1VSHA

Asv integrase core domain with zn(ii) cofactors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endonuclease
molecule keywords INTEGRASE
total genus 48
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vshA00
5CZ1A 1WSIA 2GV9A 2O4GA 4CJ5A 2PY5A 1VRUA 4DU1A 3OYMA 2BE2A 3VQCA 3HJFA 4M3UA 2D0CA 3D45A 4YFUA 4CEFA 4B9LA 2QK9A 4KO0A 2X78A 4W5OA 4FK4A 5J1EA 3L2VA 1KVCA 4I2QA 4FK2A 1JLBA 1NKEA 4RW8A 1VSMA 3O4NA 3CFRA 1X9WA 2X6NA 4Z0UA 3LZIA 1TK5A 4RW6A 2EX3A 2P5GA 2HHQA 3KK3A 3HM9A 4FLVA 1QSYA 4DTSA 1RBTA 1U47A 3VQDA 4CEDA 4CF0A 4OKKA 3LALA 4LD0A 3SV3A 1B92A 4Y1DA 3OJUA 1WAJA 4UQGA 3QINA 5CYMA 3AA4A 1ZYQA 3RRGA 3QEXA 3V9XA 4DQQA 3V1QA 4HTUA 3HO1A 4DS5A 1QE1A 1HQEA 1QS4A 3DI6A 5KI6A 3VQ4A 4EP4A 4HUEA 2PZSA 4FJHA 4TSXA 4E7IA 4DFMA 1BIZA 2OZMA 4KB1A 3L3VA 3ZSQA 4CJUA 3QERA 1UA1A 2ETJA 3CYMA 3KJVA 1SKWA 4FJ7A 1RDDA 3VN5A 3K5LA 3D0PA 3V9ZA 2HVIA 1TAUA 3QIPA 3TAGA 4KKOA 1QSLA 1QQCA 3NCIA 3RMBA 1MU2A 1NJWA 3PX6A 4H8KA 3LWMA 4FLXA 4ELVA 3HP9A 1RBUA 4E89A 4BE1A 1NK8A 1GOBA 1LW0A 4CHQA 2OA8A 1LAVA 3NH0A 4CJKA 2VG7A 3NGYA 1BHLA 1FKPA 3L2RA 1VSEA 4FZXC 4CGDA 2DY4A 2VWJA 1CXQA 3DRRA 4CHNA 1HNVA 4E3SA 3SPZA 2W42A 1VSKA 4RW4A 3OS0A 3DMJA 3EY1A 4B9SA 5JS1A 2G8VA 1BQMA 2G8KA 3AO3A 2ZQBA 3CQ8A 3IS9A 4CESA 4FM2A 2BGGA 5CZ2A 3V81A 4KI6A 3OYEA 4F4KA 3AO4A 2DFFA 2OPQA 3NFAA 3L2QA 3QEPA 4M45A 4CK2A 4CFDA 4B9UA 3PX4A 3QEWA 1NKCA 4HHTA 5J2QA 3ZSRA 4KB0A 4CF1A 3ITHA 4CEOA 1S1XA 4FJKA 4M3TA 1QHTA 1R0AA 2HW3A 1FK9A 3OVNA 3V9WA 3K5MA 3AVGA 1TK8A 4PQUA 3MEDA 3LZJA 3OYNA 1TKXA 4NCAA 4PUOA 3TAFA 4ID5A 4R5PA 3K5NA 4KHSA 3CFPA 4E7LA 1ZBLA 3SYZA 1S1TA 3VQQA 3WNEA 3VQEA 5KRSA 4FJ9A 4OKEA 1J5OA 3SUPA 2HHUA 1RNHA 2YNIA 4IG0A 4N47A 4CEEA 4Z4IA 4LH5A 4RW9A 4FLTA 