 5F8LA 3DOKB 2R8GA 1BIUA 1TVRB 2RDJA 1A5WA 3SV3A 3C6UB 3O3GA 3LALA 4ECQA 2IC3B 3S3NA 3V6HA 3BGRA 2IM3A 1I6JA 1TKXA 1NJZA 4O55A 4CEDA 3V6JA 1SV5A 4NCGB 3TAGA 3ZT0A 3BSCA 4RW4A 2XCAA 4W5OA 3TAFA 1IM4A 4OPKA 3UR0A 5KG2A 1C0TB 3MXIA 1WLJA 1VSHA 4EZ6A 3HVAA 4Y2AA 3NFAA 2KZZA 4HYKA 3MXJA 4C8NA 3SV4A 4F4XA 1U49A 1SUQA 2D3ZA 4NLYA 4M95A 1JLGA 4MKAA 1U04A 4FJLA 5KFJA 3PJXA 4Q43A 2AGPA 4QWCA 4WZMA 5I42A 1LAWA 3NH0A 4ED6A 1NK4A 2VG5B 3RMBA 3HVTB 4M41A 3VQQA 2AJQA 3DMJB 3VQBA 4ELVA 5C24A 3CQ8A 2P5GA 1UAXA 1S6QB 4C8KA 3TAPA 3DOLB 4Q45A 1EKEA 3PX0A 4MQ3A 3BREA 4CJVA 1TK5A 4KB1A 3RB4A 2YHBA 3KLVA 3EZ5A 2KTQA 1N4LA 3CJ3A 1RYSA 2G8UA 2YNHA 3OL8A 4CJKA 1JLFB 5JS1A 3V81B 5KG6A 5JXSA 4R5PB 3V6DB 4EO8A 1TGOA 2OZMA 2ETJA 1LW2B 1RNHA 1QHTA 2ALZA 1BCOA 2LSNA 3E01A 2OPQB 3OYHA 3THVA 1RTHA 1C1BB 2XC9A 1S9GB 4LSLA 4ECZA 4DS4A 5DQIA 3VQ5A 2WONA 3KTQA 2B6AA 3PR4A 1RDDA 4FCYA 2J6UA 3K5LA 3PHEA 3LDSA 3H5SA 2XY7A 3H40A 1FKPA 3QZ7A 2D0CA 3NL0A 4CJQA 1ITGA 4MKBA 3H5YA 4Q8FA 5KT2A 5DQGA 2CKWA 3SUOA 4Y2CA 5KGXA 4M3XA 3LP2A 2BANB 3CDEA 3QEXA 4O3QA 1SL2A 4HUGA 3D5MA 4IFYB 4PUOB 1C6VA 4DTSA 2OH2A 1HQUB 2AQ4A 1QSSA 1S97A 4WYLA 4Z4EA 4FYDA 4N5SA 2X6SA 1F21A 1FKOA 2UVUA 3NGIA 4R8UA 5KFVA 2XI3A 4F4YA 3NHGA 4F50A 4ECWA 4CJUA 4GW6A 4CEAA 4CGIA 3SUPA 5DG7A 3VQ7A 3KIOA 2ZE2A 2EC0A 2R8JA 3WNEA 2YKNA 4O3PA 3QEWA 1RTJA 4WFYA 4M42A 4Q0BA 1JX4A 1Z26A 4ZP6A 4I2QA 4DEZA 4B9LA 2HAIA 3AVGA 3OLAA 4E7JA 5KFOA 2X74A 5SWMA 4DTOA 3CO9A 2C2EA 2HWIA 1TKZA 4OGEA 4E0DA 3M8PA 4DQSA 1N5YA 1IKYB 1QAJA 2WCXA 4J9OA 4J9KA 2DPJA 4NYFA 4F8RA 4FJMA 3Q8PB 3ASMA 4U7CA 1JL2A 1HMVA 4B9VA 2WOMB 3KLFB 4CEOA 1YTAA 1NKBA 4IG0B 1LW0B 1FXXA 1WAFA 4PWDA 4KHYA 4PQUA 1IKWB 3RBEA 2HNZA 2JEJA 1SV5B 4KHRA 3D28A 2OA8A 4MK7A 3V4IA 5F8MA 4ZP9A 3Q8SB 1KVBA 3L3VA 1NHUA 3GIIA 1BQNA 3G86A 2FVCA 4EZ9A 4QW9A 3LPUA 1JLCA 2UUWA 1FKOB 5KFWA 4K4WA 3SQ2A 3DYAB 2FBYA 3KHHA 4DTPA 1CXUA 1X9SA 2R8KA 3KMQA 4BE2A 4NRTA 4HCCA 2F8EX 4NLRA 2UVRA 4NZ0A 3QEIA 3P1GA 4E7KA 4CJFA 5KGWA 4Z4HA 3PZPA 2D41A 3B6PA 2I5JB 4K8XA 4FJXA 5CYMA 4DFJA 1SKRA 3K57A 4CFAA 4DG1A 1LWCA 2HNYB 4Y3CA 3KLIB 4CGGA 2FJVA 4MFBA 3IGNA 4ZMMA 4KTQA 4ZP7A 3WNFA 3NDKA 1JLBA 4G1QA 3OYFA 5F9NA 5DG9A 2W9CB 4DL4A 1CSJA 1VSKA 2GUIA 4DSKA 3KNAA 3HK2A 4FLVA 2Z1IA 5J2NB 4DFKA 1JLQB 2R2RA 2E9TA 1RTHB 1S1VB 3UIQA 5HP1A 3E01B 4NCBA 4EBCA 4B3OA 4YR2A 1ZTTA 3CJ4A 2HHUA 1L3VA 3V9ZA 4DS5A 4Q5VA 3AVLA 3OYCA 3RAQA 1JXLA 4TQRA 3V9UA 1DTTB 2VG7A 1CZ9A 4CEZA 3IGVA 1JLFA 4DTMA 5KTQA 4JS5A 4B08A 1NK6A 2YV0X 3PW2A 2G8IA 4ZVHA 1S1TB 1HYSB 1IG9A 2P5OA 1S6PA 2BE2B 4IH6A 1IH7A 3FDSA 5F9LA 3FSIA 4ED2A 3H2LA 1LW0A 3KK1A 1HYVA 3DLEA 5KFZA 2VWJA 4OLAA 2EX3A 1ASUA 5KT4A 2ASLA 5J1EB 4DTJA 4LD0A 2WOMA 4BACA 3AVAA 4CGDA 1R0AA 2VG5A 4IDKA 2W9BA 1U47A 3O3FA 3K59A 2GC8A 4IKAA 3N6LA 5HBMB 4I2PA 4TY8A 3DRSA 5KFRA 3NH1A 4IBNA 4K4SA 1FK9A 3K2PA 3LWMA 2ATQA 1LWFA 3AVFA 4EBDA 1B9FA 2EHGA 1SUQB 1KSPA 3K5OA 4CF1A 4NLTA 5J1EA 4ZPDA 2IM1A 1LV5A 1EETA 2OPPA 4DL2A 4RU9A 1IKXB 1S1TA 3DLBA 3NE6A 4WYWA 1S10A 2QK9A 4WFZA 3I5AA 2ZD1A 2XY8A 1OS5A 4FXDA 3HJFA 3H4BA 4ED7A 3NBPA 2HHSA 4G3IA 5KG1A 2AWZA 4MK8A 3PO5A 1TVRA 4TQSA 5F8GA 5HRSA 1R0AB 4FZZA 3DOKA 5FROA 4RW8A 4KHUA 4ED3A 2DTUA 3RAXA 4IKFA 4E3SA 3AA3A 4FM0A 2FJWA 2B5JA 1Q8IA 1JLQA 4NYZA 3DLGA 1RA6A 1HYSA 1RTDB 4CK2A 4ZP8A 4BE1A 4KKOB 5C25B 3QIPA 4YMEA 4JS4A 2UVWA 1EP4A 1L3TA 1MU2B 4IH7A 2IAJB 3T5LA 4CE9A 3KLIA 3NF7A 1TV6B 4EYHB 1FKPB 5KT6A 1TV6A 2I5JA 4KRFA 4Q8EA 2VG6A 3VQAA 1JXEA 2V4RA 3QETA 4FS1A 3BQ1A 4H4OB 3V9WA 2D0BA 3TABA 2HNYA 4MIAA 3D45A 4O0JA 1S48A 2DPIA 5KT5A 2UVVA 4CECA 3HKWA 2XGPA 3DLGB 4DU4A 3M8SA 4FLZA 1S49A 4H4OA 1J5OB 3TI0A 3ZT4A 4DTRA 4NLUA 3RB3A 4EO6A 5KFQA 1BQMA 2FJXA 2FLNA 3ZT1A 4RW8B 3JSMA 3IRXA 5D3GB 4CERA 3OYAA 3IN5A 3V4IB 5HRPA 1NOYA 3KHRA 5DLFA 2YNIB 1U45A 3FRZA 3IG1B 4ZPCA 2YNGB 2IDOA 4TSXA 4O4GA 4BE0A 5JS2A 2RKIB 3OYLA 3DRPA 4FJKA 4H4MB 1KFDA 4E7IA 3AVBA 3DM2B 1BL3A 3ZSQA 1S6QA 1UA1A 3TVKA 4WZQA 3SJJA 4LQ9A 1S1UA 3KLHB 2E9RX 1WSGA 2RN2A 2PYJA 1HNIA 3AO1A 3MF5A 2G8WA 1TKTA 4N41A 3OYKA 1HNIB 3MFHA 4WXOA 2X78A 2BQRA 1B9DA 3GILA 1JKHA 1IKWA 1C0TA 2IJNA 1HQEB 3AO4A 1C1CA 2AGOA 2FBTA 4FM1A 1D0EA 4CJ3A 1NK8A 4CFBA 