1VRUA

High resolution structures of hiv-1 rt from four rt-inhibitor complexes
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
537
structure length
525
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structures of HIV-1 RT from four RT-inhibitor complexes.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 138
structure length 525
sequence length 537
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1vruA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1vruA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vruA05
2HWIA 2ZD1B 3V6HA 4R8UA 3ZSXA 3M8RA 4RW8A 3HVWA 4CJRA 4KO0B 4GMJB 4RW4A 5EWGA 2Q3SA 2ILYA 5KFHA 3V6JA 4BE2A 1D5AA 4ZPDA 4C8OA 3JYTA 2VG6B 4LQ3A 1JKHA 1ASWA 4E1NA 2QK9A 2YNGA 2E9ZA 2IM1A 4FM2A 3HM9A 2IJNA 1X9MA 1SV5A 3NGZA 3GIKA 3AVKA 4ZPCA 3ZSZA 1S1UA 4QAGA 3E01B 4QWDA 1VSLA 5KGXA 1XHZA 3KLIA 3SFUA 1X9WA 4C8MA 1BISA 4EBEA 1DLOA 2QE5A 4JUZA 3DYAA 4O3NA 1KFSA 4AHVA 2XY5A 1T8EA 3NCIA 3QYYA 4KHSA 2VG5B 3DLHA 2IAJA 2E9RX 1MU2A 4TLRA 4DMNA 1SL2A 4NLWA 1TKXB 4R8UB 2VG7A 4R5PB 3RB0A 3DMJB 4BACA 1IM4A 2JC1A 4DQPA 5C24A 3BR9A 4CF8A 5HRPA 2Y1IA 4WFXA 3D28A 3LP1B 2G8KA 3QESA 4H4OB 3OS2A 3UDLA 4IFVB 3RB3A 1HNVB 2J6UA 1HYZA 1T05B 1C0TA 3AVHA 3H98A 4CJ5A 3T3FA 2QKBA 4XPCA 3BQ2A 3HP9A 1DLOB 4KTZA 4RW9B 4IRCA 2VA2A 4YMEA 4RUAA 4FLTA 4OPJA 2Z1IA 1VSDA 3SUOA 1RNHA 1S0MA 5EDWA 5KT5A 3VQDA 5C25B 1L3SA 2JEJA 4FJ7A 1CLQA 5I3UA 2WHOA 3KK3A 5KT6A 4QWBA 4M42A 4E0DA 2W7PA 1GOCA 3LPUA 2LSNA 1B9DA 4N5SA 4RNFA 4B9VA 3IRXB 2YNIB 4F50A 4TN2A 4CECA 4O4GB 4RW7A 3ZSYA 1WAFA 2HVIA 5J2NB 2W9AA 3DM2A 4OGCA 1TL3A 1ASUA 4O3SA 3WNHA 3EPIA 1HMVA 4IQXA 3VQQA 4FJ8A 1RA6A 5CYQA 2FBYA 3DOLB 1Q9XA 5L1LA 1IH7A 4LSLA 4CEEA 4ZP6A 4FJ5A 4KI6A 3CQ8A 3NDKA 4ID5B 5KT3A 3KJVA 3SQ2A 4C8LA 4JS4A 2CJQA 1GOAA 5KFFA 2E6LA 3DI6A 4O3PA 4Z4FA 3QO9A 2OPSA 2FBVA 4URGA 3NH0A 3Q8QB 1SH0A 2GIRA 5KI6A 2YNFA 1S1VA 1ZETA 3NFAA 4J9MA 3NBPA 5KFVA 2RF2B 3LP1A 4CEBA 3MTKA 4ID1A 3RB4A 3G86A 3OS0A 3LALA 1RTIA 3IG1B 1SUQA 4LD0A 4NCBA 4ZPAA 4TQSA 3D5MA 4RW8B 3Q8RB 1NOYA 4W5RA 2OPRA 1JLBB 2RDIA 4HYKA 3RAXA 1OS5A 4KB1A 3PHEA 1RTHA 1RT3A 1TKDA 4JRQA 3PW0A 3V81A 3VA0A 4EYIB 3OHBA 4PWDA 3CJ2A 1BI4A 3PJXA 5KG0A 4Z4HA 1RDAA 3ITHA 2X78A 2X6NA 3S3OA 1DTQA 1S49A 3O3HA 1IKYA 5C42A 4NRUA 4ICLA 1TQLA 2WRMA 3PR5B 5L1KA 4MKAA 1RA7A 3HJFA 3QZ8A 1I39A 1WSIA 4W5TA 1IKWA 4GVMA 2XRIA 2HHXA 1EKEA 4DTUA 4CJ4A 5DMRA 1XR6A 4O4GA 3MECA 3K58A 3ZT4A 3VQ4A 3V1QA 5J2QA 4IOBA 2F8TA 5KFUA 3HVRA 1REVA 4URQU 5KFJA 5KFNA 3UQSA 1R0AB 3SNNA 4WZQA 3QGHA 4ZPBA 2XY6A 2D0CA 5SWMA 4AHRA 3ZSOA 1W9HA 4FM0A 3V4IA 1C0TB 1S9EB 3M9OB 3OYEA 4KTWA 3V9ZA 3KHGA 3K59A 1TL1B 4NZ0A 1RTDB 4PQUB 1T05A 4F3TA 4CFBA 3KHRA 2YHAA 3AO4A 3OYGA 3E01A 2VWKA 4DLEA 5HP1A 3GV8B 3KHLA 2XY8A 3TAPA 1KTQA 3VQBA 4DS5A 1VSJA 5DGAA 5E41A 5KG7A 2XGPA 2O4GA 4G3IA 4B8AB 3RAQA 1TKXA 4ZVGA 4KHWA 4IKAA 5KRSA 3OYKA 3JSMB 3LP3A 2RKIB 4EO8A 3KTQA 3T5KA 3RMDA 4JLHA 3OYBA 2OA8A 2HHWA 1UOCA 4J2AA 2UVWA 1ZBIA 3GIIA 4ECUA 4OVLA 2JEIA 4FJNA 3ITHB 4B9TA 2HNZB 3G0ZA 4F2SA 5KFCA 3PO4A 3JYTB 5J2NA 4KSEB 2B6AB 4NLPA 4KPYA 1BIZA 1HNVA 3AA4A 3KLHA 1LWCB 4RUCA 4EZ6A 3HHKA 1NNDA 3NE6A 1HMVB 3AVGA 2KFZA 1SL0A 4CFCA 3NF9A 1S1UB 1JX4A 2FBXA 3V9UA 1UA0A 4FZZA 4FK0A 2BRKA 2OYQA 4MH8A 2W9BB 3AVMA 4FW2A 3OLAA 1XWLA 3SI6A 3K5LA 2FVPA 2W9CA 4IFYA 3D45A 5KT7A 1C2PA 2F96A 1S6PA 3L2QA 4G1QA 1TVRA 3HVTB 1JL2A 1TP7A 5CYMB 5JS1A 2BE2B 3HSTB 5CZ1A 1MU2B 3OLBA 1TKTB 1KVAA 1BHLA 4B9UA 3QIDA 1S0OA 1LWFB 3O3GA 5F8MA 3DLGA 2D41A 1NJWA 1C1CB 4FK2A 3ZT1A 2XHBA 1NK7A 3HP6A 1RT3B 5FROA 1D8YA 1RYSA 1VSFA 4ZTFA 3BQ0A 4KV8A 3AA3A 1RDDA 2P5OA 1N48A 2OPQB 3U3GA 3SPZA 2HWHA 2YNGB 4RNMA 2I5JB 1C0UA 1NK6A 4FLZA 1S1WB 3OSPA 4HCCA 3QGGA 5F8JA 4QWAA 1S1VB 2P5GA 4MFBA 4WYWA 2W9CB 2KTQA 3L3UA 2HHVA 4F4XA 3BSCA 4J9SA 1RTIB 4KHYA 4M3YA 3NAEA 1WSGA 4O4RA 3I5CA 3RR7A 3NKYA 5SZTA 4Y2CA 3EYZA 5FRMA 5KT2A 2HNZA 3PW4A 1LW2B 4Q8FA 3SUPA 3TANA 3GQCA 2C22A 3MXMA 4DSKA 4FJGA 3DLGB 4DSLA 1D9FA 4IG0A 2FJWA 1IG9A 3KLHB 4O55A 1GX6A 1JLBA 1Z4UA 3U6FA 1KHWA 2YNIA 1NKCA 1REVB 4EP5A 3M8PA 2YV0X 4PWDB 3MEEA 3IRXA 2W7OA 1XI1A 3CG7A 4CIFA 3I0RA 2R8HA 2W9BA 2BQ3A 3MFIA 2Z1JA 5DQGA 1T7PA 3G6YA 3OYHA 2G8UA 4R0EA 3UIQA 4MIBA 1HJRA 1ZBLA 1NKEA 1D1UA 4B8CA 1S1XA 4N76A 4PUOB 1RT5A 1S9GA 1F21A 4I9LA 2B43A 4ZVHA 3H59A 3KKSA 4FS1A 5FDLB 3T5JA 4DU3A 4GC6A 1QSYA 4DTNA 4O0JA 2IA6A 1LWFA 1I3AA 3T5LA 2RDJA 1RBVA 1CZBA 4EZ9A 4DF4A 4IG3B 3PVXA 2Z1HA 4NYFA 3RWUA 4NLDA 3DDKA 1NKBA 4GW6A 4N56A 5HROB 4O0IA 5D3GB 2Z1GA 4AHTA 2P51A 3CWJA 2VA3A 1C1AA 1SV5B 3LP0B 2FBTA 2XWYA 4RW7B 2OPRB 4JV0A 4AHCA 3VQ6A 3P83D 1NJZA 1BGXT 1WSFA 1JLQA 2QKKA 4MFBB 1S9FA 1RT4B 5KFBA 2ALZA 3HPGA 2IC3A 4IR9A 4FS2A 4EBDA 5T14A 3VQEA 3ULDA 4CIEA 1Z25A 3BSNA 2HW3A 3QIPB 4M3UA 4H54A 1JL1A 3KIOA 2HVHA 2YNHB 3MR2A 3L2UA 2HHSA 4CF0A 3QEIA 2D3UA 3DRPB 1BCOA 1WAJA 4O5BA 5CYMA 4ZHRB 5KFOA 1JLCB 3K5NA 2KFNA 2DTUA 3BQ1A 3H4BA 2KZZA 1S5JA 4KHQA 2D3ZA 4TY8A 5KG5A 4KBIA 4IFVA 3TABA 3OL8A 4I2PA 5KFLA 3CM6A 4F4WA 3SPYA 4IRDA 4HHTA 5L9XA 1JLQB 2W8KA 1TK5A 2HNDB 2R7YA 4DSEA 2ASDA 