3OY9A 1SL1A 4N76A 1TV6A 4KTWA 5FROA 3AV9A 5T7BA 4H4OA 5FRNA 2E6MA 4B9MA 4PY5A 1A5XA 2ZD1A 2PYLA 4J2DA 1HYVA 2HHWA 2Z1GA 1RCHA 3DLRA 1JXEA 2KZZA 4FLYA 4E7JA 1VSDA 5C25A 3TAMA 1W9HA 2E4LA 3HSTB 1JLCA 1JXBA 3K2PA 3MEEA 3VQ5A 4CFCA 4BE0A 3U6FA 3ASMA 3DRPA 3P5JA 3G0ZA 1S1WA 3RMDA 3CFOA 4BDZA 3AVCA 4DQIA 4DLGA 3VQPA 4AHUA 4JS5A 4HUFA 1KVAA 2I5JA 4HVJA 4KTZA 2ATQA 3AO1A 3DRSA 4FXDA 1NOYA 3PUFA 4GVMA 2XO7A 3OYJA 4CF2A 3BGRA 3AA2A 3M8SA 1EETA 1X1PA 4DLEA 3OYCA 4DSIA 1FXXA 1YT3A 1C0TA 2EHGA 3BDPA 4H4MA 4CE9A 1GOCA 4KV8A 3LPTA 2GBZA 3KTQA 1RT4A 4ICLA 1ZBUA 4MQ3A 1NJZA 4MFBA 5SZTA 2JGUA 4FJ8A 1YTAA 2ITGA 3KK1A 1RTDA 4F2SA 4J2BA 1O1WA 3LAKA 4DFJA 1RTJA 4W5NA 4Z4GA 3DLHA 4CJWA 1J54A 4ID1A 4KAZA 4AHVA 3O4QA 1KFDA 4DS4A 1KSPA 3ZSXA 3SQ0A 4C8LA 1CZ9A 1RT3A 1WSJA 4F2RA 3AVMA 1BCOA 1RDAA 1HMVA 4FJMA 2RPIA 2YNFA 3L8BA 4FM1A 1TKZA 1XC9A 3LPUA 2XY6A 1T8EA 4BE2A 1HYZA 3TABA 5FDLA 1VSLA 2DFHA 4FJXA 3B6PA 4O55A 3LDSA 4M42A 4OKJA 3HVTA 1HJRA 3AVLA 2YNGA 4RG8A 3TR8A 4Q5VA 4DTXA 1L5UA 4AILC 4OLBA 4FJNA 3HXMA 1J9AA 1F21A 1TGOA 4FJIA 4DTMA 4CEZA 2OPPA 4CGJA 4DFKA 4Z4EA 1EKEA 1ZBFA 2IAJA 2P1JA 3AO5A 5I3UA 3OYAA 2E6LA 2QKKA 2PYJA 4CERA 4KHYA 2G8IA 4CFAA 2A1SA 3AVNA 4FW2A 1WNSA 2XRIA 3DLKA 3SQ2A 1D9DA 1KFSA 2B5JA 1WSGA 4HCCA 5HRSA 1LWFA 1SL0A 2YHAA 4CHPA 1S6PA 4JRQA 4Z4CA 4AH9A 4M3ZA 2IC3A 4DSEA 3TAPA 4KPYA 3NF7A 2XY8A 5K14A 3DLEA 4IFVA 4O44A 1NKBA 4IBNA 1RDCA 3OYKA 1TK0A 1ASWA 3KLHA 3AVKA 3HPGA 1ASVA 1K6YA 5KRTA 1U04A 4Z4HA 3M8QA 4OLAA 3AA3A 4DSKA 4LY7A 4B8CA 3QIOA 4B08A 5CYQA 1L3SA 2KQ2A 3DLBA 4KHUA 5CY4A 2VG5A 3T1AA 2RF2A 1UA0A 2YKMA 3VQBA 4IDKA 3ZSYA 1Q9XA 5J2MA 4JRPA 2WOMA 4FYDA 4O0IA 2F8TA 1C1BA 4NYFA 1VSIA 3T19A 2Y1IA 3V1OA 3NH2A 1ZBIA 1D8YA 2G8WA 