1IKVB 2RKIA 4W5QA 4KSEB 4DWIA 2ZE2B 3KLFA 1S6PB 2BE2A 3ZT2A 4Y1DA 1ZBLA 2YNGA 2JC1A 2IC3A 2JC0A 2YKNB 4IFVA 4FK2A 1S1UB 4CESA 1UWBA 1BQMB 3CJ5A 1VSMA 4W5RA 1RBVA 2W42A 4IFYA 4PUOA 3M9OB 3HP9A 1J5OA 4DSFA 3V1QA 4NLDA 3ALYA 3KLEB 4ECXA 3PV8A 2Z1GA 4RW7B 1QSYA 3I8DA 4DF4A 4CHYA 4FLWA 4E19A 3KHLA 1GX6A 1DTTA 4ID5A 1KLMB 2IS3A 4FS2A 2RF2A 4ZTFA 1QE1A 5K14A 3G10A 4NLGA 4B8AB 1JXBA 2W7PA 4RG8A 4M3WA 4L8RB 3VA3A 3KJVB 3ULDA 2GIRA 4RW7A 2O4GA 5CYMB 3NF8A 3ZSOA 2KZMA 2JEGA 2V0NA 2B6AB 4B9MA 4MIBA 3H59A 3EZUA 3OYGA 3HVRA 2E6MA 4AHUA 4HUFA 2IAJA 1XHZA 1XI1A 4IFVB 3CFPA 1JLCB 3QIPB 3VQ6A 3V6DA 3MFIA 5KRSA 3U6FA 4NLOA 1HYZA 2IA6A 5KG0A 4DTUA 4M3ZA 3TAMA 4FJ7A 1NJXA 4RNNA 3VQ8A 2ATLA 2DFFA 1U48A 3Q8QB 2OPPB 4LSLB 4ICLB 4FJJA 2BRKA 3NF9A 3I0RA 3S3MA 3FFIA 4CJEA 3DYAA 3VN5A 3H4DA 1DTQA 1JKHB 2OYQA 4FW1A 4GC7A 4XPEA 5J2PA 3N6MA 2HVIA 4KHWA 1LWFB 1B92A 2KW4A 3NBPB 5I42B 4YR0A 2QXFA 4B9UA 4IOBA 4YFUA 2VA3A 4BDPA 1X9MA 1KFSA 1KCFA 3ZSYA 4NLSA 3IAYA 1CZBA 3ISND 4IDKB 2W9BB 3LAMA 1XR6A 4F2SA 1J53A 1JLGB 3ICLA 5EDWA 3HYFA 4IG3B 3PUFA 3DM2A 1KRPA 1SL1A 2HWHA 4IG0A 2V4QA 3EPIA 3NGZA 2FBVA 4O4GB 4MK9A 3QIOA 3K5MA 4OGCA 2WB4A 2QKKA 4FJ9A 3KMSA 3QIDA 4F4ZA 4KHMA 2D7SA 3I5CA 4CJWA 1QS4A 4CHQA 4NLXA 4DQPA 1XC9A 4JUZA 4QWBA 1RBUA 1WAJA 4ZPBA 3TR8A 4JV2A 3DDKA 3CIZA 3DI6A 4O44A 3DRPB 3NMAA 4CJLA 2IMWP 4ICLA 2A1SA 3SYZA 3BDPA 3OYJA 3MECB 3GYNA 4B8CA 2W8KA 4ELUA 3TAMB 1NKEA 1HJRA 3LPTA 5KFBA 3S9HA 1C1AA 3JSMB 3TWHA 5F8JA 4O5BA 4TN2A 1JLBB 4G1QB 5L9XA 5EWGA 3U3GA 3IRXB 5D3GA 1DLOB 4YQWA 1T03A
chains in the Genus database with same CATH superfamily
4KB0A 4YY3K 1KQSR 1YJ9N 4L72B 4BS2A 1OQ3A 1ATNA 3O6WA 1M90O 1JIHA 1DQ8A 1HWIA 5B08A 3OUYB 3AVJA 2QC3A 3BPSP 4ED0A 4Z94A 1DLOA 2RDIA 2ZJPL 4FYXB 5BR8J 5A6PA 2QMWA 1RBRA 4WCEL 3GR1A 3ULHA 2NXNA 1HBMB 1NU0A 2GIQA 4BBYA 4NMLA 1TKDA 3ZLJA 2IMOA 1VSLA 1YJ7A 3OTOF 5ELZA 3KNGA 2UUBK 4JKDA 4I56A 1IWAA 1B0TA 1L3SA 3L3UA 3Q8UA 4ENOA 3I55N 2OFHX 2UP1A 1FFWB 1ZM3A 4GC6A 3CJQA 5AQGA 1CJTA 1PIEA 1KHVA 5M2UA 5AQQA 1UETA 2WTFA 2ZM6F 1FE4A 3EPGA 4NI2A 5J2MA 4CF9A 2XO7A 2V8HA 1YJUA 3Q23A 1K1QA 4F0HA 2GBZA 2C3OA 5I3UA 2DY4A 3GFHA 1ZBSA 2GWJA 3O8MA 3L0QA 2PFUA 3PVXA 1GMWD 3UDCA 4I67A 2AYGA 1QDUB 4CGHA 2CQIA 5KI6A 1S4FA 2HFNA 2V2KA 4DI6A 1VSJA 4DQ8A 3NH2A 3MX5A 1VQ7S 3M30A 4OJGA 3LGNA 2DRDA 3C95A 2IJFA 3BKTA 3CCZA 3U9ZA 4CJPA 3MD1A 4LF6K 4DUZF 2JL9A 4M3RA 3OL6A 5KT3A 3A3PB 4ZHRA 5KFEA 3RAMA 4OVLA 3TARA 4EEYA 4F3OA 2VBYA 3K9KA 5T41A 5F1XA 5DGAA 3OR2A 4WTYA 2U1AA 4K4ZA 1G2EA 3V9XA 3EJMA 3AAPA 5AJ3K 3CD7A 2RB7A 2KKHA 3EGVA 4ZVFA 2ASPA 2NREA 1E4FT 3WNGA 2XY6A 2IJRA 3IG1A 3R2CJ 3CJ1A 1GOBA 2FC8A 2LYVA 2G0IA 4B3SK 3P49B 3Q24A 3T5HA 3MOJB 1IUJA 4DTNA 3SPZA 2HHXA 2DHGA 4IR1A 3MURP 3RMDA 2EI5A 2ZGZA 4JI4F 4DR3J 4GVBB 1P8ZA 3QT5A 5BYQA 5KPRA 1DFDA 2RILA 3VALA 1SKWA 4WQ5A 3KK2B 1X5TA 2E5LK 3TQ1A 2DFHA 1C1BA 1CPZA 1C4CA 2B9WA 1J5EF 1U4BA 2ZH3A 1VK8A 3QFUA 1ASWA 2ZH8A 2UXDK 1IQZA 1ZYQA 1WUAA 1RCHA 3CD0A 3GV5B 1FJGK 2DGQA 4OKJA 1NGIA 3PJ9A 1UJ5A 4JI6F 3VVTA 1X7VA 2AEMA 3CCMN 3DLLL 2A3JA 1Z2LA 5GADU 4DV6F 1S0MA 3AVIA 2VB6A 1UL3A 2W9AA 1W7WA 1ZM4A 2YJFA 4FF2A 4CH0S 3VVUA 4CEBA 1S6OA 2XCPA 1KONA 2ZKTA 2C22A 3SCIE 2MQ8A 5CZ2A 1HPZB 2KQ2A 4LQ3A 4Z7YA 2MTLA 2GFFA 1HW9A 2V9WA 1WI6A 3SQGA 2LEAA 1YJWN 2OIHA 3IAS9 2BGGA 3J81j 1R3NA 1QQMA 2LFVA 4KB7A 4YUDA 2BXJA 2Z58B 1N8RT 1HNWF 4ANEA 4M5KA 4GMJB 3TAQA 4DUYF 4K4UA 4I2QB 2XI2A 1F3FA 4H0OA 5IQQA 4JBCA 2HRYA 3MM7A 2X3DA 2WVBA 4I6MA 1QAIA 1HWLA 5FDLB 1SH3A 3UQSA 1RHRB 1I39A 2QA1A 5J2PB 1H6KX 1RT7B 4LBIA 4ELTA 4RW9B 2CPZA 4BWMA 4IFEA 2G2YA 4LF9F 2PBDA 2FVSA 2V2QA 3M6XA 4NLQA 5CQGA 4OYAA 2QWPA 1LFWA 5TKYA 1RAEB 5KFGA 1T3NA 1ZAXA 2FDNA 3DGPB 3ID6A 3S6EA 2WW8A 1U2FA 1LEOA 1Q9XA 1XN9A 2QLJB 4HUEA 3ZTQA 4IJAA 2BW2A 3AD9C 3A8KA 5IV4A 1DGKN 5E3PA 1TL3A 1ZM9A 4YOXA 1TUWA 2YY3A 3KK3B 1YVFA 3ZZZA 2D0PA 1T8EA 1M5SA 1Z6RA 5ETPA 1QSLA 2MB0B 3C3LA 2DO4A 4IR9A 3UKUB 5C5JA 2RH3A 2M9KA 2M52A 2LP4A 1LW2A 1VQ5S 2ZITA 4FWPA 4K41A 4LF5F 2PFDA 1QE1B 5K14B 1IV0A 4ISEA 3W2VA 3CM6A 4PQAA 1WSEA 1EP4B 1N6QA 2MLZA 5LY3A 2WHOA 3GFXA 3BO2A 3NP5A 4EUVA 3SI6A 3U3YA 5MAOA 1V4SA 4BRLA 2MXYA 2Y1IA 1CXQA 1QQNA 