4DWIA 4KKOB 1RDRA 1FXXA 4LSNA 4Y34A 4K4ZA 4NLQA 5F9LA 2XO7A 4HVJA 4KREA 4K4XA 3NF8A 3TQ1A 5KFMA 3NAHA 1KLMA 3VQCA 4AHSA 4CJVA 3SJJA 3G10A 4FK4A 2A1SA 2GBZA 4FYDA 1RBUA 3IS9B 4M3ZA 1A5WA 5J2PB 4KAIA 5HRRA 3SYZA 1W25A 1L5UA 2BE2A 5EWFA 2R8KA 4LQ9A 1J53A 2IDOA 1HPZA 4M3TA 3DRRA 4HUGA 4CFAA 4K4WA 2CKWA 1HRHA 2PYLA 3PO5A 1UAXA 3MECB 4ED7A 4E7IA 2AGOA 4WXWA 1RCHA 3K5MA 1BQNB 1RT1B 2IM2A 3FDSA 1S6QB 3EZUA 2DY4A 2HMIB 1WN7A 5J2MA 4CGIA 4FJMA 4IH5A 3BSAA 4CHQA 4TY9A 2WTFA 3QIOA 4WFZA 1U49A 2ZE2B 4DTPA 1KSPA 1LW0B 1RBTA 4WZMA 3ZT3A 1NOZA 2OZSA 4H4MB 4E19A 4MK9A 2F8EX 4ZP9A 1TAQA 1X9SA 1UWBA 2I5JA 4J9KA 3VQ8A 1LAWA 4H8KA 4CGFA 3S9HA 2XI3A 4DFJA 1SL1A 3PR4A 2JEFA 3KLIB 1FK9A 2FVRA 4M95A 3CDWA 1KVCA 4O44B 3OYMA 3K5OA 3P5JA 3MEDB 3OHAA 2RN2A 4CEQA 5HBMB 2G8FA 1QE1A 4NLUA 3OY9A 1EP4B 1DTTB 2BANB 4IG3A 1TK8A 4W5NA 3KLFA 3MR6A 4ZMMA 3OVNA 1HQUB 4I2QB 3CDEA 1S6PB 5KFSA 3AVIA 3VQPA 1KFDA 3NGIA 1HYVA 2AJQA 4Q43A 1W0HA 3MEGA 2G8IA 2BQRA 4DG1B 3KK1A 3RTVA 4MKBA 1HNIA 4ECYA 3CDUA 3KOAA 3WNGA 2AGPA 3HL8A 2FJXA 2D7SA 3N6LA 1RT2A 3O3FA 5J1EA 4ECRA 1LWCA 2FLLA 1WNSA 3I0SB 3LANA 2XI2A 1ZTTA 3VQ7A 5J2PA 1S1WA 4CJWA 4RW9A 4ECTA 4X2BA 2JLEA 2GUIA 1IO2A 1NK9A 4J2BA 1GOBA 3MR3A 1DTTA 2BANA 3OL6A 3N6MA 1IKVA 3DYAB 4KE5A 5KFKA 1U48A 3T5HA 3OL7A 4Q0BA 3QEVA 3IGVA 1JLEA 3K57A 4B9LA 4ZVEA 4FBUA 1VRTB 4HKQA 4IFYB 4H4OA 3OYJA 5KT4A 4B9MA 3ISND 4K4SA 2OH2A 4OKKA 5KG2A 2FC0A 4RW4B 1YVUA 1J9AA 2IBKA 1I6JA 2RKIA 3Q8PB 4QW9A 3IGNA 5DGBA 1UWBB 2UVRA 5DG9A 5DQHA 2ATQA 3M8QA 1N5YB 2HAIA 1KLNA 1IKXA 2IC3B 4J2DA 3TAEA 4K8ZA 3RMBA 2UUWA 1JLFA 4FLWA 1SKWA 2KW4A 4KKOA 4RW6A 2YKNB 4HCBA 5C25A 2IS3A 4DS4A 2PYJA 3SQ4A 3HPHA 1LWEB 1BIUA 3DRSA 4MK8A 4ED3A 1VSMA 4ECQA 3JSMA 4EO6A 4M94A 4CFDA 3KK2A 5K14B 3AVAA 2YNHA 4LH4A 3AA2A 4FZYA 4F2RA 5KG6A 3AO1A 2XC9A 3OYIA 4NLRA 3DRRB 1YVFA 4YFUA 1RT6B 1HQEA 4TQRA 3DLEA 2W8LA 3S3NA 2O4IA 2BRLA 1NK4A 3AVNA 3SUQA 3C6UB 4OJRA 4EEYA 3LWLA 4IRKA 4HUFA 1NJYA 2X74A 5KFZA 1U4BA 3GIMA 4QPXA 3PX4A 1QSLA 3DMJA 4NLYA 3ZSWA 4CIGA 3LWMA 2HHTA 2IM3A 3RR8A 4O3RA 3KLEB 1NK8A 1LW0A 1QS4A 3H5YA 2J6TA 5DG7A 4FCYA 4XPEA 3PY8A 5D3GA 3G6XA 2BDPA 1HYSA 4Q45A 4MK7A 3RBDA 3CFOA 1Y97A 2F8SA 3LP0A 3BJYA 3IN5A 3H5UA 4CJ3A 3DRSB 1YT3A 3OYDA 4E3SA 4CGDA 3THVA 1Q8IA 4F4YA 4DQSA 3QNNA 4TXSA 2D0AA 4O44A 3HVTA 2FLPA 1EX4A 4CERA 3RMCA 3BREA 4FVMA 4DF8A 3NH1A 1NK0A 2WB4A 2YHBA 5F9NA 3C95A 3LZIA 3NAIA 5DQIA 3ASMA 3CJ5A 1N4LA 2R2TA 2HNYB 1YTUA 1SUQB 3IG1A 3HXMA 5J2MB 4Z4CA 1ZBUA 3MXJA 4IDKA 1RTJA 4QW8A 2VG5A 5KFGA 4RU9A 3AV9A 2ZE2A 1S6QA 4DG1A 3KK1B 3DLRA 5HRSA 1VSEA 5L1JA 3DLKA 1T94A 4ECWA 5HRNA 1RILA 4B9NA 3MXIA 3AVJA 4I2PB 1TL1A 4XIUA 1K6YA 3MR5A 4ECZA 4O3QA 2P1JA 5CYQB 1VSHA 1BI4B 3NGYA 4ZTJA 2G8HA 3C6TB 3L3VA 3PZPA 2R8GA 3PX0A 5FRNA 5F8LA 4WXOA 1A5XA 3MEDA 4DFKA 4J2EA 4LSLB 4QOZB 3TARA 4IH6A 4ECSA 4WYLA 1XR5A 1RDCA 1JIHA 1C1BA 4Q8EA 4KRFA 1WSHA 4URSA 4NCAA 4DTRA 4NYNA 3PW7A 4FJIA 3SQ0A 4NLOA 1U47A 3KK3B 3ISNC 4OLBA 5T7BA 3NBPB 5C5JA 3QZ7A 3BDPA 1ZBFA 3B6OA 2FVSA 2JC0A 3QGIA 3DOKB 2IMWP 3AVBA 5KFTA 1X1PA 4DTMA 3G6VA 2EHGA 5I42A 3LAMA 1JLGA 1GX5A 3ALYA 1TKZB 3KLVA 1BQNA 2WONA 4JV1A 4ZP7A 2G8VA 3CO9A 3VQ5A 4U7CA 1S9EA 4IH7A 3KMSA 4DL5A 2GC8A 4AILC 3RRHA 3L8BA 3KLGA 2EC0A 4CJSA 4FJHA 3QEXA 4J9PA 4EYHB 3L2RA 4DL4A 2C2EA 4Q5VA 2E4LA 3KD1E 1LWEA 2IJFA 2YKNA 2WOMB 5HLFA 5EUHA 4B08A 5CY4A 4DL2A 2HNYA 4FJ9A 3CJ4A 1KHVA 3ZSRA 3QNOA 2YNFB 3L2VA 3ZT0A 1T03A 5F8GA 4DSFA 4DSJA 2RF2A 4M41A 3DOKA 1CXUA 4CJLA 1NHVA 1EETB 3KKRA 2B5JA 2WK4A 2JEGA 3DLBA 3PW2A 4I7FA 2KZMA 1G15A 3F73A 4CHZA 5I3UB 1KRPA 4KTQA 5KFWA 3LP2B 3VQ9A 1ITGA 4U6PA 4M45A 4M3XA 2EX3A 4KV8B 2RPIA 1FKPB 3KLGB 3V9WA 1TGOA 1C1CA 1L3UA 4EP4A 2ILZA 5KFIA 1J54A 3I5BA 2OPPB 1L3TA 3MF5A 4RNHA 3EY1A 1KCFA 4ED0A 2DFHA 4Y2AA 1TL3B 4OPKA 1CZ9A 2FVCA 4YR0A 1LV5A 1Q9YA 3TAGA 3AVCA 3OS1A 2O5DA 2GIQA 1RT2B 3DRPA 2AGQA 4NCGA 3I8DA 4NLXA 5KG4A 1T03B 3ICLA 4M3RA 4IR1A 4OLAA 4NYZA 1EETA 1JXEA 5KFDA 1D0EA 1JLAB 2D5RA 4J9NA 1U45A 4E7LA 3S3MA 3AVFA 3DLEB 1NJXA 4KO0A 4PY5A 2YKMB 3KD5E 2A1RA 3C6UA 4W5OA 3OL9A 3OYFA 4DL6A 4DSIA 3H5XA 1FKPA 4EBCA 2W42A 5KFEA 1HQUA 4I2QA 2ASLA 4TYBA 4YP3A 3V1OA 1ZBHA 4CEDA 2V9WA 3PV8A 4CGGA 2V0NA 4FXDA 4BE0A 5EWEA 2UUTA 4RNOA 3OYAA 5L1IA 1IKXB 4JRPA 1KLMB 3EPGA 1R0AA 3NF6A 2C28A 3QEPA 3C6TA 4FW1A 4DQIA 1RTHB 4AH9A 4K4TA 4RW6B 1VSKA 3BGRA 1BQMA 5J1EB 4ELUA 1S1TA 1JLFB 1S10A 1RAJA 4E89A 4PUOA 4IKFA 1D9DA 1XHXA 2HHQA 1XR7A 4KB7A 2B5JB 1NK5A 4LY7A 2VG7B 4R5PA 4Q44A 4W5QA 4E7KA 1N6QB 4KHRA 4FLYA 1IKWB 4ICLB 2NUBA 4KFBA 2R2UA 1J5OA 4E7HA 4Q0BB 1QTMA 1HQEB 3KK2B 2IOCA 3H40A 1RYRA 2ZD1A 4J9QA 4ED6A 1SKSA 3GIJA 3RMAA 3CVKA 4CJFA 4CHPA 4CEZA 1RT6A 5KTQA 2DFEA 1S0NA 4CJEA 2UVVA 1WSJA 1EP4A 4CHNA 3NHGA 4M3WA 3KMQA 4FLXA 2WONB 1QUVA 4DU1A 2E9TA 4ED2A 4Y1CA 3VQAA 1QHTA 4N47A 1QAJA 3NH2A 2GV9A 2ATLA 3NL0A 1FK9B 1TV6A 4FJJA 1Z26A 1S1XB 1C0MA 1TAUA 4Z0UA 3V6DB 2FLNA 3MFHA 1HYSB 4FJXA 1ZYQA 4CJPA 4CF9A 2R2SA 1FKOB 1C6VA 3VN5A 2JGUA 4RZRA 1SH3A 2HHUA 4KHNA 3FFIA 4N41A 4CK3A 1TK0A 4Z4IA 4HUEA 1C1BB 3O4NA 3OYNA 2WCXA 4Y1DA 3VA3A 