4I9QA 5HRNA 2XHBA 4NYNA 2FBVA 3QNOA 1RTHA 3QNNA 3V9UA 4IKFA 2KZMA 2Q3SA 2LSNA 4CIEA 1NK5A 2YKNA 3VQAA 3AO2A 3ZSWA 4W5QA 1BI4A 3I0RA 5C24A 4Y1CA 1JLAA 1S1VA 1UWBA 5DK5A 2HHTA 3NGZA 3ZT1A 4DF8A 2DTUA 3MECA 3HT3A 1SKRA 1LWEA 3I8DA 3LP2A 4E0DA 3QLHA 4E19A 1Z26A 4KRFA 3DLGA 3F73A 1WAFA 2O4IA 1QSSA 4AHTA 4CECA 3VQ7A 1VSFA 3KLFA 4DU3A 2YNHA 1XHZA 1C0UA 2HVHA 4OGEA 4KHQA 4Q0BA 4M3XA 1S6QA 3KK2A 5HBMA 1BL3A 2DFEA 4O4GA 4BWMA 3ZT3A 3SQ1A 4B8AB 4DQRA 1D9FA 3AA5X 1SUQA 3IAYA 1RT6A 3NF9A 3DOLA 2JLEA 4LSNA 4B9NA 3ZSOA 1S5JA 4FJGA 1BI4B 4C8NA 1W0HA 2A1RA 5HLFA 4HCBA 4DTOA 2KFZA 2HNZA 2OPRA 1A5WA 1HYSA 5KGWA 3QEIA 2HMIA 1NK4A 1GOAA 2BANA 3C95A 2RKIA 2VWKA 1KLNA 2FBTA 3VA3A 3CM5A 3M8PA 5DMRA 4ELUA 3ULDA 3OYLA 4O0JA 4J2AA 1VSJA 4JLHA 4CF8A 4FVMA 4CGGA 1RT2A 1TAQA 2Z1HA 3QO9A 4CHYA 5JS2A 4C8OA 1NJXA 3NBPA 1BIUA 3DOKA 3C6TA 3QESA 4BWJA 4CJFA 4OJRA 4CIFA 4CCHA 3NDKA 4KTQA 3VQ9A 1RBSA 2QKBA 2P5OA 4KI4A 1BISA 1TVRA 1Y97A 1LAWA 4AHCA 3TI0A 2YHBA 1L3VA 3V9SA 1C0MA 2OPSA 4EZ6A 2HHVA 1I39A 2P51A 1SL2A 3TANA 1IH7A 2ZE2A 3L3UA 3NF8A 4B9TA 4Z4FA 4E7KA 3HL8A 2IOCA 4I9LA 3SI6A 5I42A 3M8RA 2R7YA 4O5BA 3SQ4A 3LP1A 4CGFA 3OYHA 4C8MA 3EYZA 4AHSA 3JYTA 1RTIA 1TKDA 1HNIA 1WSFA 3AVIA 4NCGA 1IKXA 4CJLA 1RT1A 3AVFA 2VG6A 3RRHA 1JLEA 2YV0X 4CJVA 4DFPA 1ITGA 2HB5A 4DWIA 1HRHA 2Y1JA 4BDYA 4DG1A 1X9SA 1DLOA 1SV5A 5KGXA 3SPYA 3MEGA 1UOCA 1JL1A 3NH1A 1NK6A 3ZT2A 4ZTJA 4ZHRA 3KIOA 4M3YA 3VQ8A 4DF4A 3NHGA 1XWLA 4F3OA 1ZBHA 3FFIA 1JLGA 2B4JA 4DTRA 2KW4A 5FRMA 4PA1A 4QCLA 1WN7A 2X6SA 3L2WA 1BGXT 3F9KA 1I3AA 4W5TA 4FK0A 4IFYA 2IGIA 2WONA 3NGIA 4OPKA 2KTQA 4FZYA 3KLIA 4IG3A 1T05A 5HRPA 3TWHA 3OYDA 5HROA 3OYIA 1J53A 3L2UA 2D5RA 4QOZB 2D0AA 2FC0A 4KHNA 4ZTFA 1VK0A 3ZSVA 3PO5A 1XHXA 