4H4KC 4B3RF 3VF2A 2XMKA 4PWWA 4BR0A 1S1WA 4Z2XA 3O6QA 3QGIA 1X9WA 4P7TA 1B0PA 4WFXA 4IH5A 1D8YA 2Y9HA 2CWKA 1RTIA 4DX5A 4F0MA 4DHVA 5HSPA 3ELHA 4QJVA 1F60B 2LKZA 4JI5K 4FLXA 2DB1A 4DR3K 3AA5X 4ECVA 1TUYA 4F4KA 2VOPA 5KFMA 3MHYA 2QYGA 3SCXA 1HPMA 3HJVA 1E4GT 5J2QA 1GXUA 2XTJP 3OD2A 5FPNA 1GMUA 3SUQA 2G8FA 2V2VA 4TY8B 1WC3A 2BR0A 3LUYA 5L38A 3HT3A 2Z56B 1SJRA 5HJXA 1RDAA 3RBDA 3DLRA 1YIJS 2F4VF 4E2FB 2W8LA 3GE9A 4KHPF 4CM0A 4QS9A 2D69A 3CJ2A 4URSA 4E7HA 3HFVA 3H2UB 2LDIA 2PGCA 3AOBA 4CGFA 1UFKA 3TU5A 2VQFK 3QESA 3AVKA 3QBCA 4V19X 2YXLA 1GOCA 1VMBA 1XR5A 5T14A 4A2AA 1BD6A 1UEKA 5EN1A 4EP5A 1D1UA 3H8YA 2G1HA 3KZBA 5F8HA 1CC8A 5THWA 5J2MB 4YR3A 1NEEA 2MYFA 1N33K 5IWAJ 1UAWA 5J2QB 5HQMA 2AJFE 4URGA 4ILGB 1VQKN 2E2PA 3I0RB 3UKRA 4C0HA 4HTIA 1QAYA 2NXCA 3NKYA 4LIRA 5DG8A 3AO2A 4J2EA 1SJ3P 1FXRA 3LWLA 4NLWA 1PCAA 3T9ZA 5AQXA 3H08A 5AR0A 1VRQC 4JI2J 4KH1B 3BB5A 1S1WB 2JJ4D 4E1NA 3C94A 3AARA 2V7YA 4HCBA 4AL6A 3NXZA 1YVUA 2QLBB 3VGUA 4KAZA 3DAWA 4YORA 1VQ5N 3GJTB 2VDHA 3SQ0A 4B1YB 3W2WB 5ADXA 2ZHBA 4DV2F 2UXBK 2NRWA 4FPAA 4JKGB 1N6QB 4E7LA 2O8DA 2XS5A 3HZEA 2WFBA 4QYZJ 3W2VB 1S1XB 1FD8A 3AJ1A 3CI5A 3NF6A 4KGZB 2OTLS 5LJWA 1HKBA 4DL5A 4I7FA 3F5TA 4LY7A 4AHTA 3Q8VA 2OPRB 3QATA 3J81O 3QWUA 4P2XA 3TJAA 1U2VB 2MLYA 4KBIA 1K1SA 2EC2A 4K4VA 3MR6A 3A8JA 5GAEP 2R42A 4BG9A 4H54A 3KUHA 1YF5L 1VQPN 1REVB 4DUZK 3VESA 3PHTA 1KAYA 3V6KA 2FSKA 3ISNC 1RKIA 2KH9A 2L9NA 5HQLA 1RDWX 5KG7A 3QO9B 4UUWA 4ZCLA 4E1JA 5LMUJ 4PXBA 4I68A 2YVSA 1JLAB 3VR1A 5JVGL 3I4HX 4LF8K 1HI8A 1ZBTA 2LU2A 3QT6A 5A2QY 1SKSA 4J90A 4Z37A 3ITHB 2RHSB 4HTJA 1S99A 4KI4A 4KHNA 3KXDA 3IWNC 1DRZA 4OX6A 3CJBA 1A5VA 4R25A 1GX5A 2V69A 4HWIA 4OYXA 2ZNZA 4Q7AA 4FBTA 2GNKA 1HQUA 8AT1B 4JI0K 5L1KA 3PIPQ 3Q2SC 4YB6A 3M9MB 1N56A 5KT7A 3SCJE 3CCRS 1DT9A 1GLLO 2P9LB 3K8WA 4FZYA 4DSEA 3KJFB 2CGJA 3W0LA 1HA1A 5F8NA 1FRHA 2UU9F 2M7SA 1TZ0A 1X3NA 2AKWB 4MH8A 3CCQS 3AA9A 2KFYA 1VC6A 5KFNA 1TAQA 3J8AA 4N8OA 3IS9A 3BM7A 3Q7BA 1QJHA 3OJSA 3D0PA 4TU8A 4KGXB 3RRHA 3M9NB 1PG5B 3OS2A 4DMNA 1LK7A 1HLWA 1WOOA 5KFLA 2QL7B 3JYTB 4QOTA 2OPQA 3W9IA 2F8MA 1SH2A 2VA2A 2B4UA 4OZJA 1X4GA 2OZSA 4Y1CA 3W66A 3V81A 3FEYB 4O3OA 1TFYA 2UUCK 2KU7A 3DRXA 3POTB 4KHSA 3SQ4A 4CF2A 1NGFA 2OO4A 3H46O 4DU7A 4G1PA 2P9LA 3NRBA 2B43A 1T9XA 2F9TA 3C7NA 3H5UA 5K20B 4AHVA 5AJ3J 3MPUB 1HMVB 2J76E 1JWWA 2BJDA 2C2DA 3EDQB 3S1TA 5A2QU 4ER8A 3D3CJ 4PWUA 3HL8A 2P2CB 2DO0A 2ASJA 4NOHA 3ITHA 5FDLA 2MKKA 3LP0A 4XO0A 2O8EA 2YH1A 4JV5K 3AA2A 4YOEA 4IG3A 1VK0A 3PY8A 1JLAA 4OX9J 5ADZA 2CQ3A 1YJNN 2ZWHA 4ANDA 2RD5C 2KVQE 4CJ4A 4ECSA 3M2RB 2VQEJ 3ZSXA 1YJWS 3ULEA 3GJQB 4TU7A 3BH7B 1QVFR 4M5JA 1CJVB 3KLHA 3U1NA 1YRXA 2GVZB 3CCVS 5KRTA 2CQPA 2GJIA 3DJCA 1KTQA 1D9FA 5HN0A 2BYCA 3MK6A 1SQFA 2JVRA 4O4RA 3IM8A 2K1RA 5H9EJ 1VQNS 2BABA 3MWBA 4O3NA 3ENQA 3V4MA 4DHYA 2XLJA 4USMA 3FMWA 2MEWA 4V19S 1MA9B 3BR9A 2JEFA 5GAGU 1FWKA 1S79A 3O4QA 3LANA 1N34F 4JK7A 4BC5A 3RR8A 4JV0A 4DDFA 3THPA 2KT3A 3OR1A 3W65A 5EX3A 2FF6A 1IO2A 1WSIA 1NBEB 4P6QA 1R43A 3P6YC 3FBEA 2EBEA 1VSFA 2QL9B 3OSPA 2XULA 3LDNA 2NLXA 1KVJA 1ZS6A 2BMBA 4ALZA 4DL0C 3T1YK 3ZZUA 1CLQA 5DGBA 4ZA1A 2J6SA 3BSAA 3E8OA 3DOLA 2L48A 4FJNA 4ZPAA 2V9KA 3OR2B 1T9TA 4LSNA 1H3DA 5H1SV 1T7PA 1WG4A 1FNXH 2R8GA 4ANCA 2NRHA 5AE1A 1TVRB 2C3PA 4C97A 2IVYA 2RQMA 4LF9K 2YWKA 2OSQA 3GR0A 1XNRK 5AQFA 1WD6A 2QLFB 5ITHA 3NCRA 2QWOA 2XCAA 5ETVA 2HBMA 2QJ3A 3M2VB 1C0TB 3NFAA 4MDAA 3CCJN 1IBMJ 1O5JA 4LF7J 3L9ZA 3SV4A 1XBWA 2NYHA 4PPZA 1YI2S 2F40A 4NLYA 1TUVA 3G82A 4EGLA 1U04A 1UVLA 1JCGA 5AQKA 3KUEA 4OZ1A 3W9JA 2AGPA 4QWCA 1YX2A 4CO2A 2B9XA 3QMQA 1CS4A 1WF1A 4FKYA 2P5GA 2RU9A 3OA9A 5DM6Q 2HLUA 1VQ4S 4C8KA 3FLCO 3DOLB 1UPPA 2E1ZA 3THXB 4PG7A 2E7VA 5C2CA 4PYAA 3EZ5A 1RYSA 3D2EB 3AB4B 2YNHA 4LFBF 4YHHF 1WHYA 1DEJA 5KG6A 2H3GX 3E66A 5JXSA 2OZMA 4EK2A 1HBUA 4YOYA 3WXLA 2LSNA 3THVA 3E01A 4QBUA 1RTHA 2ZBCA 1C1BB 4LSLA 3JSRA 4FWOA 4IEIA 4LF4J 4ZVSB 4PKGA 2YWFA 3LPEA 5T7LA 5DQIA 4A8YA 3G71N 5CXTA 2B6AA 3FSXA 3K5LA 3LDSA 3H5SA 2XY7A 4HTLA 1FKPA 1F1BB 1T11A 3QZ7A 2CJAA 2FIUA 4F9OA 1V5IB 1X5SA 1F0XA 3R5BA 3CDEA 1Q16B 4HUGA 1C6VA 4LRAA 2AQ4A 3PYDA 4KR0B 4YDXA 4Z4EA 4Y2MA 3O4WA 4CT9A 2FPHX 4FWKA 1FKOA 2UVUA 