3CIZA 4K4VA 4PA1A 4BDPA 3OYLA 2OPSB 3QLHB 4CF2A 1RBSA 4CJUA 3I5AA 4ECXA 4DL7A 3HYFA 3LPTA 2ZQBA 5KFQA 4CJQA 2BGGA 3OSNA 4ED1A 4CK1A 5HROA 3GYNA 3LDSA 3HVAA 3MEEB 3FQLA 4ZVFA 4IG0B 2C2RA 1JKHB 4G1QB 5KFAA 4O3OA 4YR3A 3CJ3A 2R8IA 5DLFA 3H5SA 3KLEA 3AO3A 3NF7A 5KG1A 1TKTA 5KRTA 2E6MA 4OKEA 3IAYA 4ELVA 4LSNB 2BR0A 4QCLA 4B3OA 1RDBA 3ZSVA 1N6QA 3HT3A 4ELTA 1N5YA 4UQGA 1J5OB 2WOMA 4CHYA 4DEZA 4NLGA 4FJLA 4CGJA 4FBTA 1JLAA 1HPZB 2X6SA 3L2WA 1C0UB 4J9RA 3CFRA 4KAZA 3F9KA 4TY8B 5KFYA 5C42B 4FZXC 1B92A 4CEAA 4TYAA 3H08A 3SFGA 4E1MA 1N56A 4C8NA 3A2FA 4DFMA 3VQSA 1U04A 1VK0A 3QETA 5EU7A 5K14A 4KI4A 4F8RA 3HK2A 4RG8A 3SUNA 3V81B 2D0BA 1VRUB 4BWJA 2KQ2A 4HTUA 4TSXA 3HPOA 4DTSA 3SI8A 3V6KA 4IBNA 1SKRA 4Z4EA 4K4UA 4FLUA 2AQ4A 1YTAA 4DFPA 1TKZA 4YR2A 1LW2A 3TAMA 3DLKB 4DQRA 5I42B 3AO5A 5CZ2A 5JS2A 1A5VA 2BQUA 3OJSA 4NRTA 2I1RA 4B9SA 3LAKA 3WNFA 2UVUA 2Y1JA 3N6NA 2G8WA 4KHUA 2V4RA 1RT4A 4WFYA 4DLGA 3DI6B 3KNAA 4JV2A 4I9QA 3FSIA 2C2DA 2J6SA 3QEWA 3UR0A 5HLFB 4E7JA 3CJ0A 2XCPA 4LH5A 4CK2A 4BDYA 5KGWA 3KLFB 5F8HA 3TI0A 3OJUA 2QV6A 3QERA 5KG3A 1RT1A 1QE1B 3O4QA 3T1AA 1VRUA 4NLSA 1EXQA 2XCAA 2VWJA 3H2LA 2DFFA 4Z4GA 4CJTA 2V4QA 3TR8A 4ED8A 3CFPA 3AVLA 2AWZA 4DTXA 3V4IB 2XY7A 4NLVA 3SV3A 4I7FB 2DPJA 3QINA 4F4ZA 1JLGB 4CCHA 4CJKA 3TWHA 4GC7A 4BE1A 4JS5A 4K4YA 1RTJB 2AX1A 3I0SA 3GILA 4KHMA 4CGHA 3B6PA 3D0PA 1S1TB 1S48A 2IM0A 5KFXA 3BSOA 3PW5A 3I0RB 4H4MA 2VG6A 4Y3CA 2DPIA 1WNEA 2HB5A 3TVKA 5JUMA 4FLVA 3BGRB 3V6DA 5F8NA 2B6AA 1O1WA 3AA5X 4NCGB 3M9NB 1CSJA 3HKWA 3V1RA 3RB6A 1VRTA 3SCXA 2IAJB 4KB0A 4CHOA 4CF1A 4DU4A 3FQKA 4DTJA 5FDLA 3CYMA 4K50A 4WE1A 4DQQA 4ZP8A 1RT5B 1S9GB 4FJKA 3QIPA 5F8IA 5JXSA 1VSIA 1JLCA 1QAIA 2PZSA 3NMAA 3V9SA 3ZSQA 1SH2A 3LZJA 3QLHA 4BWMA 3GV7B 1LAVA 3PJWA 2YKMA 3M8QB 3EZ5A 1S4FA 3LP2A 3Q8SB 4MIAA 1TVRB 4CEOA 1WLJA 4NLTA 3DM2B 2HNDA 5KFRA 4OL8A 2R8JA 2ZKUA 4DTOA 1UA1A 1MMLA 3P1GA 1S97A 3PUFA 3FFIB 1T3NA 3MAQA 2ETJA 3HO1A 3V9XA 4L8RB 1IKYB 4ID5A 1QQCA 4B3OB 4K8XA 2AX0A 3DOLA 2OPQA 3KJVB 2R2RA 4MQ3A 2B4JA 3CM5A 3SV4A 1JLEB 4QWCA 3M9MB 3C94A 5DLGA 5HBMA 1RT7A 1BCMA 1XC9A 4ZHRA 1WSEA 3SZ2A 3WNEA 3IS9A 1QSSA 3E51A 2FJVA 2FVQA 4QWEA 5KFPA 4CESA 4J9LA 3ZT2A 2ITGA 1HARA 3RRGA 1K1QA 3M8SA 2HMIA 3OYCA 1HNIB 3AO2A 4DL3A 4F3OA 3MEGB 3H4DA 5C24B 1JXLA 1L3VA 4OGEA 3TAMB 5DG8A 2AU0A 3RBEA 2IGIA 3M8PB 3UPFA 5HP1B 4FM1A 4BDZA 5DK5A 1B9FA 1JXBA 1RTDA 1DTQB 4PQUA 1CXQA 1FKOA 2ASJA 4CE9A 2QXFA 1ZTWA 1TV6B 4XO0A 3NGDA 4RNNA 4AHUA 3SQ1A 2OZMA 3T19A 3QO9B 4F4KA 4WE1B 3TAQA 1BQMB 3ZCMA 2OPPA 4YNQA 1KVBA 1IKVB 4C8KA 3U3YA 1RBRA 3KHHA 4YQWA 1RT7B 1K1SA 3PX6A 3TAFA 3FRZA 3K2PA 1U09A 1NHUA 1ASVA 4CEFA 4J9OA 4IDKB 4ECVA 4OKJA 4KFBB 2XGQA 2PY5A 3GV5B 1BL3A 5J2QB
chains in the Genus database with same CATH superfamily
3R97A 3R5JB 1UEVA 4BGAA 2HYIB 2XWXA 1XK8A 3X3UA 1VAZA 1X4GA 5M1NA 1KQKA 2AEJA 1GAOA 1X4BA 5HOOA 2NPIA 2Z2ZA 4BRQA 5KFHA 2Y1RI 3V6JA 4CO5A 4B17A 3CCTA 3MDQA 2KG1A 4KC5A 3FGUA 2OI2A 4LQ3A 1JKHA 1ASWA 5EXWA 1VK3A 4OO1J 2CPXA 2R7TA 3QRQA 3ZSZA 1S1UA 1JK9B 4IO1A 2M2BA 5HMXA 4CD1A 5KGXA 4BRLA 3KLIA 1VHXA 1X9WA 1XHZA 1R6VA 3FE1A 4C8MA 2UXBJ 3IWLA 3L4IA 2P9UB 2Q0UA 1ZOTA 4JUZA 4O3NA 1IBCB 4RUBA 3ISZA 3BPSP 3DLHA 2IVPA 2E9RX 1EO1A 1KOHA 2CVEA 3CCQS 1S6UA 1VISA 3MR7A 4DDFA 3LM2A 1IBKF 4JK7A 4UF4A 4KIAA 3DMJB 2HPUA 3LF0A 1IM4A 4CF8A 4KBOA 5HRPA 1MWKA 4WFXA 3LP1B 5KPRA 3TSUA 3QESA 3WT0A 2OD6A 4H4OB 5E7OB 2E2QA 3AT1B 5GAEP 1U6BA 4OYWA 3T9NA 1P9YA 3CCVS 2WFBA 4H4KC 1NGJA 4O0NA 4BC2A 5D6GA 1C0TA 2NS1B 3H98A 4CJ5A 3CJQA 4MDBA 2QKBA 3HP9A 3IUCA 2VA2A 5M1KA 1QM9A 5HJXA 4FLTA 2GHWA 2Z1IA 3SUOA 1K8KB 2VBYA 4DJBA 3VQDA 3BZCA 4Y0FA 2JEJA 5IWAF 3T6BA 3JS9A 3N4WA 1I5OB 3KK3A 3C14B 5KQ8A 4G1PA 3PRVA 4B3TK 3M30A 5AQFA 2W7PA 1U2VA 3CCSS 5JVHQ 3OXFA 3GL1A 3PCOB 4JV5F 2GIFA 5K8MA 4B9VA 2NRXA 3IRXB 2YNIB 3CJ8A 2KXNB 3ZSYA 1SQFA 2AP6A 1HNXK 2W9AA 3VAJA 1O13A 3TTFA 4B3MK 4O3SA 5A8WA 3EPIA 1VQ8N 2M0GB 1HMVA 1ACMB 4K0KJ 2DNGA 5CYQA 2FBYA 4DR1F 4NA2A 2YBVA 1Q9XA 1IH7A 2ZC3A 4FJ5A 4DR1K 3CQ8A 5GADP 4ID5B 1AXQA 4C8LA 4NB4A 3CD7A 5MLCQ 1TL7B 4O3PA 1S3XA 2RILA 2OPSA 2FBVA 4A4JA 3NH0A 2Y3YA 3H90A 2CNOB 3CMAS 3G6ES 1RABB 3EUNA 1ZETA 4ANEA 2L48A 2F9TA 5KFVA 2DGUA 5LM7E 3OS0A 3SAFA 2DNRA 1K9MO 3GFZA 2ROPA 4A2AA 4OV1A 2MKJA 4RW8B 1KEKA 4TU8A 2OTJS 2OPRA 3ZEUA 4ZLLA 5AFUH 3HSGA 2ZH1A 4QYZJ 2ACYA 4KB1A 1HD0A 1KONA 1XNQJ 1TKDA 5CQGA 2ZZNA 2OTLS 3VA0A 1E6YA 5BR8K 3TZXA 4PWDA 1BI4A 3ZX3A 1AUDA 4FXWA 4Z4HA 1RDAA 3ITHA 1GXTA 3MMAB 2X6NA 3D9BA 3FBEA 2HVZA 1DTQA 1SBRA 4OZLA 2XLKA 4V19X 3O3HA 1IKYA 2NZ4A 3VEYA 2AEMA 1M90O 1OYEA 4GKKK 2WRMA 3PR5B 2NXUA 4CBXA 4CLFA 4W5TA 4GVMA 2C3YA 2FGCA 1NB2A 3BR8A 2XRIA 4DTUA 3LDNA 5DMRA 1XTZA 1F5BA 4YORA 4UY8O 4IOBA 4WP8A 1T9UA 4IEIA 2ZH3A 5EGYA 2MXYA 1REVA 2CFXA 3P5TL 1YTYA 4ZPBA 3CC4S 2DXEA 2V8VA 2QGFB 5DS7A 5DZ7A 3W66A 4NZ6A 2E7XA 4F0MA 1S9EB 1VR6A 3M9OB 2K3KA 4KTWA 3NLCA 2OAUA 3V9ZA 4KGZB 4Q7AA 5AE1A 5J1NA 4A57A 2E29A 3VF2A 1JB0C 4CFBA 1GLBG 1UMJA 2YHAA 2MZQA 3AO4A 1W7AA 3E01A 5HP1A 4RPFA 4OV6A 3KHLA 1UVLA 3TAPA 1KTQA 1ZPVA 2H3EB 1VSJA 4F0KA 1T44A 