3O3FA 2HNDA 4C8KA 4I7FA 3DYAA 3K5OA 3A2FA 5EU7A 5D3GA 4DQSA 1KRPA 1EX4A 4E7HA 3LANA 1IO2A 3ZT4A 4CEAA 5KTQA 5J2NA 4B3OA 4CJPA 3VQ6A 3KLEA 1U4BA 4CJRA 4N5SA 1LWCA 4DTJA 3JSMA 1VRTA 1NK9A 1Q9YA 1U48A 1TL3A 1EP4A 1S9GA 4FLWA 4OPJA 3WNHA 4J2EA 3O3GA 1JKHA 3P1GA 2HNYA 1T03A 3UIQA 1YTUA 3AVJA 4F3TA 1JLFA 1KCFA 4E1NA 1FKOA 1NJYA 1EXQA 3AVBA 2RN2A 3LP3A 3RR8A 2Z1IA 3C94A 1RBRA 3U3GA 2D0BA 4FLUA 2XY7A 1C1AA 3KD1E 4EZ9A 2HHSA 1VSHA 3IG1A 3OYGA 4BDPA 2GUIA 1NK7A 3PY8A 4K8XA 3PX0A 4CJ4A 2G8HA 3SV4A 3HVRA 4AHRA 4DTNA 4DQPA 3IRXA 4GW6A 3WNGA 1IG9A 1RILA 1WSEA 3P83D 4CEBA 4E1MA 2HHXA 4BACA 1KTQA 4EP5A 4FJ5A 1RBVA 3HPOA 4CK1A 3H08A 2KFNA 3TAEA 1IKWA 3HP6A 3HK2A 1WSHA 4HUGA 1WLJA 3MXMA 4NCBA 1Q8IA 1X9MA 2IDOA 4CEQA 2AJQA 1YVUA 4FCYA 3K58A 3ZCMA 1QTMA 4N41A 4DMNA 1KLMA 4N56A 1G15A 4CJSA 3O3HA 3T3FA 4L8RB 4DU4A 3SZ2A 4CJ3A 1LV5A 5HP1A 4CK3A 3U3YA 1CZBA 1DTQA 3RTVA 1LW2A 3HYFA 3EZ5A 4FLZA 4CHZA 3MXJA 1U45A 4LSLA 4XIUA 3ISNC 4M41A 3CM6A 4I2PA 4QAGA 3SJJA 1DTTA 3NAEA 1IKYA 5J2PA 3ZT0A 3OYBA 4JS4A 4RW7A 4B9VA 4DSJA 2F96A 3KKRA 1BCMA 1N6QA 4FM0A 1RT7A 3K59A 4DTUA 3TAQA 2BDPA 4M3RA 3SNNA 1BQNA 1JLQA 1S9EA 3QEVA 1NOZA 1SKSA 4FJJA 2F8SA 3OYFA 4DSLA 3KKSA 1C1CA 2FBYA 2NUBA 3B6OA 4KFBA 3RMCA 1U49A 4KREA 3THVA 1UAXA 4W5RA 4KHWA 3MAQA 3AVHA 3WNFA 1HPZA 4DSFA 3SCXA 4CHOA 1C6VA 1B9FA 3G10A 3S9HA 2OZSA 4OGCA 3ZSZA 4GMJB 1Z25A 1NK0A 1TL1A 3C6UA 4CJTA 3I0SA 4CGIA 4CF9A 5C42A 3KLGA 4OVLA 3CG7A 3HPHA 3SUQA 2G8UA 2QXFA 3V6DA 1CLQA 4FW1A 1ASUA 3LWLA 3LP0A 4F8RA 4CIGA 1A5VA 2XY5A 1KVBA 3VA0A 1L3UA 3MXIA 4CGHA 2G8FA 3E01A 4PWDA 1IKVA 4ELTA 2Z1JA 3OJSA 1D5AA 3ALYA 4G1QA 1HQUA 1S1UA 2FBXA 3LAMA 3V1RA 3V4IA 2OYQA 1RT5A 5SWMA 2X74A 3K57A 4FZZA 3PO4A 1B9DA 3QETA 3SUOA 4WE1A 3SUNA 4CJEA 4LH4A 3AVAA 1CXUA 4DTPA 4M3WA 3NF6A 1JL2A 4CJQA 3S3OA 1REVA 2IS3A 3PV8A 5HRRA 3RMAA 3TARA 3NE6A 3S3NA 1L3TA 1T7PA 3RR7A 1RDBA 3RWUA 4FJLA 4K8ZA 4CFBA 3DM2A 5E41A 3OS1A 1N5YA 4YNQA 2B6AA 3OS2A 1TKTA 3KD5E 3S3MA 1XI1A