3VENA 2IRYA 2E7XA 4WP8A 3SLCA 3NHGA 4Y2KA 4CJUA 5DG7A 4Z7CA 3WNEA 5JVHQ 4WIIA 4OFZA 3D2EA 5IWAF 1OY8A 1F5BA 4A47A 4DEZA 2HS3A 5I9EB 5J1NA 1JJ2M 4D3GA 1SJ1A 5B0EA 3AVGA 3OLAA 2QA2A 5KFOA 3CJTA 4HH0A 3GBTA 4DQSA 3VGSA 1QAJA 3BN4A 1Q82O 4KGVB 5TKWA 2DPJA 4F8RA 5F0WA 5GMEA 3Q8PB 3ASMA 2ZM6K 1JL2A 1HMVA 4BRIA 4B9VA 2DNLA 3VTIA 1NPKA 3MAHA 4HT5A 1YTAA 4CEOA 3PLAA 2PE8A 4DPXA 1J5EK 3JS9A 5LSLA 4PWDA 2Z2YB 3N0VA 4KHYA 4LRCA 3MN5A 3TZZA 1SV5B 4OZ3A 5DM6L 2C3UA 2NZTA 4E8UA 3MWTA 3KVGA 3ET6B 3JAMU 2YQ1A 3TA1A 5F8MA 4ZP9A 1NHUA 5D4OA 5JVHL 2RUSA 3HDSA 4LVOP 4K4WA 1AXQA 2VF3A 2FBYA 3BGOP 1X9SA 4C0BA 2R8KA 1T6CA 5C2DA 3WEEA 2F8EX 4MLHA 3BEGB 3GYGA 1BE4A 3QEIA 4E7KA 3GTYX 2AJ0A 1R7IA 2MKYA 3PZPA 4EI2A 2U2FA 2D41A 3B6PA 4K8XA 2CNOB 5CYMA 1SKRA 3TSUA 4DG1A 3L7OA 1TL7A 3PYEA 1ZPWX 1AZSA 3VERA 4DUZJ 3OYFA 1VSKA 4C3KA 3MMAA 4C23A 2LDYA 2EFPA 4XH5A 1RHQB 4DFKA 5AQYA 3ENOA 3M1VA 2E9TA 5M1NA 3UIQA 4NCBA 5HP1A 3CJ4A 4LF4F 4LF8J 2HHUA 1L3VA 4Q5VA 5DRKA 4TQRA 3V9UA 4NLCA 2VG7A 1CZ9A 3IGVA 2F4VK 2CJKA 5KTQA 1PGZA 3F0NA 4NL5A 3S7RA 1HX1A 1R31A 1CULB 4KH4A 3PW2A 1LXJA 1VDHA 4ZPVR 2D74B 2G8IA 4ZVHA 2WC9A 2P5OA 2ZJPQ 1M1HA 1KAXA 1S6PA 1SJQA 5GAHI 3OFEA 4JI4J 3FSIA 1P8GA 3DLEA 3T41A 3NMRA 3EMTA 2O8FB 4CGDA 1R0AA 3JXUA 2NZCA 1X5OA 4IDKA 1CJVA 2FHOB 4Q2MA 1X4AA 3I82A 3MMBB 1N33F 2F3JA 5HBMB 2PT0A 2KXNB 4PHTX 4YN3B 4IBNA 3K2PA 3AQOA 2XMWA 2E5LJ 1Q7YT 3VTHA 5F0UA 2ZFHA 4X64F 1JCEA 3AJ2A 2ZH9A 4ZPDA 1V4TA 1PBUA 2GGPB 2IM1A 3MGJA 2G2OA 4DL2A 2XNQA 1WHWA 3L7PA 4RU9A 2RE2A 3DLBA 4BRGA 3LM2A 4WYWA 2E1PA 2QK9A 2CAJA 2F65A 2ZD1A 1Y5NB 2UV8A 3H4BA 4JI8J 3NBPA 3I55S 2HHSA 4P75A 4G3IA 4MK8A 3NGRA 4TQSA 4A2BA 2VQEK 4DX8H 2VFUA 4NI2B 2H4WB 4DB3A 4ED3A 2DTUA 4LUBA 5A8KA 3AA3A 2IYIA 4FM0A 3WT0A 1IG8A 2J0XA 2W6LA 4NYZA 3GONA 1RTDB 4LF5J 4U7UD 2UUCF 4WFNL 4YMEA 4LF6J 1B7FA 2VQFF 5E0OA 1L3TA 4IH7A 4XH1A 3T5LA 3KLIA 1TV6B 2F9JA 1BU6O 2AA4A 1TV6A 2LU1A 4WP9A 2FY1A 2A3ZA 4C0OC 3FEZA 2VG6A 4K5SA 4Q8EA 1PILA 2YWHA 3QETA 3BQ1A 3V9WA 2HNYA 5AQSA 2DPIA 3N4PA 2UVVA 3BR8A 4RWTA 4BY9C 1AA1B 4ZLNA 2NPIA 3ZZTA 4EO6A 3DOMA 3ZEUA 1HNXK 3ZT1A 1O8BA 1S77D 5D3GB 3V4IB 3F9MA 4PG4A 4B3TK 2J5AA 2C3MA 2IDOA 4HVZA 4X66J 4O4GA 2QI2A 5I3PA 2CQHA 4FJKA 1RSCA 1KFDA 4KC5A 2R3VA 1BL3A 3SSQA 1S6QA 1UA1A 2E1YA 3TVKA 2XLKA 4EAHD 5JLHA 2HK3A 1YGYA 2EKYA 1FJEB 2RN2A 4ZIWA 2ZNYA 4DV2K 3ULEB 2PYJA 1NGHA 4L73A 4X66F 4ZJLA 3MFHA 2BQRA 4BVOA 3GILA 1X4CA 4JB8B 1IKWA 3OXGA 2E5HA 2BJ8A 3AO4A 3FCHA 1C1CA 3CUNA 2QWNA 3NS5A 1D0EA 3PIPL 3OT9A 2RKIA 1Y4ZB 3LGMA 4DV1F 2ZE2B 3KLFA 4LFBK 2FY8A 2DGVA 2IC3A 3OBYA 2QZ8A 4N8NA 1NJIO 1D09B 4ED5A 4WF9Q 4RCHA 4WK1A 4M7YA 1UWBA 4K2XA 3CNQP 1BQMB 5AE2A 2HZAA 3CJ5A 3W5YA 1FJGJ 1ROFA 3DFEA 2VHGA 1VOMA 3KLEB 4IXCA 3MTJA 4ZCIA 5AFUH 4RW7B 1QSYA 2B8PA 4TNOA 1GX6A 1QE1A 5K14A 4F26A 2O1PA 4NLGA 1JXBA 3WXMB 1HKCA 4M3WA 3VA3A 3CQYA 1MG7A 2P9SB 2H5JB 2CPYA 4B3SJ 3MPWA 1NPRA 4ZITA 1T9YA 5CYMB 3D6HB 3NF8A 2B7BB 5AQPA 1QVGM 4DV3K 2CJ9A 2CPDA 2CJBA 5EHHA 1RGIA 1GMWA 1FESA 1I94J 3HVRA 3LPYA 1R0BG 3M4XA 1WC1A 3K7RA 3EKSA 4WWSA 3MFIA 2WSEC 2QL5B 4NLOA 1N36K 2UU9J 5AT1B 2Y3YA 1Y5IB 4PEOA 5CAAA 4FJ7A 1P1LA 2DR9A 4A46A 2ATLA 4RLEA 3Q8QB 2X1AA 4ICLB 4FJJA 3G8TA 1EKSA 3CE8A 3CMAS 3PXGa 3H4DA 1JKHB 1IM6A 4GC7A 4JK9A 3N6MA 1RBAA 4KHWA 1OH5A 1LWFB 3BV8A 4YR0A 1NDCA 2UXBF 4BDPA 4BRAA 1Q79A 2GO8A 2W9BB 3H1QA 1GLEG 1XR6A 1KKHA 2CPEA 2HBRB 1JLGB 3PUFA 5FPMA 1SL1A 2HWHA 4IG0A 3C14A 4OYPA 3EPIA 2RHKA 3ENAA 3FZKA 4MK9A 3QIOA 5EVZA 4FJ9A 3KMSA 4F4ZA 2MZSA 4A8QA 4KHMA 2D7SA 4DV4J 4CJWA 1BY9A 1QS4A 3CERA 4CHQA 4DV0J 4DCHA 2DTJA 1XC9A 4UZBA 1R27B 1RBUA 1WAJA 2XZWA 4ZPBA 2FSNA 2BM0A 3G96A 3DRPB 1U6BA 4CJLA 2IMWP 3O9UA 1S59A 3BDPA 2K2PA 4DV4K 2BJ1A 3GYNA 5I4MA 5KFBA 2I8EA 4CQ1A 1C1AA 4DV2J 3JSMB 3TWHA 4PRFA 4FKXA 4JI3J 5KPTA 1ATSA 1WORA 4JI0J 4QZVB 2EBGA 5EWGA 3IRXB 3EKUA 4Q2LA 4YQWA 3C6TB 3D4JA 1Z25A 2EEYA 3BBCA 1EKRA 2HB5A 3QRRA 4DV3J 5F2RA 4HHJA 3TJ9A 2A6MA 1S22A 2BANA 3PRDA 4JYAF 4I1TA 2VG6B 5E41A 4LF2A 3ZCMA 3MAQA 1GLAG 3MPYA 4CFCA 3OYDA 3G0ZA 2RDDA 1WBBA 4AE5A 5KG3A 3MCSA 2CG8A 5HROB 1A9NB 2UU9K 3Q89A 1VQKS 4GNIA 4LC9B 4J9NA 2W2QP 4CEEA 3OLBA 3L2WA 3NAEA 1VRTB 5D15A 2BBEA 2DHSA 