5GADI 5DGAA 2XGPA 4DV0K 2V4JA 4B8AB 1TKXA 1X8DA 5BYSA 4AL6A 5CR4A 4AM6A 3AQOA 1EIYB 4NI2B 3AODA 2EFPA 3DKDA 2YHYA 1PJ6A 3OVBA 3RMDA 2OA8A 4B1UB 3NGUA 4ECUA 2JEIA 3MPUB 5T7LA 1RCOB 4B9TA 3H20A 1VQ4S 5KFCA 5LMUF 4OI2A 3PO4A 8RUCA 3JYTB 5J2NA 2K8GA 2B6AB 4RUCA 4EZ6A 3HHKA 1NNDA 3NE6A 2WSFC 2DH8A 1BC6A 3AVGA 3OTEA 1VC0A 1SL0A 4CFCA 2CPFA 2DIVA 1GT8A 4ZJOA 2FBXA 4FZZA 3ENAA 2PFUA 5A8KA 3H2UB 4MH8A 3CPWM 2YWKA 3K5LA 3JAMO 4BRPA 2DH9A 3HZ6A 4I6MB 1U8WA 1R27B 3L2QA 1JL2A 3HVTB 1TP7A 5CYMB 4AL7A 5JS1A 2BE2B 5CCMA 3HSTB 2BV3A 3J7YI 2M5YA 3QIDA 1LWFB 1OH7A 3GONA 3DLGA 2VL1A 4ZS6A 2BX6A 4FK2A 1VRQC 3G8SA 5DJBA 1NK7A 1EX8A 4JI1F 3HSCA 5FROA 4ZTFA 4KV8A 1JQGA 2Q2RA 3BGUA 3GCXP 3U3GA 3PFOA 1V9OA 2I5JB 1NK6A 2FB0A 4FLZA 3OSPA 4C7QA 5F8JA 4QWAA 4X62F 1Q95G 2W9CB 3FZMA 2ZF5O 4U8VA 4GVBB 3EE3A 2HBRB 2PN6A 4J9SA 1RTIB 2MQLA 3RR7A 3ET6A 5THWA 1F0XA 2MTLA 5KT2A 1MDUB 3TANA 1KAXA 2N3LA 4O55A 3U6FA 1KHWA 2E2NA 2QA4S 3M8PA 3Q2SC 2ZUGA 2FD2A 3OPKA 4PYAA 1T3OA 2FY1A 4LREA 1YF5L 3NY0A 3CG7A 2VODA 5M1OA 2UUAF 1M1KT 2XYHB 4IJNA 8AT1B 3C3LA 3U1MA 1HJRA 5IS2A 1VQ7S 4DV2K 3SLCA 1D1UA 1FESA 4WFNQ 4DR2K 4L73A 4DUYJ 3M32B 1VBKA 4ZVHA 3LL3A 2D3O1 3KKSA 2WVEA 5FDLB 3HHLA 4DU3A 1KKHA 2HMPA 1U1OA 9ATCB 2KM8B 4IG3B 2Z1HA 4NYFA 3TJ9A 1DRZA 4UOGA 2J0WA 4N56A 5D3GB 4RL1A 4AHTA 3CTRA 4QIEA 1R89A 3KXDA 1SV5B 4WFAL 2YWHA 3LP0B 1HR0J 1FDBA 5IC4B 3P83D 2FJBB 4MFBB 2RUGA 3F44A 3E3XA 4K8RA 3HSZA 2BUPA 4UUXA 4WFNL 3EL2A 2HQFA 1UTAA 4EBDA 5MLCV 2B4VA 2UUCJ 1PBAA 3QIPB 1DAXA 2H4YB 3KIOA 4ISFA 2UUAK 1FJGK 1YHQS 3L2UA 1GQEA 4CF0A 3EGWB 1VJWA 4FOEA 1BCOA 2P9KA 4O5BA 3G8QA 3K5NA 2KFNA 2RQKA 2KZZA 1IBMK 2ACMA 3GJTB 3D7EO 3CCSN 2M8HA 4JI1J 3OFGA 4KBIA 1FD2A 4PL8A 2H1YA 2CPEA 3CJKB 4I2PA 3D2FA 3JXUA 2F9JA 5AQUA 1FEEA 2QL5B 1ZZFA 3SPYA 1JLQB 1WDDA 3M05A 2HNDB 2COLA 3DGPB 3FJ2A 4DWIA 2XTJP 4ITSA 4K4ZA 2NRTA 5BR9A 3D7SB 2E88A 2XO7A 5MAOA 3S6EA 4IOCL 3VQCA 4CJVA 1JJ2R 1CJKA 5BN8A 2ZH5A 3FCHA 2XS2A 1P9QC 1RBUA 1X31C 2KB2A 1A5WA 3DHXA 3E9OA 3SYZA 2HS0A 3FMWA 1W25A 1Q7YO 1L5UA 3SXLA 3MD3A 3CCZA 4YDUC 4QOTA 4LFAF 5EWFA 1PJ7A 2GMLA 5A8RB 4HR2A 2CKWA 3D66A 3T1YJ 4NEZA 1QJHA 3DXMB 4BCAA 4GRSA 3EZUA 2DY4A 4FWNA 4ER8A 1B0VA 4WCEL 1KVKA 3BSAA 5AJ3J 5AQVA 4DV4F 2DRAA 3M2RB 4CT9A 3U8XA 1RBTA 4GO5X 4E19A 2PIIA 2ZM6J 4P2SA 2QL7B 1UWBA 3MPYA 3U02A 3B4MA 2Q1LA 4H8KA 3D6TB 3U9ZA 1I94J 5DO2A 1VQLN 5IV3A 4LUBA 1R8PA 3DXKA 4OZ5A 3THXB 5DM6L 3CMQA 3P5JA 3AAPA 3MEDB 3R1LA 5M1PA 2G8FA 3GFHA 5LJ5Y 1QE1A 2YCHA 4OX6A 3VHQA 3UD3P 4W5NA 4R79A 1HKBA 4EFHA 2QM1A 4F3QA 1PC5A 2QMXA 9RUBA 2A2CA 5KFSA 3OXGA 4ENOA 1KFDA 1M0SA 4QR2A 5AQJA 2VZ9A 3T1YF 2BOAA 2G8IA 1URNA 2AP1A 4BBYA 4MKBA 4ECYA 1T9XA 3TO8A 2IJRA 4RO0A 2NLWA 2HRUA 1I1GA 3CCRN 2D3OR 1NDLA 5K9FA 3EDQB 3O3FA 5L38A 2FLLA 4DV4J 4JB8B 3TNVA 1GNKA 1S1WA 2GVZB 4ECTA 5H1SQ 2GFFA 4FPIA 3BEXA 1OMSA 3MR3A 3IDHA 4WP3A 4Q0BA 3D2EB 1HBMA 2J7UA 4X84A 4IFYB 4JI6J 1UFKA 1VQNN 3I55N 3W2WA 2VFVA 4RJVA 2HOEA 4K4SA 4OKKA 2NRRA 2KO1A 2FC0A 1DBDA 3O1WA 8ATCB 3VENA 3DU5A 5DGBA 4CQ1A 4HTIA 5DQHA 2ATQA 1N5YB 1KLNA 1HJOA 1IKXA 4JD2B 2GELA 3RMBA 3GFYA 2YPYA 4WTOB 4JI2J 2YKNB 4M5KA 4HT5A 5C25A 4JI7K 3MHYA 2IFXA 1U24A 3SQ4A 3AJ2A 5AT1B 4ED3A 1VSMA 3BB5A 4HT7A 2YNHA 4M7XA 3BGFA 5BREA 4F2RA 4NLRA 4E98A 2DY9A 2F5GA 2W8LA 1UPMB 2BRLA 3Q8VA 5B0DA 3SUQA 1Q7YT 1KBRA 2LKZA 4EEYA 4OYPA 1U4BA 2GO9A 4QPXA 3PX4A 3I9V9 1G4CA 2LEAA 4CIGA 3LWMA 2PFFB 3VF6A 3SAHA 3MMBA 1B0TA 1M90T 3SDEA 1S72N 2X1GA 1LW0A 1QS4A 2J6TA 3UD4P 4WKRA 2VKZG 2PEHA 5IM0A 4K0KK 3G6XA 1HYSA 3O2IA 1CC7A 2F8SA 3J8AA 3H5UA 3MM5A 3FUYA 2E1PA 4CGDA 3W2VA 3QNNA 5LSRA 3VAFA 2QN6B 1JJ2M 4CERA 4OI4A 4DF8A 3OTOK 4E8UA 2OLWA 3QBCA 4V1Ak 3LZIA 2XMKA 1EJ7L 1R8BA 2ZNYA 1N36K 2LQ9A 3JXOA 2O8EB 3IG1A 1ZBUA 2V52B 1VIXA 3WXIA 2F4VJ 2DVIA 4RU9A 1VQNS 4DG1A 4LFBK 2HHHF 4ILHA 1R59O 2KG0A 2LMIA 3MXIA 3AD7C 4PKGA 4X64K 1TL1A 1Y5LB 4NE9C 3MR5A 2BA9A 1DARA 4UZCA 2D1KA 1UKUA 4EUVA 3W65A 5FRNA 4GKKJ 2FPHX 5F41A 2ZH9A 1A5XA 1MN9A 1NHKL 1BWVA 4LSLB 3LA0A 4QOZB 3FGVA 1JIHA 1MN7A 2A42A 3P45B 1WSRA 4O23A 4FJIA 4UY8T 3BN4A 3SQ0A 3OT9A 1DT9A 3ISNC 4JI4K 2DNNA 5C5JA 5FLXY 5I9EB 2QL9B 4U7BA 1FE4A 3TX0A 2FVSA 3KKFA 4DUZF 5LSLA 5KPZA 5KFTA 5I42A 1ESVA 1GXUA 2WVDA 1GX5A 3WIUA 1IQZA 1XJWB 1TKZB 3KLVA 3SSQA 3CMAN 1BQNA 1FFWB 2KJWA 4BC9A 3SBMA 2P9IB 3CO9A 2J76E 4YOYA 2ZEJA 4DL5A 2VWBA 3FVYA 1RE1B 2GC8A 3AXMA 3RRHA 2ADBA 3GYGA 3HJVA 3E66A 4DHVA 5IWAK 3KYLA 4LF6J 3L2RA 4DL4A 4EHUA 4RR5A 2E4LA 2IJFA 3KD1E 3O8WA 1YJTA 2GVDB 2QW9A 3D68A 3J7ZO 5BN9A 5CY4A 1FW6A 2HNYA 4FJ9A 1QAYA 4IO9L 4A47A 4AE5A 2YNFB 3HDSA 1T03A 2HHPA 5F8GA 4DSJA 2LQ8A 3DOKA 3MOJB 1NHVA 1ZM2A 1EETB 2C3MA 3THTA 2KZMA 3PYFA 1U8SA 1FRXA 5KFWA 3LP2B 3VQ9A 3MCAB 2VBWA 5LXRA 2RAQA 2RPIA 2BVZA 1HBNA 5CA5A 1TGOA 2DPNA 1C1CA 1FRHA 3QGPA 1J54A 2QLXA 1W7WA 3UDEA 2V2VA 2DFHA 4Y2AA 4ZLJA 1VBYA 3SCLE 2BEFA 2FVCA 1MROA 1Q9YA 4DUZK 4CLYA 1E4FT 3KVGA 3NNCA 3CCVN 1F6TA 3DRPA 1JWWA 4NCGA 2OANA 3T1HJ 3MUTP 3ICLA 3O9TA 4M3RA 4OLAA 1N8RT 2VJVA 1UJ6A 4I6WA 4JI5K 1HNWJ 5EY4A 4CLTA 3O44A 2V8GA 3DLEB 2ERRA 2HSTA 1NJXA 4CM2A 