chains in the Genus database with same CATH superfamily
3J81O 2PY5A 3OYMA 2BE2A 3M6GA 3VQCA 4JI4K 2D0CA 3HSCA 1IBLK 4KO0A 1QVFM 4IJNA 1SS6A 1KVCA 1H1VA 1SQKA 1VSMA 1QZ6A 5AQQA 4NO7A 4JK7A 4DTSA 3VQDA 1G99A 1IJJA 1WBDA 1DGKN 3SMPA 4LFAK 4UQGA 3QINA 5CYMA 3U8XA 4ISGA 4A57A 2OTJN 4JI8K 4K25A 2W41A 4CZFA 3BUZB 4CJUA 2ETJA 1TAUA 1ZXOA 3V9ZA 3FFKB 2HVIA 4KKOA 1NM1A 1QQCA 2GTDA 3RMBA 3THWA 3LWMA 4FLXA 4DUZK 3HP9A 5TKYA 5HOOA 4CHQA 1LAVA 2WBNA 3J8AA 4CJKA 4A5AA 1BA0A 1BHLA 3L2RA 2DY4A 4CGDA 1NGIA 4DV3K 3DRRA 4CHNA 2W42A 4B9SA 3OS0A 4XH4A 1WB9A 2G8KA 3AO3A 4KI6A 4K0KK 3AO4A 2DFFA 4ILGB 4CK2A 1J6ZA 1WUAA 5C15A 4FJKA 3V9WA 2NRHA 3K5MA 4PQUA 3EEQA 3LZJA 2OANA 3BF1A 3VESA 1TKXA 4ID5A 1ZBLA 1S1TA 3WNEA 3VQEA 1YAGA 4JAXA 3L0QA 4LH5A 4FLTA 1TV6A 1W97L 4MDAA 1RCHA 4YOUA 1VQKN 2V7ZA 3M5RA 1JLCA 3K2PA 1Q82O 4WQ5A 3LDPA 3P31A 1S1WA 2ZM6K 3MX2A 3AVCA 4JS5A 4HUFA 2I5JA 2HBLA 4KTZA 1OKJA 1P90A 2ATQA 3DRSA 4X66K 1NOYA 2FXUA 4CF2A 1ATNA 3AA2A 3M8SA 1NGDA 1EETA 3OYCA 1FXXA 3BEXA 3VEYA 3KK7A 4KV8A 3OHRA 2GBZA 1HNXK 4FJ8A 4Z94A 2ITGA 3KK1A 2QWNA 4MDBA 1RTDA 4F2SA 4J2BA 5LL6Z 1O1WA 4DFJA 1NU0A 3DXMB 3DLHA 1J54A 4ID1A 2QWOA 1KFDA 5EY4A 5BR9A 3ZSXA 3CCQN 4BRMA 1BA1A 2YNFA 4FM1A 2XY6A 3LDLA 1QQOA 4BE2A 4FJXA 2DFHA 4O55A 4CBUA 2A5XA 3FE1A 4LF5K 3QBXA 3BF3A 1J9AA 3VEVA 4FOIA 1EKEA 4DSLA 3CCMN 2ZJPL 4KHYA 4JD2B 2A1SA 1YITN 3SQ2A 2XRIA 4FWLA 2HMPA 1S6PA 5EXWA 4JRQA 1OVYA 2Q1NA 2XY8A 4FWSA 4O44A 4DUYK 3OYKA 4FVUA 1ASWA 1JCFA 3AVKA 4DR7K 