1X4EA 4IRKA 3THXA 3I0SA 1U26A 1MMLA 1DQ9A 4F4AA 4BRHA 1DBDA 3RMCA 2DVIA 3QEVA 1XWLA 2HSTA 1RT5A 3RRGA 3CF5L 2YQ0A 3CTRA 4FLYA 2UUAK 4I0WA 4DSLA 2Z30B 4DFPA 2D5RA 3CFOA 3P96A 1IBLK 1YQHA 3DGPA 1IKVA 2V4JA 1RDUA 1BLUA 4RZRA 4KT0C 3V1RA 5L46A 4CZMA 4QWAA 2GQCA 4CO4A 2EPIA 4W98A 1RISA 1RYRA 3AD7C 2A1RA 2K3IA 4ECYA 1QZ6A 4CIEA 2E20A 3UD3P 1TKTB 2Z57B 1FRLA 4LFAF 1NO8A 3BF1A 2VYPA 1FFSB 3O1LA 3S8SA 2HIYA 4OIXA 2DNMA 4IOAQ 1U8SA 3SNNA 3CDAA 5K5MA 4GKJF 5J2NA 2NNWA 4BDZA 7FD1A 1C0GA 3PRVA 3T3FA 1QM9A 2CVEA 3CC2S 1FE0A 5ETTA 2VOOA 3BQ2A 3IXQA 2QKBA 2JVOA 4J2DA 2CZ9A 1OKJA 4QW8A 1DQAA 4BRNA 3Q0AA 4OJRA 4E1MA 2JGUA 2B4JA 2J0SD 2V52B 3LTOA 4YOTA 2HHTA 5HLFB 4OHZA 1RBOB 1F9FA 4NO7A 1NK9A 4QS7A 3AVMA 2DCLA 2H1YA 3OS0A 2FJBB 2HBZB 4J2BA 3A8YA 4DG1B 2CYYA 3QPIA 3L09A 4ID1A 1VQNN 4LFCF 2HW3A 5E2QA 1QTMA 5D0EA 3KUGA 2MLXA 4M8LA 3PR5B 4CO3A 1JXVA 3I4PA 2APOA 2PI5A 3QB0A 4ZK7M 2GTDA 2WB1D 3MUVP 2DR6A 5K8OA 4I9QA 4BDYA 2ZZMA 2JSXA 2XZTB 2YPYA 1C0FA 3US5A 4GVBA 3DXSX 1RT1A 4CCHA 2KYXA 4OZ0A 4U7BA 4U96A 2QFIA 3IO1A 4BQLA 3HO1A 1F2GA 5A6WA 3PEHA 3NOGA 1VQMN 1WWHA 1RI7A 4F4WA 5JVGQ 3M2RA 1VQLN 4ZVEA 3ZTPA 4PWDB 1RWVB 5JJBA 3UW1A 3ILOA 2ZJRQ 3B54A 3IWLA 3BSNA 2H54B 1C1CB 3VOVA 5BN9A 2PSZA 5FIIA 3J80U 5AXKA 3JQJA 4U95A 3DN9A 2UUCJ 4RW9A 3ZETA 1V5VA 5GMDA 4DQQA 4CLLA 3HHLB 4I2PB 3G82B 5DQHA 2B9EA 3TUJC 2W2PP 3RYLA 4DV7F 5HOOA 3IBWA 4A8FA 4FJ5A 3AVNA 4JOUA 4CLSA 3OJUA 3A5OC 3W8GA 5KFYA 1IBKK 3VA0A 2W2NP 3QDKA 3C7NB 1A5XA 4K4XA 3EX7B 1U2VA 1XEZA 3DLHA 4F2RA 2WVDA 5E3AA 3NGUA 1ZTWA 1RGVA 3NVMA 4N47A 1YIJN 2G8HA 2DNQA 3T1YJ 1WDTA 2DYAA 5I3UB 2P9PA 2F5GA 4M5HA 4X4OA 1Q81T 3GOIA 4CHOA 1YJRA 4YB1P 2HZVA 3OTOJ 2F8SA 2E2QA 4OPHA 1APSA 4B1XB 2H9ZA 4FXWA 4JI1K 1SB6A 3DLKA 3CG7A 2JX2A 2R7XA 4ZPTR 3K2YA 2P9SA 3L6QA 3RSEB 4FZXC 5BR8K 3W61A 3N79A 2C2ZB 2FBXA 3CVKA 2ITMA 4LR9A 1Q8BA 4OKEA 4H5NA 1H7XA 1RDBA 1HHTP 1HI0P 3FRYA 4AQYF 3P4UB 4ITSA 2Y1RI 2DRAA 2Z1HA 4GY2B 4OZNA 3O3HA 4TY9A 2B9YA 4UY8O 2A41A 3OR1B 2G8VA 4RWWA 1ZXOA 5JUMA 3EXYA 4CF8A 1RAFB 2QE5A 5H9EK 2AF6A 2DHAA 1M5HA 3ETOA 2QX0A 2UUTA 1RBLA 1IJJA 1WTBA 3OYIA 4X4TA 4ZN3A 2E2OA 2VPZB 1KDNA 1UVMA 1KC8T 2HLTA 3ENWA 1LCUA 2CVIA 1KQSM 4JI2K 3R7BB 1CS4B 1KP6A 1VQ7N 3OPKA 3CJCA 2MKJA 3HTVA 3QLHA 3PW5A 4K50A 5CHIA 2XMMA 1M5OC 3UE5A 2NSBA 1RWXB 3VQSA 3EWGA 4FF4A 4ETZA 5KOWA 4LH5A 3TP2A 2Q31A 4CNZA 2ZHOA 2XMVA 5F0XA 1O1WA 2P9UA 1B7YB 4B3TJ 1RBSA 2OELA 3VGLA 3CIMA 3J7AP 2PMZD 3CWJA 2JDJA 3HBTA 2MQMA 5LL6d 1S7IA 1TKXB 4WFNQ 2HYIB 3RWUA 5LMNF 4J37A 3UDVA 3AA4A 1RABB 4I69A 3U7JA 3UI3A 2MZ1A 1WNEA 3NCQA 2CPIA 2NSCA 4UTGA 1RLCL 3R8YA 4QOZB 1N0VC 4JLHA 3VF4A 3N4WA 2OP5A 2GV9A 5DJBA 4UOCA 2W40A 4HT7A 3OYBA 5HMWA 3MCPA 4B3RJ 2HQGA 1KC8O 2ZH7A 5GINA 2HAFA 4DR4J 3QRQA 3K58A 2ABYA 3U27A 1SAZA 4KFBB 1FX4A 4WQ4C 2OMOA 2JLEA 4YDDB 1PAUB 4OZ2A 4YDUC 3IS9B 1J9AA 3KOAA 1HI1A 5A8KB 4CHNA 4TYBA 3ZTRA 2QA4N 3MEGA 5HI7A 5CZXA 5GMKa 4RUHA 3FQKA 5D6GA 3MR7A 4MLEA 3ZX2A 4FLTA 2VUGA 5E26A 3OTCA 5KFSA 3QBXA 2PIIA 3P31A 5EU7A 3NLCA 1XR7A 5JLFA 1PAEX 3DHWC 4O23A 5C12A 1S7HA 4FWRA 3VETA 1NKCA 4M5DB 2IYGA 2O8CB 4KPYA 4FNHA 1X8DA 3MEDA 2PDAA 1AFJA 5C2FA 2VKRA 2HNDA 1L3UA 5HBMA 1UWBB 4Q44A 1XHXA 1NOZA 1T95A 3G6YA 4U67L 3O9SA 3ZETB 4JRQA 1QY7A 3MI7X 1KAZA 5L1JA 3BY5A 1D9DA 3QGGA 4NEZA 4DQIA 4LF9J 1TKZB 2DITA 1IBLJ 1WB9A 4DV4F 3PJWA 4G65A 5HMYA 2BTFA 3FBCA 4UT4A 2PC6A 3UN3A 2WAQD 1NSKL 2ASOA 4H0TB 3IDHA 2P51A 4NCGA 2AYMA 2AHOB 4RNHA 3U1MA 1CJUB 4X4RA 4FW2A 1IBMK 3GSDA 2LQ5A 4OMFG 2A10A 3W8PA 4CWBA 4CLYA 1ZAWA 2AZ3A 3A3NB 1HARA 4Y6IA 3SMPA 3ONQA 4B9NA 2XRIA 2BACA 1PJ5A 2GHPA 3H25A 2JHEA 3ILJA 3NWGA 3J7YU 3L95X 4KH6A 4IRCA 2HS0A 1HNZF 3EE3A 3ENHA 1NAQA 4CJ5A 4UOGA 2JH3A 3PTWA 2DJWA 4OV6A 4BR9A 3MEEA 2ASMA 1LWXA 1RACB 1L3KA 4PA1A 3BEXA 2Y0BB 1I94K 2IBKA 2IOCA 2KO1A 2LXIA 1VQMS 2NUBA 4RW6B 1HRHA 3EY1A 4UOFA 2FYXA 3HP6A 5M2PA 4FWNA 5H9FK 5AXLA 4PG6A 1TK8A 4HKQA 1IJFB 4PXCA 4LMZA 4P74A 4CJTA 4RPFA 3G71S 3KHGA 2YWGA 2R7WA 2O5DA 4HVJA 1JJ2R 3MCNA 3W62A 2YX6A 4B9QA 1Z4UA 3UE2A 2QW9A 4WKYA 3OL7A 2YNHB 2DCUB 4FJIA 3OSNA 4CZLA 2ZH2A 2MKSA 2ZDOA 4NX9A 1VQ6N 1TTHB 1UW9A 2D3O1 4USTA 1RTDA 4M5NA 3P5JA 2Q6CA 4CLFA 4LF7F 3ZZYA 4K8RA 