2P9GA 2AJ0A 2E2OA 3KD5E 4KQZA 3OYFA 3GE9A 4GKJJ 3A8IA 4JI8F 1HLUA 2DJWA 2V34A 1WDTA 1ZBHA 2V9WA 3CC7N 4GNIA 1VC6A 2ZVIA 2UUTA 4YHHJ 1WC6A 2LECA 4JRPA 1OH5A 3CCEN 4YY3F 4AH9A 3EKSA 1PYSB 2QSWA 1WG5A 3DFEA 1S10A 1RAJA 1XHXA 2HHQA 1FWLA 4CH0S 1XR7A 3GSIA 1H38A 1NK5A 5D4OA 2H54B 2AZ1A 3C15B 1BUXA 3C7NB 4R5PA 1VYAA 4P6QA 1N6QB 3KHYA 2HGNA 4LF1A 4KFBA 2R2UA 1O8BA 2RNEA 1QZ6A 2WUSA 3GIJA 3HTVA 2V2KA 4H5TA 1R31A 1CULB 5KTQA 2DFEA 3VVTA 2KU7A 3Q86A 3HT0A 1WSJA 4CHNA 3NHGA 1N32J 4M3WA 3KWMA 3OFFA 3IWXA 1XMOK 2WONB 3U7JA 3R5GA 4DU1A 1FJCA 4DN0A 2E9TA 4Y1CA 1CQNA 1QHTA 1QAJA 1H7XA 3TW0A 4USHA 5LT5A 4LFAJ 4ZK7M 3HHNB 1FK9B 4FJJA 1RTZA 1Z26A 4A8FA 2HAFA 2FLNA 3MFHA 1N34F 1JCEA 5E3AA 3O6QA 1ZYQA 1U2FA 1FKOB 5G4DA 4ZN3A 1VI7A 2W1BA 3CF5L 5J1PA 4R0JA 3FFIA 1R43A 2RIJA 2POKA 2AEFA 2HQIA 4HUEA 1C1BB 2GO8A 3PIOL 1OKJA 4Y1DA 4HTLA 4PA1A 1M5PC 4Z7YA 3OYLA 4B9QA 4CF2A 2ZGYA 1EKSA 4BRKA 3D6FB 3MAAB 4CJQA 3K2YA 3MM6B 3FQLA 1DHMA 4YR3A 4FOIA 4EGLA 2WAQD 1RACB 1AT1B 2G13A 1WOSA 2CGLA 2VPWB 2D9PA 3NF7A 1E6VB 4LSNB 2BR0A 1QVFR 3SMSA 3NNHA 4JI0F 2ATCB 4B3OA 1RDBA 3ZNUA 4BQLA 4ZIWA 1T95A 1IJFB 2IMOA 3H8YA 1J5OB 2UUAJ 4GMKA 4DEZA 1H0HB 5B8HA 1JLAA 1S6OA 1YJVA 2X6SA 2CPYA 4PKIA 4TY8B 5C42B 4E2FB 4PL7A 4E1MA 2HFOA 1N5VA 2EBEA 3HOSA 2AYEA 5LSOA 5HQLA 3IFEA 2LA6A 4BWJA 1VRUB 2KQ2A 4TSXA 4DTSA 1B7YB 1UVIA 4IBNA 2FHOB 2FHKA 3R3TA 3C19A 3CNQP 3AB2B 4R25A 3BF4A 3RSEB 3DLKB 2P9SA 2DGVA 5CZ2A 2EFOA 3B8AX 2BQUA 4MLEA 4X62J 2UVUA 3FZHA 4KHUA 4IZ9A 4D3GA 4I9QA 3UR0A 4LH5A 4BRHA 4BDYA 2V67A 3OJUA 3AARA 4ANCA 1RAIB 4RLEA 1U26A 2A6OA 1NGHA 4Q2LA 1FHTA 5M2UA 1XNRJ 3TUIC 2OEMA 1X5PA 3I55S 2DFFA 3BBFA 4Z4GA 1HNZJ 3TR8A 4ED8A 1IJEB 2ZBCA 1MWZA 4A2BA 1ZZNA 2DNLA 1JLGB 2MJUA 1OPIA 1WOOA 3TVZA 5AQPA 5H9EJ 2CADA 4EMDA 3L95X 3D0PA 1S1TB 2DHGA 2L9WA 3BSOA 1FI4A 2AT1B 1CJTB 1NJIT 4Y3CA 1BA1A 5D4PA 4CDIA 3MM8B 1K9MT 2HBZB 4IWVA 5F8NA 3W5YA 3E1YA 5TKWA 4YDUA 4OX9J 2VJUA 3M6UA 4MAKA 4A59A 2R7RA 1WC1A 1VRTA 2IAJB 2XSJA 4CI6A 4CF1A 4DTJA 4C23A 2BABA 3EE9A 5IT9U 4DQQA 4ZP8A 2G0IA 1RT5B 3MX2A 3QIPA 1T02A 3ADAC 3LW5C 5JXSA 3V4MA 1JJCB 3R5AA 4I67A 4BWMA 2IVMA 4YOTA 2YKMA 2JX2A 1VS3A 7AT1B 3A1YG 1WLJA 4NLTA 3DM2B 2G1DA 4CI0B 2MQQA 5ADXA 1EAYC 4KJIA 2VQEJ 1T6CA 1ICEB 2ZKUA 1RWUA 1UA1A 5E84A 4H0XB 3VEVA 4FWKA 4L8RB 1FDDA 2KLAA 2E5HA 5RUBA 2QLBB 4U96A 4K8XA 4QBUA 1S59A 4JN4A 2B4JA 4MQ3A 3OR2B 2WW4A 5DLGA 5HBMA 3QJLA 2O8DA 4ZHRA 3WNEA 3BO2A 1QSSA 3E51A 4U8YA 4F4AA 4FN5A 4QWEA 4HACB 1LOUA 1K8AT 1LQ9A 3AOBA 5H9FJ 2MQNA 2W2MP 4DL3A 4DN9A 3OQ2A 1NUEA 3GPAA 2AU0A 2IGIA 4B02A 3G96A 2F40A 2MLYA 4Y2IA 5DK5A 1YZ6A 1B9FA 3OUYB 3K9JA 2H5JB 4DV5F 4C48A 1SPBP 3TJ8A 2QXFA 1TV6B 4RNNA 3SQ1A 2OZMA 1ATRA 3QO9B 2A6MA 1BQMB 2QYCA 2OPPA 1KC8T 1IKVB 1IBMF 4C8KA 2HBYB 4QIFA 4K25A 2FZGB 3PX6A 1HW9A 2IRYA 2WW8A 4QQBA 3VMFB 1D9AA 3K2PA 1NHUA 4DR2F 2ZJQQ 6FDRA 1F3FA 2QIFA 3BGOP 1Z1ZA 2DNZA 2XGQA 3QFPA 3VVUA 2CPZA 5HQMA 2HWIA 3CIMA 5DDOC 2ZUAA 5C2CA 5D4NA 5LOQA 4WQ4A 4OZ0A 3LDQA 2FC8A 4CTAA 3HVWA 4CJRA 3K5PA 4GMJB 1NDPA 5EWGA 2Q3SA 3UWTA 2CPIA 2B4OA 4ZPDA 1JCFA 4C8OA 2HZVA 4E1NA 3K0JA 3GTYX 2IM1A 2VFUA 4X4RA 2IJNA 1X9MA 2UXDK 3GIKA 3AVKA 1H2VZ 4ZPCA 2MKSA 5M2PA 5BPNA 3BYRA 2EVZA 2YKOA 3T69A 4ILJA 3R5BA 4C2MA 2G0CA 4EBEA 2R7WA 1N5TA 3LDPA 3DYAA 2P6TA 5GAEU 4KHSA 1APSA 1IWAA 2ZFHA 4TLRA 1SL2A 1TKXB 4R8UB 2VG7A 3CHWA 1YI2S 4BACA 4TU9A 4FWSA 4LF8K 5C24A 1WKLA 2VBXA 2ZZTA 5E3PA 2Y1IA 2FC9A 1TFYA 3P39A 1LFWA 1CPZA 3OS2A 1Q82O 4QU6A 3CJ7A 3I6PA 4GV3A 2ROEA 3P31A 4IDHA 1WEXA 3N0VA 5F3ZA 3J7AN 3NGKA 3BUZB 3R9LA 4KH0B 1Y4ZB 3AVHA 2K2PA 3VEOA 1TR0A 2ZHOA 1J6ZA 1H72C 1DLOB 4KTZA 4RW9B 1NAQA 2ZZMA 3I96A 4DUTA 4RUAA 5M2RA 1CJVB 1VSDA 2J7WA 4NLCA 2JJ4D 3L7OA 5C25B 1QVGR 4KYZA 3TA1A 4FJ7A 2AV5A 2PMWA 2CAJA 5C2FA 1HKAA 2DYAA 2AMCB 3ILOA 3HBTA 4E0DA 1PO6A 2CZ4A 2FHJD 3LPUA 2LSNA 4KHPJ 2P9LA 4N5SA 4RNFA 4F50A 4TN2A 2GX8A 4CECA 4B3RF 1WAFA 2HVIA 2NSBA 3L3CA 4I69A 1ASUA 5IWAJ 2E1MC 5FPEA 4JEPA 4BVOA 5HQ8A 1BO5O 3MCOA 3OBYA 3M3ZA 4RBTA 4CEEA 3VPZA 4KI6A 4A8SA 3BGLA 5KT3A 3KJVA 3OW2R 2CJQA 4P2FA 1F5AA 2E6LA 2HK3A 2VOOA 4URGA 1VQ9S 2C3UA 2GIRA 1BU6O 4NX9A 3VETA 3W5XA 1SKUB 4FNIA 2QWNA 3DGVA 2RF2B 4EU0A 4YOVA 4ID1A 3G86A 1UVJA 2VQFJ 1RTIA 4FWMA 1SUQA 4UOFA 2VASA 5LL6d 1KVJA 4FNHA 3P5BP 1KQSR 4DCOB 2VPZB 4P52A 1OS5A 4WF9Q 1RT3A 2ALYB 1SQGA 3PW0A 3V81A 4EYIB 4A8YA 3DJCA 3CJ2A 3GJQB 1F2GA 4KGKA 1VQ7N 4A8OA 3J7YU 1G1XA 3IRWP 4NRUA 4ICLA 2RU3A 1TQLA 4YY3J 2WBNA 2YQ3A 4MKAA 1FRMA 3ETOA 1WSIA 1IKWA 4FWRA 3WQUA 4CJ4A 2ZH2A 1XR6A 3J7YP 2I8EA 2A0FB 5DDQC 3K58A 1WHXA 1WF2A 2F8TA 3TA0A 2IPOB 4OJHA 1SAZA 2QWMA 1Q86T 5KFNA 3GE1A 1R0AB 3SNNA 2E1CA 4IXCA 4X66J 3QGHA 2D0CA 1YRXA 1CG2A 4AHRA 3ZSOA 4QJVA 3AA9A 3V4IA 3OYEA 4YB6A 3T1HF 1WBBA 2W6KA 4WQ4C 4L75A 2O8BA 1P1LA 1SS6A 3GSDA 1RP5A 4PQUB 4F3TA 1BWFO 3CO0P 2P9IA 2VWKA 2CPHA 1YJWN 3AHPA 3GV8B 3T9ZA 3IMXA 2DRBA 3N9UC 3HHEA 1WOPA 1EARA 1WHWA 2CYYA 2ZITA 1PCAA 4KHWA 5KRSA 5K20B 2OKQA 3I9ZA 3VZHA 3C14A 1TUVA 3KTQA 5KQDA 2H48B 2HHWA 4OYBA 2QT7A 2UVWA 3MM9A 3GIIA 1ZBIA 3DDNA 4AUKA 2RSQA 3G0ZA 1VHIA 4BRFA 