3ENHA 5AZJB 1HPMA 1K6YA 1U04A 3M8QA 3AA3A 3QIOA 5EOYA 1YJ9N 4H0TB 3IDHA 2Q31A 3D2FB 3ZSYA 3IUCA 4QS9A 5JLFA 2WOMA 3GOIA 2ITMA 4O0IA 4NLCA 3PSIA 3VERA 5KPRA 3NH2A 2VGNA 1NGCA 2E2QA 2G8WA 4I9QA 2QWMA 3MMVA 2FBVA 3V9UA 3QFUA 2Q3SA 1BDGA 1BI4A 1S1VA 3N4QA 4E19A 1Z26A 3CCUN 3F73A 1QSSA 4AHTA 1VSFA 3KLFA 4DU3A 4F9OA 1S6QA 3KK2A 5HBMA 4WF9L 2DFEA 4BWMA 3SQ1A 4B8AB 1LCUA 1SUQA 3O08A 4FJGA 3TTFA 3CC2N 1W0HA 2A1RA 4HCBA 4NLBA 4DTOA 2HNZA 1A5WA 3G6EN 1HYSA 4IEEA 2J4RA 4BREA 1GOAA 2VWKA 1KLNA 2FBTA 3VA3A 5DMRA 3N4PA 3OYLA 4JLHA 1VQON 1RT2A 2Z1HA 3T7ZA 1NJXA 3NBPA 1BIUA 3GL1A 3QESA 2FSNA 1EWRA 3HOTA 3AAPA 2P5OA 4KI4A 1RFQA 1TVRA 4AHCA 1C0MA 1I39A 4B9TA 4E7KA 5I42A 1HLUA 1OH5A 4CGFA 5BREA 3OYHA 4DR5K 3KWGA 4PKIA 3LDNA 3AVIA 3TPQA 5F0XA 2VG6A 3RRHA 4DFPA 2HB5A 3SBTA 3CMAN 4BDYA 3FZKA 4DV2K 1DLOA 5BPMA 3EN9A 1UOCA 1NBWA 1NK6A 3ZT2A 4ZHRA 2HF3A 4ISEA 4M3YA 4DF4A 1ZBHA 3SAFA 2B4JA 1VQ4N 4PA1A 3H45C 1V4TA 1WN7A 2E5LK 2FF6A 1I3AA 3MN9A 4A62A 2AA4A 4WQ4A 3KLIA 2P9SA 4BR2A 1T05A 3TWHA 1KD1O 5HROA 1Q81O 1K73O 1J53A 4KHNA 5C0YA 1XHXA 5JMVA 3DYAA 5EU7A 1KRPA 1J5EK 3CI5A 5KTQA 5J2NA 4CJPA 3KLEA 1U4BA 4N5SA 3ZX0A 4DTJA 1Q9YA 1C0FA 4FLWA 4B3TK 4OPJA 4DV0K 3GE1A 4R79A 1YTUA 4OPAA 3ZX2A 2BUPA 4E1NA 3AVBA 3LP3A 5M1KA 2O8DA 2HHSA 1C1AA 4EZ9A 2QWQA 5CHIA 3PX0A 4CJ4A 2G8HA 3CCRN 5AQTA 3IRXA 4GW6A 1IG9A 4H5VA 5KPTA 1WSEA 2P9KB 1RBVA 4IZ9A 3EKSA 1IKWA 4DCHA 1WSHA 2P9IA 4HUGA 1WLJA 4DR1K 1X9MA 4CEQA 5E26A 3R3LA 4YORA 1YVUA 5AQXA 4N41A 4RTFD 4DMNA 4EAHD 1G15A 4BR9A 3SZ2A 2ZGZA 4CJ3A 5HP1A 4CK3A 3C65A 4BR0A 3HYFA 4PHTX 4FLZA 3RTVA 2O8EA 4LSLA 3CHWA 3SJJA 2ASPA 3NAEA 3CCLN 1IKYA 1U2VB 3SK3A 5M1FA 4B9VA 2F96A 3EKUA 1DEJA 3KKRA 4JKGB 1N6QA 1NLVA 4M7YA 2BDPA 1BQNA 1NJIO 