4Y65A 3UFCX 2KFZA 3R5AA 1ZBFA 5E84A 2XGQA 1UJ6A 1RT4A 1S72N 3VPZA 5HANA 1FCAA 4LF6F 1NNEA 4W5TA 3D3BJ 3EGWB 3WZ0A 5AQNA 1YTUA 1BWEA 2HBKA 1S0NA 1FXLA 3K5PA 1WEXA 1M90T 1TMJA 4K4TA 4Z4FA 4DBQA 4XEIA 3QJPA 5EGYA 3DRRB 3M30B 2ZQBA 3VQEA 1NWKA 3UVJA 2RQKA 3KFWX 2UUBF 3O9QA 4DR4K 2CZ4A 4Q0BB 1QZ5A 2WBRA 3CYMA 1BA1A 4Z0UA 1HQ2A 2XNRA 1ZETA 1NMDA 1WACA 1T05A 3GFYA 3P8BB 1SL0A 3VQ4A 2IVNA 1QLNA 3MAAB 1YG0A 1RUSA 4I4BA 1KVIA 3CFRA 3NGKA 1LAVA 5DMRA 2YKMB 4J91A 4JYAK 4LSNB 5FJ4A 3AO3A 1VRTA 4WIQA 2LQJA 3RB0A 4CIGA 4FJHA 3BJYA 2E1CA 3IUCA 2BA9A 3BS9A 3HPGA 3V9SA 1NU4A 2RHQB 4OYBA 1W9HA 3R5GA 1GXTA 2L41A 2H5EA 2QRRA 2DFEA 3SJHA 3CC4N 2G1DA 3TAEA 3QFWA 2J4RA 3ZSVA 3KD5E 4CZFA 2D3UA 3D6TB 1ICEB 4ILJA 1VRUB 1ELOA 5HRRA 3HXMA 4X4VA 2XZDB 4C6AA 4CJRA 3W64A 4OX7A 3FBBA 3THYB 1LXNA 3VGVA 2LQBA 1VR6A 3G4SS 4M45A 2VFRA 4IOAL 1I51B 4C7QA 3BZCA 3A5MC 1RWPB 2F8TA 3MPDA 1RAJA 3EICA 3CPWM 1SH0A 5AQMA 3CXCR 1H7WA 2HFOA 5RUBA 3A2FA 1KLMA 1RAGB 2Z1JA 3EYZA 2XO6A 2GVDB 2BQUA 3NAIA 1SCJB 4HHUA 3QFHA 3D54A 5C24B 5A8WA 4DV3F 4C1NK 2YKMA 4EIAA 3UCZP 1NM1A 5F8LA 4BR4A 3DOKB 1Q8LA 2A2DA 1NRKA 1KNZA 3LALA 1WSVA 3S3NA 3V6HA 1Q7YO 3ILLA 3I8BA 1NJZA 4O55A 3VCDA 2QEXS 1SV5A 3PYFA 1CEZA 3OBIA 2V67A 2XM3A 1IM4A 5KG2A 3MXIA 1WLJA 2IIHA 4XAKA 1VSHA 3DHXA 3F44A 3R1HA 3MXJA 1N54B 1U49A 4WTOB 3QT8A 3GYXB 2D3ZA 3WXKA 1JLGA 2N3OA 3TYTA 1IR1A 4JKBA 4FJLA 4IWVA 5KFJA 1S72S 2HS4A 5I42A 2ZH1A 1NK4A 1GFWB 1SC4B 5AQUA 3RMBA 4AM7A 4ELVA 1UAXA 3TAPA 3HHEA 4RBUA 4PG8A 4FVCA 4Q45A 3O9TA 3PX0A 2HVDA 5ETNA 5LL6Z 4KB1A 3OTBA 2AV5A 3HCXA 2UXDF 3FGUA 2G8UA 3OL8A 5JS1A 4L3KA 2UXBJ 3V81B 3WC0A 1VBXA 4R5PB 4MMOA 5AE3A 4X84A 3FKBA 5LMUF 4Y28C 2OPQB 4LFCJ 3M6UA 2XC9A 1S9GB 3OUYA 2GMJA 2WONA 1I1GA 4DCPB 2C2OB 4CIOA 3KWIA 2CPJA 4AM6A 3LOUA 3GG4A 4V1Ak 1ITGA 4MKBA 2EG2A 5DQGA 1U2CA 5LT5A 3SUOA 1G1XA 4UUXA 4M3XA 4BQZA 3LP2A 2OGUA 4DR6K 2BANB 3D0GE 5I3QA 2WVFA 3QEXA 3G6EN 1T02A 4PUOB 1HQUB 3S01A 3WHIA 2B4PA 2HK2A 3K0JA 4FYDA 1F21A 5AQHA 4CD1A 5IC6B 4F4YA 4ECWA 1U1KA 4KRWA 4GW6A 3HHLA 4CGIA 3C6AA 1W2IA 3VQ7A 2XMAA 2ZE2A 2R8JA 2VWBA 3QEWA 4WFYA 5CCLA 3H20A 2AJ2A 5LSRA 4OV1A 4W92B 3CCSN 4NPOA 4E7JA 3MMJA 2X74A 4BRCA 3CO9A 4PABA 5BR9A 5GADI 2HWIA 2CQGA 1TKZA 4KJIA 1PKUA 2LQ8A 4LT6A 3BBFA 2P6TA 2XMUA 2FTRA 1IKYB 4DMZA 2WCXA 4J9OA 1AT1B 1NLKL 4NYFA 3BKFA 2YHWA 5C2GA 1RHUB 4C3LA 2MGZA 2WOMB 2VCPA 4JNEA 2KHOA 5M1KA 3N01A 3QGPA 1TUGB 1NKBA 1ULRA 2DGSA 4IG0B 5BR8F 3EE9A 1FXXA 4WQ5C 4GV3A 1H2UX 4KBOA 3MMCA 2A5XA 2W25A 2KG0A 3QMLA 3ATUA 2HNZA 1BUXA 5CD4H 1JJCB 1VBKA 3VQTA 2P5VA 5HO4A 3JS6A 4GV6A 3DXBA 1YRTA 3FZHA 4PG5A 1KVBA 3W5ZA 2YCHA 3GIIA 3G86A 2FVCA 5E3RA 4QW9A 1NDPA 4GO5X 3VHQA 1LOUA 2Q3PA 5BPNA 4L75A 3AGKA 1N36J 1YITN 3DOMB 2GEMA 2Z4PA 4U7UK 4NASA 3KMQA 1SQGA 4BE2A 4HCCA 4NLRA 2UVRA 4NZ0A 3R5DA 4CJFA 4JEPA 5IV3A 4Z4HA 2XYPB 4MTPA 4BC3A 2COLA 4FJXA 4NXMJ 5E33A 5DM7Q 2HNYB 5SUHA 4Y3CA 4TU9A 4CGGA 1GNKA 4MFBA 2CQ0A 3WNFA 3NDKA 4G1QA 4NXNF 2CFXA 3ENBA 1YWXA 4TLQA 5F9NA 4DL4A 2W2MP 1NMNA 2KN4A 1MN9A 4FYWB 1RWUA 4LRBA 2GUIA 2A2CA 1HD1A 1NJIT 4C1NI 3AXKA 4IUFA 3WDOA 4OI3A 3HK2A 4M5MA 1HHQA 3D7SB 2QWLA 2DGOA 3B8AX 1VQON 2YKPA 5LOQA 3AY0A 4EBCA 1ZTTA 3UO0A 4C48A 1MWMA 3VEVA 4CJ7A 3C2PA 1XMQK 1OYEA 3G25A 3CD6S 1JLFA 2R4FA 3TTCA 2ZWOA 1R8CA 4LF5K 2QTDA 1G3OA 1VIOA 3G2XA 2QT7A 4B08A 2RNEA 2YV0X 4DV0K 1HYSB 4AQYK 2FD2A 2BE2B 2RSQA 1IH7A 5F9LA 1QUPA 4ED2A 4LF8F 2BKPA 3H2LA 1LW0A 1HYVA 2VGMA 4A8WA 1EO1A 2OI2A 2ASLA 2WOMA 2VG5A 4O8KA 3BPDA 2GC8A 3CSKA 1P1TA 4IKAA 5ETOA 1WI8A 4I2PA 2AW0A 4TY8A 3DRSA 4YEAA 1N52B 4K4SA 2ATQA 3AVFA 2WBMA 1B9FA 1H1VA 2K8GA 4BR7A 4PL8A 1RU2A 2Q1NA 3K5OA 4ZVPB 3G6ES 4CF1A 2MQLA 4NLTA 2A0FB 2OPPA 4IO9L 3FK4A 4CLUA 2D9OA 4IOCQ 2CG4A 3NE6A 2OHDA 1S10A 4WFZA 1OS5A 1SPBP 2F1FA 2CJXB 1FTRA 3HJFA 4ED7A 3BZKA 3ZTSA 3CMAN 1B3TA 3LQVA 4V19J 5F8GA 2QA4S 2I38A 4FZZA 1V3SA 2V68A 1Q5YA 2BJ7A 1BG3A 1B99A 4K59A 2B5JA 1WF2A 4GKJK 3CJ8A 3EXCX 1R8HA 1X0FA 1RA6A 1HYSA 1RAHB 3SQOP 1GH8A 4CO0A 5BYSA 1DKGD 3QIPA 2MJUA 3PSIA 1F5CA 3TZWA 1PSDA 1LNQA 2EK6A 5AZJB 3HOSA 3W5XA 5A2QO 4QU6A 1JXEA 3PSFA 3TABA 7FDRA 4O0JA 1RCOB 2YPZA 4WCEQ 1Q82T 2XGPA 2JLGA 3DLGB 1YJTA 3M8SA 5CR4A 4BVPA 