2W6LA 1SJQA 4K43A 4H5NA 1MWYA 2CNNB 1HNVA 4QPTA 3A5NC 3ATUA 3J81U 1LOTB 1HMVB 3I33A 3PYDA 2CQCA 1P8GA 1F2HA 3PKYA 4EIAA 4HH0A 1RJJA 4RWWA 2HRYA 2DR7A 5GAHP 4WQ5A 4YOWA 4FK0A 2YTCA 3ZTSA 2EBGA 4BR5A 3AVMA 3UDCA 1XWLA 3TUJC 5JVGL 3CC7S 4DV1J 4J7CA 1F3VA 1GFWB 3D45A 1IBKJ 3CJ1A 4NO7A 5LMNJ 2F96A 1PKUA 3AOAA 3MN5A 1ELOA 4G1QA 1TVRA 3GFXA 4NMXA 5JJBA 1S76D 5CZ1A 1FNMA 3OLBA 2PA8D 1FE0A 3VAKA 3W3SA 1S0OA 1F60B 3O3GA 5F8MA 1XN9A 1TTHB 4OX9F 4QIWD 1SJFA 2MB0B 1HKGA 3S8SA 2ZH6A 1TUWA 3SEOA 1U1PA 1NJWA 3HP6A 3BO4A 1JNZB 1D8YA 2DISA 3BQ0A 2FYXA 2AYGA 4ED5A 2KDOA 2P5OA 1N48A 3SPZA 2YNGB 2N4DA 4PZVA 4RNMA 1C0UA 1MSWD 2G4BA 2JWKA 1HWJA 5IT9Y 5DM6Q 3BN7A 4MFBA 1X4FA 2C2MB 2QJ3A 4WYWA 2QTDA 2DNYA 2J0QD 1NPRA 4BRGA 1H7WA 4PABA 4KHYA 4M3YA 4O4RA 5G0RA 4I68A 2HNZA 3PW4A 2HF3A 5GMKa 5A6WA 3NS6A 3GQCA 2ZJRQ 2NNWA 3UKUB 2C22A 4DSKA 3NOGA 1D9FA 4IG0A 2FJWA 3KLHB 1JLBA 2V5HG 1REVB 2YV0X 1WJ9A 3MEEA 1X5TA 3IRXA 1FX4A 4OHZA 3G25A 1OQ3A 1NBEB 2L9DA 4CH7A 1N54B 2DO4A 2W9BA 2HGLA 2BQ3A 2Z1JA 1CC8A 2BW7A 1ZA2B 3AFGA 3UIQA 1U25A 2V63A 2EKYA 2JLGA 3WZ0A 4Y65A 4B8CA 4ERDA 5LL6Z 4N76A 1S9GA 1F21A 1RHQB 4I9LA 2B43A 1NH7A 3CD0A 3TP2A 1TL7A 3H59A 4FS1A 1WI6A 1GMWD 4GC6A 1QSYA 4DTNA 4O0JA 2P9UA 1HNZK 2XZTB 1X4AA 3T5LA 1CZBA 3CCQN 3DDKA 1HBUA 3UNGC 3BKTA 2AYMA 2RE2A 4DR4K 4ZVUB 4UOHA 4DR7F 2FBTA 5K5MA 4RW7B 2OPRB 4LF9J 3S01A 1TELA 2P9NA 1RCXB 1NJZA 2EG2A 1Y3JA 2VDIA 1WSFA 2H65B 4LSZB 3EVWA 4DR2J 1S9FA 1RT4B 5KFBA 1YDLA 3J80O 3HPGA 2RH3A 4OX9K 1YGYA 4FS2A 3CD5A 1R8HA 4DQ8A 2CG8A 3A0IX 3EVOA 1E6VA 3UN5A 1U1MA 1BWEA 4M3UA 1Y10A 4H54A 3GBTA 3N5BA 3MR2A 2HHSA 3W61A 1VC5A 4CLZA 3AXKA 1Y11A 3QEIA 2V8PA 4LRBA 2YKQA 1WAJA 3HM8A 2BXJA 5KFOA 1JLCB 4FVUA 5AZIB 1V5IB 1S5JA 4KHQA 2D3ZA 4TY8A 4ZLNA 5KG5A 4IFVA 4X64F 5A0YA 4UQTA 3A4TA 5KFLA 4F4WA 3ULEA 2BYCA 2QXLA 2APOA 1TK5A 2W8KA 3M30B 3LM9A 3ZYYX 2GQ2A 4B3SK 4LF5J 4DUYK 1RDRA 2Q79A 4PKDB 3NWGA 5AQQA 2DBBA 3D4JA 1YVNA 5F9LA 4HVJA 1XBWA 2BJ1A 2MQPA 5KFMA 3NAHA 4AHSA 3SJJA 5M1QA 3R5CA 3CCRS 4QYRA 3G10A 4FK4A 2XEXA 3TTDA 2KT2A 2A1SA 3MK6A 3IS9B 2Y1LB 4M3ZA 1IBMJ 3PHTA 4KAIA 1UFLA 1MA9B 3NS7B 4LQ9A 4NA1A 4M3TA 4NXMF 1C0GA 2H4WB 3A12A 3G87A 2PYLA 4TVAB 1UAXA 2FJDB 3MECB 2MZRA 3R7BB 1S6QB 5H9FK 2MHNA 4LF4J 2HMIB 1WN7A 4FJMA 4IH5A 4OFZA 4AL5A 4H0TB 4CHQA 4TY9A 4KGMA 2WTFA 3U9DA 4L3KA 1SXLA 2A1BA 4WFZA 3UKRB 1OWXA 4FPRA 1LWXA 3LDLA 3M2UB 4H4MB 4MK9A 1FXDA 2RS8A 2RB7A 1LAWA 2I7PA 3JB9k 2PMZD 4ZOSA 4M5DA 3KLIB 2FVRA 4M95A 3CDWA 1KVCA 2WC9A 3D1OA 4BY9C 3K5OA 2MEWA 2MZ1A 2RN2A 3FZ2A 3IP0A 2R7OA 2E5LJ 1DTTB 2BANB 4BGBA 1Y5IB 3UVJA 3MR6A 1AFJA 4BR2A 2Z8QA 5D78A 4ZMMA 3BPDA 3OVNA 2M3DA 1YBTA 2HKEA 3KK1A 3RTVA 1HNIA 1QY7A 3N28A 3KOAA 1ULRA 3PIPQ 1NH8A 3WNGA 4B1XB 2HFZA 2AGPA 4A5BA 4DV5J 4I1TA 4OZ3A 5AQRA 1XNQF 2BOPA 2M70A 3OVAA 4ECRA 1LWCA 4U7UK 3PRDA 1WNSA 1U0HB 3R2CJ 4TKTA 4H0OA 3PYGA 5J2PA 2FJEB 1PILA 4X2BA 2JLEA 2GUIA 4XK8C 1RU1A 2QO3A 3EJMA 1K0TA 3O80A 3OL6A 3N6MA 1ITPA 3FEXB 3NXZA 3QEVA 3IGVA 2J7KA 2Y8WA 2CXEA 1JLEA 1WHVA 1RK8A 2K1RA 4OHYA 1VDHA 4W4MA 3K57A 4B9LA 4AF1A 5A2QO 4FBUA 3FMBA 3IM9A 4W90B 3I8BA 4PXEA 1N34K 3OYJA 5KT4A 4B9MA 4X65F 2KVIA 2JNJA 4DR3K 1YXQA 5FPMA 2OH2A 5LMUJ 3KWIA 4RW4B 3ID6A 1J9AA 3ZX0A 3SMPA 1W97L 4JKGB 1YHQN 5LXYA 1O6XA 4GKJF 4PQAA 4HACA 5FD1A 2IC3B 1RDUA 3MAHA 4K8ZA 3DGPA 5ETKA 2YY3A 2R7QA 4FLWA 1N88A 4JHDB 3CC2S 1XNRF 3JAMU 4RW6A 4DR5F 4XAKA 1G7CB 4DR6J 3SQGB 3J7AP 1WWHA 4DX8H 3RAMA 2B51A 1LWEB 4MK8A 3LH2S 5DRKA 3JSMA 1NRKA 4M94A 4CFDA 5GAEI 5K14B 3AVAA 1UJ5A 4LH4A 4CLUA 3WC2A 1FD8A 3AA2A 4JAXA 4FZYA 2R4FA 3AO1A 3OYIA 4XDDA 3DRRB 3WC0A 4NYPA 3UI3A 1HQEA 4TQRA 3FCWA 1NK4A 3GP9A 3PEHA 3C6UB 1EQ0A 2BH1A 3RZAA 4U9RA 3LWLA 4OJRA 3AD8C 5KFZA 3GIMA 3UCGA 3H25A 3DMJA 3CULA 3THYB 3RR8A 4WQ5C 4O3RA 2ZVSA 5TKYA 3IAS9 2YWWA 3QT8A 4FCYA 5D3GA 4S0MA 1XEZA 5A6PA 1Y97A 3LP0A 3B8HA 2CRLA 3IN5A 3ATVA 3DRSB 4M5LA 2E2PA 4JI3F 3MMAA 2IVNA 3MCSA 2V8DA 2QSFA 3ENOA 3Q8YA 1KC8O 4JI3K 4Y28C 4F4YA 3VGTA 3CDBA 4G6VB 4Y2KA 3NCRA 2HHHJ 4TXSA 2NREA 1NCLA 3VESA 3QNWB 3BREA 3B6BA 5ETMA 4ZLPA 3WIVA 4PG8A 2WB4A 4XH1A 3C95A 3NAIA 3J80Y 1L3KA 5DQIA 3CJ5A 1SC1B 3K0SA 2HNYB 2JFKA 3CMES 1RFQA 5AQZA 3CE8A 5J2MB 4OLOA 4QW8A 4JP8A 2ZE2A 3UE5A 3U4LA 3L0QA 4A46A 2XZWA 4HI1A 5HRNA 4I2PB 3D2FB 1BI4B 4JI4F 2AJ4A 1NBWA 2HBQB 3BP8A 4M5GA 4QS7A 3DLJA 4OYOA 4XH4A 5CCLA 2R8GA 2E5IA 1HBNB 2LXFA 3UCUP 5U47A 5AFUA 2W01A 4DFKA 1GEHA 4F3MA 2XMAA 1ZC6A 2DHXA 4IH6A 1GXLA 1RDCA 5HMZA 4C11A 3G4SS 1WSHA 2P2CB 4URSA 2BACA 4RWXA 3NNAA 4I6AA 4LF7J 1KXPA 4NLOA 1U47A 3R6LB 5CHIA 1G3OA 3QZ7A 3BDPA 1ZBFA 1Q5VA 3M32A 2A3ZA 3I56N 3EWGA 3FEZA 4UY85 3AVBA 4C4WA 4DTMA 1URRA 3G6VA 2ZHBA 4X65J 3TX8A 2BTFA 3ALYA 4ANDA 1LK5A 3QT6A 5A2QY 4JV1A 4ZP7A 3VQ5A 4U7CA 1S9EA 4IH7A 3KMSA 3HHDA 3MTJA 1FX2A 4AILC 3KLGA 2A18A 4CJSA 3OBIA 5AQMA 3QEXA 2YVSA 3R6MA 4FL9A 1FXLA 2YKNA 4WFAQ 2DKOB 4JI4J 1VQ8S 1WUAA 4A8KA 1U2RA 5A8KB 5HLFA 2UXCK 1GMVA 3CJ4A 1KHVA 3QNOA 1VQ4N 1WF1A 2NZCA 3L2VA 4DSFA 1WD6A 1JCGA 4M41A 1CXUA 5JLHA 4W98A 4NI2A 3GOIA 3JAMY 5GMDA 3DLBA 3PW2A 2Q1NA 2LU1A 4CHZA 4JV5K 