4FLZA 2YKOA 1S49A 2WBNA 3ZT4A 2AJ4A 5B0AA 1CBKA 4DTRA 4JD2A 4BRPA 5KFQA 2R7TA 2POKA 2HHHF 4RW8B 1S76D 5BREA 5AQWA 2Q6BA 3GJSB 4CERA 3IN5A 3KHRA 4DV5J 5DLFA 2YNIB 1U45A 3E1YA 1T9UA 2J7WA 1N5SA 1M1KT 4ZPCA 4ILMA 3MUTP 3TVYA 1EARA 5JS2A 5CA5A 3D0IE 2KHCA 1NMEB 4H4MB 4AUKA 4E7IA 2IBOA 4JI8F 3AVBA 3DM2B 1H74A 3ZSQA 3QICA 3THWA 4YB7A 4CRJA 1KQFB 4U8VA 2XBPA 3M1FA 1FXDA 1FNOA 3GLJA 1SS6A 4FWQA 2FGOA 2NXJA 2Z2ZA 1HNIA 2G13A 4MAKA 3WBZA 2CQCA 1TKTA 5IT9U 3CXCM 2ZBQA 2FJEB 1B9DA 1SKUB 3VAHA 3JTPA 3G8QA 5HVGA 2AGOA 5LM7E 4DPYA 1NK8A 1IKVB 2NRXA 1JQGA 2LLZA 2N7CA 4KSEB 2KLAA 4G6VB 2XSJB 3QAEA 2YX7A 2JC0A 4M63C 4FK2A 5C0YA 2BM1A 5LMUK 3SCLE 1X0PA 2O8FA 3R9PA 4AQYJ 1YZ7A 1H2VZ 2EFQA 3R1LA 4W5RA 4PUOA 3HP9A 1J5OA 4NLDA 2W7AA 3CULA 4E19A 4HI2A 1KLMB 3CCEN 3CCLN 2RF2A 1BA0A 3G10A 3ISZA 4B8AB 1DJ0A 2W7PA 4RG8A 5IQ6A 3NCPA 2DIUA 1OVYA 2GIRA 3U4LA 2HBJA 2ZVIA 1FNMA 3O8WA 2JEGA 2V0NA 2B6AB 5C7PA 2ZJQL 4JI1F 4B9MA 3H59A 5M2RA 5D0GA 3ZX3A 2R7QA 4EU0A 1NHKL 4AHUA 4HUFA 2IAJA 3CCRN 1XI1A 3I9ZA 3N5BA 3CFPA 1JLCB 3VQ6A 3N9UC 1FF2A 4DN0A 4A57A 3CC2N 5HATA 2XB2D 3B78A 2DGXA 1KOHA 4CH1A 4OI4A 2W6KA 1GLBG 3I0RA 2KG1A 3S3MA 3FFIA 4CJEA 1DTQA 2OEMA 1KS2A 5J2PA 2XHCA 2HVIA 1EQ0A 2KW4A 3JTNA 3NBPB 5I42B 5AQLA 2ALYB 4B9UA 5BPMA 1OQ6A 1KFSA 3GL1A 1KCFA 1M5VC 3ZSYA 3DU6A 3CMES 1VQ9S 4OYMA 1OPZA 1HNZK 3LAMA 2EWHA 1J53A 4C8YA 3IAM9 4OJ1A 2B0GA 3HYFA 3DM2A 5HL7Q 3RW6A 3ID8A 2LXFA 1NCLA 5BN8A 2ACMA 4ZPWR 1MROA 3I33A 3VGTA 2XEXA 3SSSA 4O4GB 3C46A 2CIMA 2N3LA 3QIDA 1OO0B 3E2EA 4QIWD 1MWQA 4NLXA 1WUUA 1VQLS 4OZLA 4C3MA 4P2FA 3DI6A 4O44A 3EN9A 1PYSB 2Q43A 4BR5A 4WBFA 4ICLA 1YJVA 2NS1B 3H90A 3C19A 3PIOL 2N4DA 3GB0A 3LPTA 2O3DA 1FEEA 2QFJA 3S41A 4CZJA 2CDRB 2XSFA 1LQ9A 3RRKA 4G1QB 4N7TA 4B3MJ 5L9XA 2HVEA 1DLOB 4M63A 1ZA2B 1T03A 1G7CB 4M5IA 2AX0A 4CZCA 2RU3A 3FCVA 1NB7A 3QSYB 3L3CA 3NGDA 8RUCA 2ZH5A 1TL5A 3W9HA 1RT3A 3KHYA 4FOEA 5DDQC 1UKUA 1UOCA 3VQDA 4QS8A 2BRLA 2FUG9 1HKAA 2MQPA 4KKOA 2DHXA 5KFKA 2CQBA 2RUGA 4ZLJA 5C42A 2ZH4A 2DNRA 1MU2A 2D0AA 1UVIA 1TQLA 5GAGI 3MEEB 5KG4A 2HBYB 5EUHA 3SMZA 2VJVA 3KLEA 5LJ5Y 3CB4A 4QIEA 3OYEA 4DUYJ 3H5XA 2B5JB 4LBHA 1Q81O 2HF3A 2OAUA 2GAGC 3PX6A 3TR5A 4B9SA 2M4MA 4WFAQ 1XUPO 3DMJA 3CDWA 1RT6B 2YWWA 2HPUA 1XMQJ 2KKZA 3AFGA 5HVFA 3TUZC 2XHWA 4RNFA 2J9CA 3JXOA 3GIKA 1IKYA 4P52A 1NGAA 3B4DA 1N5YB 3HFZB 3I32A 1BXNA 2CNNB 4LJMA 5AXNA 4MO5A 2QM1A 3SFGA 3MR3A 2K06A 1WG1A 1CULA 4JI6J 3NG8A 4OQJA 1RWKB 3NGTA 1SQKA 1YUWA 3BGRB 3CCUN 1GQEA 4WFBL 4RUAA 3SZ2A 4I6MB 1FD2A 4FM2A 3LZJA 3EM1A 4JRPA 4X65J 1M5PC 3PM9A 4Y2IA 3TUPA 1T6DA 3T7ZA 2P9KB 5B0CA 3MMAB 5KPZA 3JSYA 3SQGB 2A6OA 2AJ1A 3D0HE 2WVCA 1RT2A 3EVWA 4CTAA 1U1OA 4FL9A 1R8BA 4K25A 3VF0B 4OYOA 4DR6F 3QNWB 2E5GA 4FN5A 3HSGA 4OKKA 2IVFB 4DXLA 3AVHA 3RR7A 4ED4A 2N82B 2OMLA 2AP1A 4H03B 2W9CA 2GVDA 1Y3KA 3KLGA 2CGLA 5AZIA 4CLZA 1ZPVA 1IBKJ 5HK4A 3RUBL 4GMKA 4F36A 1F3VA 2VPXB 2HGLA 2EVZA 2ZEJA 3TTFA 2OLWA 3PW0A 2AMCB 4DV0F 4ID5B 4ZTJA 2Q79A 2JWLA 3QRPA 3L4QA 3JTOA 1AW0A 2RRAA 2YHAA 2IM0A 4JI8K 3CD6N 5HL7L 2DBBA 2QN6B 1NZ8A 3SDEA 2F9WA 1T9VA 5DM7L 1RAIB 2WUSA 4C8OA 4IQXA 1Y0HA 4J9UE 5ETLA 2F7TA 1BQNB 2H65B 5U47A 2ASDA 1YT3A 1VRUA 3AOCA 3MCMA 1IXKA 1X3MA 4CD3A 1U1RA 4CK1A 4CK3A 1EHWA 2DT9A 3IR6B 1U6ZA 2HIQA 1RB0A 2ILZA 4P7VA 1W25A 2F4VJ 3W3DA 4X64K 2ZD1B 3M8WA 4FVMA 4R79A 1SIWB 4PCQA 6FD1A 3I56S 4UY8T 2B3TB 1ACMB 1NLVA 1MN7A 4RR5A 1NPPA 1VSIA 4AHSA 2XYHB 3BYRA 5LXRA 1B0VA 2HOEA 4DV1K 4B3MK 1D5AA 3KG4A 3UPFA 3CM5A 3RTVA 3M32B 3HM9A 5AQIA 4ZHRB 3PKMA 4FYYB 4J8FA 1OWXA 3PO4A 2IA0A 2FC0A 4FDFA 3HI0A 3QYYA 4HHTA 5EOYA 3UNYA 3ZTOA 4GV9A 4PY5A 8ATCB 2DH9A 1REVA 1HR0K 2PAVA 4QPXA 4FK4A 1FDAA 1QQCA 4IDHA 1NJWA 2CJYB 4GVLA 2BV3A 2PEHA 2FLOA 3LP0B 1VQPS 1KVAA 5FRMA 4ZIVA 3LP2B 3M8YA 3PCOB 4QU7A 1MMNA 1ZOTA 3NGSA 3V2UC 2P9IA 2J9DA 3DGVA 3KD1E 4QWDA 2Q2RA 3P45B 3HKZD 3J7ZO 4P73A 1S6UA 4ISFA 1F9EB 2BKOA 1W26A 3W3SA 1VQ8S 4LVNP 1KVCA 1IN0A 1BUPA 3MEGB 3O5TB 2RIJA 1ZC6A 2OTLN 1UPMB 4YOWA 1YKWA 2GQQA 4C2MA 1YDLA 4ZVGA 2M5YA 2KXHA 3B6OA 2F9DA 4DR5J 2J0QD 3TSQA 2HHVA 4DJBA 2AX1A 1KHWA 1OJ4A 2NUUG 5KFXA 1WC5A 4B02A 4CFDA 2HSEB 1XK8A 1RILA 4J9LA 5SZTA 3M8QB 4DF8A 2BE9B 3DDNA 4U9RA 2AU0A 