1OIAA 3A3PB 2N7CA 1W2BR 4KTQA 2LQJA 3AD9C 4CJ7A 2A2DA 4QZVB 4M3XA 3IAM9 4LF6K 3L7PA 3Q8UA 4LBHA 4UTGA 4LFBF 3AY0A 4ILRA 3O4WA 1FJEB 2CJ9A 2RJZA 4TNOA 4RNHA 1ZS6A 3NWRA 2CQHA 1WTFA 1CZ9A 1LV5A 3LOUA 3TAGA 4B3TJ 2O5DA 1X5SA 2WSEC 1RAFB 4NLXA 3WXMB 5KG4A 1YKWA 2CUYA 2LU2A 4NYZA 3HULA 3CCJN 3PG9A 1JXEA 2BW2A 4ZVRB 2D5RA 1Q53A 2CPDA 4J9NA 2IYGA 2DCLA 4I6MA 4E7LA 3S3MA 3AVFA 5AXKA 1PIEA 4KO0A 4PY5A 1S57A 2B3TB 4DSIA 2NQPA 1FKPA 1PAEX 3I31A 4EHTA 1BQXA 1HQUA 4I2QA 4FSVA 2MSTA 4M5NA 1AW0A 3TEHB 3DXMA 4BE0A 5EWEA 4RNOA 5GINA 1KLMB 4JI2K 1R0AA 3NF6A 3QEPA 3C6TA 2ZH8A 1NO8A 4IYQA 4K4TA 1NLVA 1E6YB 4C0HA 5J1EB 1S1TA 4PUOA 1SCJB 2XYGB 2BKPA 3JQJA 2QMUB 2B5JB 4B1VA 4LY7A 3ETMA 1WKJA 3K89A 1X4CA 1JJHA 2B4UA 1J5OA 2IA0A 3RG6A 4JI7F 3HMJG 3TSPA 2OTJN 3R3LA 3W7BA 1RYRA 5AQHA 4DZ6A 4J9QA 4LRFA 1YIJS 3RMAA 1EWRA 2FIUA 4CJFA 1Z2LA 5I3QA 2UVVA 2E1YA 2GTDA 3A5MC 3WEEB 3PYEA 2GWKA 1M5SA 4DUZJ 3KMQA 3MWPA 4FLXA 1QUVA 1Q16B 2IHR1 3E8OA 4ED2A 2UXBF 1HLWA 1VQ9N 1F9EB 4OPAA 3H45C 3M1VB 3NH2A 4WFBQ 3RRKA 4UUWA 2KXFA 3VTHA 2GV9A 3NL0A 4M5JA 3G82A 3LQVA 1CJUA 1REGX 4JI5J 1S1XB 1HYSB 4X4OA 1VK8A 2C2KB 1MNEA 2VDHA 4RZRA 1V4SA 4KHNA 3L6QA 2P9PA 3WX4A 4N41A 2DHHA 5AQXA 1TK0A 1XNQK 3GYXB 4Z4IA 3QAEA 1YUWA 1AZSB 3DOMA 1SJ4P 4MMOA 3OYNA 1RBAA 2GHVC 1WF0A 3Q83A 2WCXA 4ZVQB 2B56A 3CJBA 2XMTA 4PYDA 5EVZA 1VLYA 4BDPA 2OPSB 2F4VK 5IQQA 1RBSA 3PJ9A 1XMQK 4LFBJ 2XQCA 4DL7A 3HYFA 2YJFA 4UW2A 2ZQBA 5KFQA 3LPTA 2PA3A 3OSNA 1YK9A 5JVGQ 1S4EA 3LDSA 5HK4A 5B08A 4ZVFA 4DX6A 2C2RA 4G1QB 4O3OA 2MQOA 2IDLA 1Q79A 2VKRA 4N77A 4JI0K 5DLFA 4CZKA 3UFCX 3KLEA 3AO3A 2G9OA 5D0EA 2O1PA 4OZNA 4ELVA 4OKEA 3IAYA 2UXBK 1KQSM 1VQLS 1OYDA 5B0EA 2DGTA 2J5AA 2R9LA 1U6FA 5LY3A 1N5YA 1Q86O 2C2OB 2WOMA 3A3NB 4CHYA 2MKCA 4NLGA 3MPDA 1RDWX 3ZZYA 1N32K 1HPZB 3MMCA 1C0UB 4J9RA 2NR0A 1VGYA 3R8YA 5JLFA 4UOCA 4CRJA 2J0XA 3WQTA 3SFGA 1P27B 3VQSA 2F9WA 1U04A 3QETA 4KI4A 4F8RA 3HK2A 2ZWHA 4RG8A 1C4AA 4DR7J 3SUNA 1RAEB 1SKRA 5AE3A 4Z4EA 3DAWA 4DFPA 5C15A 1RLDA 2V7ZA 5A8WB 1VFJA 5I42B 1RWWB 3AO5A 4LF6F 3ZETA 3ILIA 1A5VA 1ZXOA 1HWUA 3UD5A 4X4TA 2IRXA 1RQ0A 2CQIA 2IY5B 3MXHP 1NSKL 1ZAWA 3L4BC 2MSSA 2KHCA 3JTNA 3H3OB 3I32A 1N33F 3FSIA 3QFHA 3P6YC 4DKWA 2DIUA 3UNYA 2QTWA 2GVDA 3KLFB 5F8HA 3TI0A 2FDNA 3QERA 1WOQA 2MQMA 3W2VB 4MJKA 1RT1A 1QE1B 2R7XA 1HI0P 2E20A 2O66A 4JKFA 1EXQA 3A8EA 3CJ9A 2XCAA 3Q22A 3H2LA 3H1QA 2Z4PA 2AWZA 4E1JA 3ZZZA 5E2QA 2XS5A 4OX7A 3QINA 3VGUA 4OI6A 2QI2A 4CJKA 3TWHA 5LMNF 1G2EA 5B0BA 4CO2A 3I0SA 4NA3A 4CGHA 5L39A 2IM0A 1S48A 4WK1A 2GQQA 3I0RB 2ZHAA 5L9NA 3AY9A 3TVKA 4BC5A 4FLVA 1VQON 3BGRB 1NM2A 2A40A 2B6AA 2P9NB 4NXNF 3AA5X 1SC4B 3MM7B 2JDJA 1CSJA 3V1RA 1YJUA 1U7LA 4DL0C 3SCXA 3FR0A 3VZIA 3FQKA 4FWOA 2MDAA 4K50A 3HZGA 3O1BA 4OZ1A 4JNEA 1TYQA 4IO9Q 1WBDA 3OA9A 2ZDPA 3SQOP 4FJKA 1ILYA 4MTPA 1QAIA 4OQJA 2BMBA 4C0BA 1R3NA 3NMAA 2QWLA 3LZJA 5IV4A 1O5JA 2ZOGA 3OTDA 4JK9A 1RAAB 3PSFA 3VOVA 2L9NA 1YI2N 3CXCR 3MAAA 2OSQA 3M8QB 4DPWA 3EZ5A 3ZEUB 1S4FA 4LIWA 1UWAA 4J90A 4DU7A 2LEPA 2DR9A 3H0PA 1D3WA 5KFRA 3MUVP 2PE8A 1IR0A 4DV6K 3KJNB 4DTOA 3MZIA 3P1GA 1S97A 3MAQA 1T3NA 5CYJA 1VQ6S 2B7BB 1RKIA 1IKYB 4ID5A 3TWZA 4ETXA 4B3OB 1NLKL 3MPVA 2VC0A 3IM8A 3TUPA 3CF5Q 3A8KA 2HVEA 3KJVB 3DXBA 3DXKB 4QWCA 3M9MB 4AQYJ 3C94A 3MN7A 3VEXA 5ADXH 2GGPA 3IS9A 3RW7A 3T6JA 4BC3A 3D1HA 4JKBA 1DY3A 4CESA 3AJ1A 5LJWA 3ZT2A 2ITGA 3RRGA 1K1QA 1XERA 1KWMA 2IVYA 3OYCA 2DEIA 3PNIA 1VLOA 5BYQA 2JOQA 3VAHA 3ONQA 1RGVA 4JBCA 4F3OA 2DRDA 4RU2A 3BZKA 5C24B 2XYPB 3RSEA 4J9UE 4IQMA 1WELA 3MX5A 3RBEA 5ETRA 3C6HA 2ZJQL 3M8PB 1M5HA 3ENVA 3UPFA 3OR1B 3UE2A 2XLIA 1JXBA 2YPZA 1DTQB 3KWGA 1CXQA 4CE9A 4XO0A 4F67A 3T19A 5JMNA 3ZCMA 3MGJA 1RT7B 3EXYA 2DK2A 3C66A 2CQDA 3ZC4A 3BH7B 4HEA9 1U09A 2BM1A 4J9OA 4IDKB 4OX8A 4NPOA 1TZ0A 1Q82T 2KM8C 4ES3A 3T3FA 2ZD1B 5D8HB 5E5NA 3V6HA 1G6BA 3HHLC 4OYZA 4L76A 1UCNA 1P90A 2LDIA 3M8RA 4RW8A 1ZM9A 1R6YA 3L4QA 1YJNS 1FWKA 4BRAA 1ROFA 3QSIA 4RUHA 1D5AA 2RD5C 5ETOA 3JYTA 2DR8A 1GTHA 2FQQB 2HWTA 2MZSA 2VG6B 1B64A 2QK9A 1RHRB 4HDHA 3H7HB 3GWCA 4PPZA 3W63A 1X5OA 4FM2A 2Z2MA 3HM9A 1SV5A 3BF1A 4QAGA 2HHHK 1VCTA 2YX1A 3E01B 3R5DA 4QWDA 4F36A 5AQSA 1O0PA 4PG7A 5EX0A 5A76A 2N4CA 4BRNA 1BISA 2P5VA 3EZWA 4HHUA 1W2BM 2MYFA 1FRKA 2MKYA 1WUUA 1Y64A 1KFSA 3POTA 3NCIA 3QYYA 4ILLA 3ZNJ1 2IAJA 2XSJB 1MU2A 2W40A 1TUYA 3Q24A 4DMNA 4NLWA 3NCQA 4R5PB 3RB0A 2ZWOA 2JC1A 4DQPA 3DU6A 1U1KA 1WSVA 2NXEA 1NGIA 3DN9A 1ATSA 5HANA 1XIQA 5JMVA 1Z2ZA 1U2VB 3UDLA 4JK8A 4LC9B 2DXFA 3QWUA 4LBIA 3EVMA 1YJWS 4OJGA 1T05B 1MMDA 4LF9F 2KT5A 5HMYA 2H51B 2VB6A 2YI1A 3BQ2A 2NRZA 4BG8A 4IRCA 2Y0BB 1XQSC 4YMEA 4ZPWR 1HWLA 2MLZA 4C98A 4OPJA 3CJSA 1KOOA 1RNHA 2HS4A 5EDWA 5KT5A 3THPA 3W62A 4DX7A 3DRYA 3O8MA 1CLQA 3J7A1 4M8LA 2QLWA 5I3UA 2HEKA 2WHOA 3SSSA 2ZM6K 3WHIA 3DDIA 5KT6A 2ZM6F 4QWBA 4B3RK 4ZVPB 1GOCA 1NGEA 2DHAA 1PBUA 1K47A 2DNPA 2CNKB 3KG1A 2M9KA 2G2YA 2MGZA 2XS7A 3BS9A 4ZDNA 1Y7PA 3D2WA 1TL3A 3ELHA 1BDGA 3WNHA 4IQXA 3VQQA 2WVBA 2HZCA 1RA6A 3AGRA 2H5EA 3DOLB 2OMOA 1K8KA 3BKUA 3QBWA 4ZP6A 1FRLA 3H42A 3TTCA 3A8JA 3IBCB 2CG4A 1ZAXA 5KFFA 3FSYA 3KNGA 3DI6A 3O5TB 2P8IA 3QO9A 2B9EA 1CVJA 1CS4A 4FWQA 2YHWA 3Q8QB 4DZDA 1SH0A 2BE7D 2F63A 5KI6A 4KHPK 2YNFA 1W26A 4GKKF 3HHLD 1OVQA 3NFAA 2BJ3A 3MWBA 3NBPA 1NGBA 4LRCA 3BM7A 3RB4A 4EK2A 3FK4A 1YRTA 4LD0A 4DCJB 2ZOFA 4TQSA 2QWRA 1HNXF 2UV8A 3Q8RB 3PACA 4W5RA 3DRXA 1NEEA 3I4HX 5L46A 2RE1A 2PBDA 4HYKA 3F5TA 1DFDA 1HUXA 4IO8A 3GG4A 1BHNA 3PHEA 1RTHA 3ZTRA 3BBBA 2DR5A 1ZBTA 2MKKA 1E4GT 3MMJA 3UN3A 5IFMA 2G2ZA 1SJRA 3DC2A 2DTJA 3OHBA 3PJXA 5KG0A 2ZBIA 1RGIA 2X78A 1NGDA 1WACA 1S49A 2ZBRA 5AZJB 1QQMA 2OP5A 2W4DA 3ENBA 1RA7A 4U95A 3HJFA 3QZ8A 5M1FA 2QLJB 2XSFA 2CQ2A 5F0WA 3G9CA 4O4GA 3W1YC 4JI7J 2VV5A 4C11B 5J2QA 2GUPA 1Q81O 4GV6A 3Q89A 5KFUA 3HVRA 3D2EA 4JKCA 4URQU 5KFJA 5AQTA 3UQSA 1A0OB 4WZQA 5IT4A 1HBOA 2XY6A 4BREA 2ZBPA 2VGNA 3FFKB 5GAGU 1EQMA 3H1VX 4NXNK 1V3RA 1C0TB 1DQ8A 2CPJA 1Q0NA 3IKMA 3QFUA 5FPNA 3K59A 1TL1B 4NZ0A 2CJYB 2L08A 1RTDB 1UW4A 3KHRA 2AD9A 1HHTP 2YHXA 4A8QA 4ZPTR 2GZOA 3VQBA 4DS5A 3T1YK 3C15A 3PFEA 2HG4A 4PG4A 5CD4A 5E41A 2O01C 3J81O 4G3IA 4PPDA 3RAQA 2BM0A 4A61A 3OYKA 4M5HA 2GV1A 2RKIB 1QTNB 3FEYB 1HI1A 4Z2XA 3T5KA 2CQPA 4AFFA 1UOCA 4J2AA 5AQWA 4QS8A 3C0BA 2HNZB 4F7VA 2XNRA 2AJFE 4GVEA 3GMGA 3RU0A 4F2SA 4C8ZA 3ZZOA 2UU9K 1VQ5N 4KPYA 2UXDJ 3JSBA 1BIZA 3KLHA 2ZWPA 2Z58B 3MMBB 1TL5A 2KFZA 3CCMN 4WIIA 1S1UB 5H1SV 3MURP 4F9OA 4BC4A 3V9UA 3CQYA 1HNZF 2BRKA 2OYQA 1SZ2A 2W9BB 1NU4A 3J7Z5 3OLAA 3SI6A 2FVPA 1RWOB 1VQKS 3ZTOA 2DGOA 3VGMA 2W9CA 4IFYA 1GLAG 4CT8A 1OH8A 1RAGB 1NDKA 1S6PA 4DOZA 2YQ1A 4DR5K 4HWIA 2P9KB 4DCHA 1FJGF 1VIOA 3M2VA 5CD4H 4QU7A 1C4CA 2DGXA 4Y00A 4LR7A 2UUBK 2BJDA 1I3OB 6FD1A 4KH6A 4GO7X 2YH1A 4Y2MA 4ES1A 3ZT1A 3NRBA 1RT3B 3AA3A 4GV9A 3SK3A 2OPQB 1S0VA 1YX2A 4DV3J 4DV7K 3AA8A 1S1WB 4HCCA 4CZIA 3TU5A 3M2UA 3SBGA 3QGGA 1YZ7A 3ID8A 2ZJRL 2Y0SD 1S1VB 4ZCIA 1JJ4A 4JI6K 2KTQA 4P75A 3VAGA 5AQLA 1B70B 3M1FA 1OPZA 3D0HE 2HHVA 4F4XA 3BSCA 2DEJA 2CZ9A 3NAEA 5HAOA 1DGKN 1BOTO 3NKYA 3QQCD 4PG5A 3EYZA 2MQ8A 1TL4A 2X3DA 2ZJPQ 4FJGA 3DLGB 4DSLA 3TJAA 3ZZTA 1Z4UA 2YNIA 2F3JA 2YWFA 4YB7A 3D3CJ 5AZIA 1FRJA 1YWXA 2KHOA 3EDRB 2GHPA 3R1HA 2R8HA 4NOHA 1T7PA 3G6YA 3QMLA 4O8KA 2Z2LA 2G8UA 1HI8A 3QMQA 4R0EA 4MIBA 4KPCA 1ZBLA 1S1XA 1LXJA 2NRWA 4WFBL 2ZJPL 4K5RA 3TRGA 1VQPS 4P2XA 1S72S 2I38A 4YDXA 4V19J 4YHHK 4CH1A 4H03B 1WKKA 3TVYA 2L41A 4A48A 2RDJA 2HQ3A 3LGMA 3EZOA 2V51B 4GW6A 3L7UA 3T1HK 5HROB 2D74B 2ZH4A 4JKDA 2DY1A 5E33A 2VFSA 2VA3A 2RHQB 3MM9B 2ASPA 2ZC4A 4WCEQ 1T6DA 4DHYA 1LK7A 1HNWK 4CO3A 4AHCA 1N36F 3VQ6A 1BGXT 1JLQA 2QKKA 4C9DA 3NCPA 3E9PA 2ZGZA 4QYZK 2DGSA 2IC3A 3OTOJ 4IR9A 4FXVA 2C1EB 3MD1A 3VQEA 3ULDA 5EX3A 5BR8J 3BSNA 1QVFM 3G8TA 4ISGA 1JL1A 1GLLO 2HVHA 2YNHB 1BLUA 1UAWA 2C2ZB 2PFDA 2W2OP 1YBUA 2DB1A 2D3UA 5ETVA 3BEGB 3DRPB 2HFNA 5AXNA 1QVGM 2LQ5A 1U1LA 5CYMA 4ZHRB 2KKZA 1EZZB 1HBMB 2DTUA 1IBLJ 3H4BA 1V5VA 2O8CB 3HI9A 4PRFA 3TABA 1SJ1A 4HTJA 2ZBQA 4B3SF 1WB9A 2HBKA 2CQ0A 1X3MA 4IRDA 4FYXB 4HL9A 4HHTA 2R7YA 4BC7A 4LT6A 4DSEA 2ASDA 2EWHA 4KKOB 2JFDA 3DCAA 5ETTA 4Y34A 4NLQA 1Y00A 3O9QA 2GMJA 2R7VA 4K4XA 3TQ1A 4NLBA 2GBZA 4FYDA 3I87A 3MPWA 1RWXB 5J2PB 1KAZA 5HRRA 2PD1A 2OFGX 1G99A 2R8KA 1J53A 4LF9K 4HUGA 2W4PA 4CFAA 4TLQA 1HRHA 3PO5A 5IXUA 4YN3B 1XMOF 4E7IA 4WXWA 4CBWA 4N7TA 1RT1B 2IM2A 3FDSA 2X1BA 4H0PA 1DQ9A 5J2MA 2VFTA 3HFVA 2ZE2B 2ROGA 1KSPA 1LW0B 1YQHA 2VF3A 2OELA 3QB0A 3BY5A 4WZMA 3ZT3A 2VBZA 1QHAA 4P71A 2F8EX 4HDGA 1TAQA 2GAGC 3MEKA 2I5JA 4J9KA 3NGTA 3VQ8A 1HX1A 2CDRB 4CGFA 2XI3A 4DFJA 2VICA 1SL1A 5BJRA 3P3DA 1X9JA 1OQ6A 1FK9A 3V5RA 4O44B 3CIPA 2F9DA 2YJEA 2P6SA 2GVZA 2WBRA 4HLBA 2KXHA 3CEDA 5HMWA 4PKHA 2RRNA 3SQGA 4LFCJ 3JQMA 4NLUA 1EP4B 2EFGA 3ET6B 3GLJA 4IG3A 5ETPA 1IM6A 3R2DJ 2EK6A 3QDKA 1WC0A 3NVKA 3AVIA 2VIHA 5HI7A 2QWOA 2PC6A 2AJQA 3MEGA 4DG1B 1UETA 1PYTA 4CZMA 3CDUA 1H2UX 2BUNA 3IBWA 5AQKA 2FJXA 4DR4F 2D7SA 1DJ0A 3N6LA 3J7ZT 1RT2A 2XBPA 1FTCA 1ZTTA 2XI2A 3M5RA 4RW9A 2V6AA 1NK9A 4J2BA 1GOBA 1HNXJ 1EHWA 4YB5A 2HSEB 1IKVA 3ZXWA 3DYAB 5CE3A 4B3MJ 4IOAL 1KP6A 1VRTB 2Q43A 2W4CA 3ISND 2M52A 1FFGB 3CMEN 5KG2A 5T41A 1YVUA 4P9SA 1K73O 3Q8PB 4QW9A 3IGNA 3CI5A 4F02A 3H6EA 2UVRA 3FKBA 5DG9A 2AHOB 7FDRA 5DDRC 3TAEA 1RISA 2UUWA 1JLFA 1V6HA 1BUPA 2IIHA 2KW4A 3P38A 2RRBA 4FYVB 1GLFO 1N0VC 1VQ6N 2IS3A 2DR6A 1GLDG 1ZPWX 2KVQE 4M5IA 1BIUA 4CZCA 4N8OA 1LKZA 3KK2A 2LXIA 1AFIA 3QT7A 3K7RA 2XC9A 1WG4A 5A8RA 1K44A 5F2RA 5FPDA 1RT6B 3MDFA 3F2KA 3DLEA 1DZ5A 5AXLA 2O4IA 3GIRA 4DV5K 1NM1A 4J91A 4IRKA 4HUFA 4NL5A 1W2IA 4IOAQ 2HHTA 2I7NA 3THWB 1NK8A 2NRVA 2CWXA 4A62A 4WJBA 5DG7A 4XPEA 3PY8A 3F9MA 4ILGB 2DNKA 4Q45A 2V2ZA 3GR0A 3RBDA 3SSRA 1UZDA 5GAHI 2W2QP 4LBPA 2F8HA 1PAUB 2F65A 4CJ3A 1YT3A 3OYDA 2GWJA 2HS3A 3H46O 1Q8IA 2EC2A 3EGVA 4RX6A 3OUYA 3HVTA 2KKHA 2FLPA 4CNYA 3RMCA 5AXMA 2MY7A 2N3OA 4P73A 1NK0A 2YHBA 4KRWA 5F9NA 5HL7L 3EGZA 2HIYA 1VHFA 1N4LA 1U02A 4M63C 2R2TA 3M6WA 4BHQA 3C6AA 3J81Y 1SUQB 3VF0B 4Z4CA 1RTJA 3AV9A 4NXMJ 3DLRA 3ENWA 4CIOA 1YG0A 3DLKA 2XHWA 3OW2M 1T94A 2MZTA 1RILA 2YH0A 1RAOA 4B9NA 1TMJA 5CH7B 1K6YA 4ECZA 4USMA 4JI1K 1NB7A 5CYQB 1XMBA 1VSHA 1YITN 4QS9A 1RWMB 2YWGA 3NGYA 3CCWA 2G8HA 3L3VA 3PZPA 4K7QA 5F8LA