2XWYA 4M3YA 2J6TA 3JYTA 1S0OA 3MTKA 4M3UA 1FHTA 1G15A 2CWXA 2DH8A 3IR7B 1U1LA 1S9FA 3PW7A 3CJKB 5HRNA 4CHZA 4JI3K 4QIGA 5CCMA 2IVMA 2KT2A 1SZ2A 1I3OB 1WC0A 4OHXA 2V34A 1HNXJ 1VBZA 4GKKJ 4DLEA 4P10A 3QNOA 5BPLA 2MZRA 1DY3A 3RMAA 3AAQA 3NNCA 4KV8A 3PACA 1IKXA 4NXNK 2GAHC 4M7XA 3R6GB 1VS3A 4A61A 3K5NA 4FF1A 5BRDA 3PX4A 1RDRA 3QJJA 1DHMA 4CHPA 2UXCF 2CADA 2FSJA 2HHWA 2R7RA 4AHRA 3LF0A 3R97A 3HVTA 3SBMA 4DU8A 4CZEA 3SAFA 1UZHA 4HR2A 4JI5J 3J7AN 3KKFA 1VCTA 4CIFA 2JNJA 4JAXA 1NHVA 1MWZA 1PYTA 1WKJA 4NA2A 1ZZFA 4PPDA 5B0DA 5KQDA 2P9NB 3TVZA 1C2PA 5KFCA 3O4NA 1ZBHA 1LWEA 3S3OA 3QEPA 2CNLB 2OPSA 1WHVA 4OLOA 3VQ9A 2LA6A 4CGJA 2FHJA 1WSHA 4QIFA 4Y00A 1BWFO 2UUAJ 3T6JA 3R6LB 2CPHA 2OEKA 2F4FA 2VG7B 3QAUA 1UCNA 3F2KA 1T0TV 1X4FA 2MZTA 2I9SA 2XMTA 2G8KA 1G6BA 4NLBA 1D8ZA 1LK5A 4DR1F 1PYOB 2PO4A 1ZBUA 3JSBA 4W5NA 1NH8A 1BI4A 1NG9A 1WSJA 5C42B 4FO0A 4J2AA 2R8IA 2DNPA 1UFLA 1C0MA 4X4PA 4D3HA 3IKMA 1Q86T 3SBGA 3J7Z5 4IOCL 3BH6B 2W4DA 5F8IA 4PKHA 2FLLA 3Q2TC 5L1IA 5GAHU 1Y97A 3VMFB 1K73O 4HDGA 4N56A 3KG0A 3EGNA 4J9PA 1CLFA 4DPWA 3THYA 4W4MA 4PYDA 4JHDB 2IPOB 4RJVA 3KK7A 3H98A 4GKKK 5FRNA 4R5PA 3M8QA 2Q1LA 2YI1A 1RT2B 3WIUA 1Y11A 2OEJA 3T1HJ 5B0GA 2W7OA 3MCOA 3L2QA 1URNA 2NYIA 3SPYA 3DLKB 4OJHA 2V63A 4NE9C 4DL7A 1HWUA 4HACB 2Q0RA 1ASVA 3DI6B 2VASA 1XQSC 3I5BA 1MDUB 4DZDA 1BHNA 1VC0A 3SMSA 3HSTB 2PI4A 4KE5A 4N76A 2P9IB 3ZT3A 3IMXA 1VK3A 3PRBA 4F3MA 1SC3B 1U09A 1TK0A 2EW9A 1U0HA 1WOQA 2ZVSA 3GG1A 3M2UB 1OH7A 3VF6A 3KKSA 4DU3A 1EAYC 1D3WA 2G4BA 3VZIA 3G6VA 4B1UB 2E1RA 1HLUA 1NK5A 1QTNB 2V6AA 3ZZPA 3LZIA 3HM8A 3F9KA 3R5CA 3UR3C 3U9DA 2FVRA 2W2OP 2FB0A 3JAMY 1BCMA 3AV9A 1RKJA 2NZ4A 3NMUA 4WXWA 1QHAA 3E51A 2VODA 1HNXF 1YXQA 1PO6A 4M94A 2K7KA 1XMOF 2HMIA 1S12A 3VZHA 4X65K 2E6LA 1C0UA 1S9EA 2HRUA 2BJEA 1TL1B 2ZBRA 2IM2A 2AT1B 3AHPA 2EG1A 3JQMA 1FRXA 2ROGA 2HHQA 4IZ9A 1PBAA 3MXMA 3LDLA 1RT1B 1QUVA 3GU0A 4C8LA 3W2WA 4Z4CA 3ZXWA 2RQCA 1WELA 1H72C 1XMOJ 4FJ8A 3A5LC 3PFOA 4J9MA 1UWAA 5GADP 4DU1A 3HSJA 1KR4A 2VD3A 1K0VA 3MDQA 1HD0A 1HKGA 4YP3A 1U1QA 2NRVA 2QWMA 4PL7A 3AODA 2DKOB 3DXMB 1U8WA 4ILHA 5ADXH 1U1NA 2RF2B 4IJNA 2UXDJ 5DK5A 1J2VA 4Y34A 3GQCA 2RPIA 4PR6A 5KFFA 2V50A 1FJCA 1MNEA 3E9OA 1PC5A 1LWEB 2ACYA 2VKZG 2CH6A 2DGWA 3L8BA 3PNIA 2J0WA 3AVCA 3D68A 2R7SA 3KKRA 1I3AA 3L2VA 5ETKA 1OH6A 2MZQA 4ZDNA 4CTAB 3T19A 2V8PA 4B9TA 1T05B 5AXMA 4NCAA 3C15B 4OYIA 3AGRA 1MROB 4DSJA 4YOUA 2G0CA 2HQCA 3HLUA 3GCXP 3EZWA 5AQZA 2CRLA 5EWFA 3FQLA 4XPCA 2FHMA 4AT1B 3IFEA 1VSEA 1N48A 4ED8A 3DRRA 2KB2A 3VWSA 3BGLA 4BG8A 4DSIA 3ZC4A 1L5UA 1R8PA 2KRBA 3T5JA 1TELA 3OVAA 3TZXA 1T3OA 2KL8A 3PG9A 3SQ1A 3LM9A 5KQ8A 4KTWA 4K4YA 4U67Q 3ZSZA 3OFFA 4QYRA 2VWKA 4WU2A 5B0BA 1BISA 4O3RA 4K0KK 4HTUA 2WSCC 5K8NA 4FF3A 4BC4A 4KFBA 3TTDA 3Q22A 1HPZA 4ECUA 2EXUA 1EJ7L 1KTVA 5IC4B 3R7NB 1K8KB 4P9SA 2K3KA 4TLRA 1FKAF 4OI1A 1YZ6A 3NCIA 4DL3A 1Y00A 1S0VA 4A8SA 1E3MA 3I0SB 1JCFA 5T7BA 2E2NA 5L8RC 4FWLA 2EFOA 1GLFO 3Q8RB 1K9MO 2F96A 2H4YB 3H6EA 2M3DA 4NA1A 5B0FA 5KFTA 4DR6J 3RB6A 3L2UA 4BWJA 1J5EJ 1RBTA 3E3XA 2X1FA 3MWPA 5CY4A 4H0PA 2BJ9A 1GAOA 1A7GE 2JRSA 2R2SA 4R0JA 1P6TA 3FE1A 1BI4B 1VSDA 3KK3A 2V94A 2OTJN 3H45C 3WNHA 2UXCK 2YJEA 4BHQA 4FK0A 5D0HA 3HI9A 1R59O 1KVKA 4ED1A 1HUXA 1BQXA 4FWSA 3X3UA 1KD1O 1JB0C 3OXLA 4DV7K 1V3ZA 1A5WA 3ENVA 3MEKA 1XC3A 3O3GA 4ECQA 4KPCA 4MYUA 3BGRA 2IM3A 2PD1A 1TKXA 1H38A 2GA7A 3HF5A 3V6JA 5BXIA 4IYQA 4NCGB 4QIVA 3TAGA 2C2KB 3CC7N 3ZT0A 3BSCA 4W5OA 5DDOC 4OPKA 3UR0A 4DN9A 4Y2AA 2KZZA 4HYKA 3TEHB 2E29A 3FZLA 4F4XA 2MKIA 1SUQA 4GKJJ 4CO5A 1OMSA 2E1AA 3UD4P 3N4QA 2QGFB 1E6VA 4MKAA 2ZC3A 1F5AA 3PJXA 4Q43A 1Z1ZA 3O9RA 4FXVA 2VG5B 3HVTB 4M41A 3VQQA 2AJQA 3DMJB 3CQ8A 2J9DE 1FWLA 4BROA 5G0RB 1NDLA 4W90B 1Q1KA 4MQ3A 3IC1A 2KHDA 1V9OA 4ZVQB 4CJVA 1TK5A 3SDEB 4FWMA 3C65A 3KDOA 3FNNA 4ZVOB 2YHBA 2QO3A 1N4LA 1GMVA 2SXLA 2CQ4A 5ETQA 4BRMA 3BN7A 3CCMS 2MKCA 3V6DB 1Q95G 4EO8A 1LW2B 4LFAK 4NYPA 1N5QA 2ALZA 5FPEA 4F3QA 3D9BA 1GTHA 1RADB 4ECZA 2D9PA 3GDQA 3P38A 2PMHA 4DS4A 4K7QA 3TA2A 1MLAA 1HR0J 1RDDA 3PHEA 1KD1T 3C6HA 4JKAA 3D6MB 1W2BR 2P8IA 3P4IA 2D0CA 4ZJQA 2UYTA 1NSAA 2AYEA 4CDIA 3H5YA 4Q8FA 2DNNA 2QLWA 4K43A 5KT2A 4OX9K 2CKWA 1HW8A 2GUPA 1LFPA