1NOZA 4CVNE 2F8SA 1C1CA 1HUXA 3RMCA 4KFBA 1UAXA 3MCAB 4ILHA 1GLDG 1S22A 3CJCA 3F5TA 3WNFA 1HPZA 3WQUA 4DSFA 3O6WA 2OZSA 3S9HA 1NK0A 4CJTA 4JYAK 2G8UA 3WXLA 2O8CA 1KVBA 2NRZA 1N32K 3MXIA 2O8BA 1MA9B 4EHUA 3ENBA 3L6QA 2GELA 3FZHA 3K57A 2YCHA 3QETA 1VQPN 1IV0A 1REVA 3PV8A 3NE6A 1N5YA 3W0LA 2B6AA 1M90O 1TYQB 5CZ1A 4PKHA 2HBMA 4CJ5A 4JV5K 3VGLA 4M3UA 5AQVA 4YFUA 2X78A 4H5RA 2A40A 4W5OA 4I2QA 1BWFO 5AZJA 4RW8A 2X6NA 3LZIA 2HHQA 4RW6A 3KK3A 1YJNN 4MO5A 4CEDA 4OKKA 3LALA 3SV3A 2NLXA 3EO3A 4XEIA 1EO1A 3G71N 4JI1K 3B8AX 3U9ZA 4JKHA 3SLCA 4DS5A 1QE1A 3VQ4A 4NXMK 4E7IA 1NGFA 5C10A 1RDDA 3TAGA 1QSLA 1NJWA 3PX6A 1K8AO 3LM9A 2OA8A 1MWMA 2VWJA 1JJ2M 1CXQA 4BVPA 1VSKA 4RW4A 3DMJA 5JS1A 3IS9A 5AFUH 3V81A 2OPQA 3DXMA 1OH8A 4M45A 5ADXH 2Q36A 2AP1A 1NKCA 3TU5A 4DV7K 4KH6A 3TSQA 1S1XA 3CF5L 4K42A 3OVNA 3AVGA 5AQLA 3MEDA 3OYNA 4PUOA 3TAFA 4R5PA 4KHSA 5I9EB 1IG8A 4E7LA 3VQQA 2HBJA 5KRSA 1HNZK 2D0PA 1Y64A 4N47A 2UXBK 2YX6A 4IEIA 4B1YB 4N76A 4CZLA 5FROA 4YDUC 4H4OA 2O8EB 2HBKA 2ZD1A 4BRIA 2Z1GA 1JXEA 1ATSA 4FLYA 2KZZA 3TTCA 3S41A 1VSDA 4HWIA 5AQYA 5C25A 4B3SK 2VYPA 3MEEA 3VQ5A 5GIOA 3G0ZA 3FR0A 4A5BA 3RMDA 2YHXA 1MWKA 1KVAA 3U4LA 3AO1A 4FXDA 3CETA 4DV5K 1XUPO 2XO7A 3OYJA 3F2KA 1HJOA 4JKAA 3HZ6A 4X65K 4FO0A 1YT3A 1C0TA 2E8AA 2EHGA 4CE9A 3FZMA 1I94K 1ZBUA 2JGUA 3T1HK 4H5NA 1HR0K 4BRGA 4YDUA 4W5NA 4CJWA 4KAZA 4AHVA 5LJWA 1KSPA 4DKWA 1TUUA 3SQ0A 4C8LA 3ZEUB 1CZ9A 1NGAA 1RT3A 4EFHA 3AVMA 4F2RA 1RDAA 4FJMA 3BY5A 2P9PA 3SAHA 3L8BA 1TKZA 3UB5A 1T8EA 2CH6A 3H1QA 3P39A 3B6PA 4FWKA 1S3XA 3HVTA 2YNGA 4RG8A 2FSJA 3TR8A 1L5UA 2CGLA 4AILC 1F21A 4CGJA 4DFKA 3ZX3A 1ZBFA 2IAJA 2KKZA 2P1JA 3OYAA 3C6HA 4DV6K 4GKJK 4CFAA 4BC4A 1QZ5A 3AVNA 1WNSA 4JKDA 1D9DA 1W7AA 1N33K 1YUWA 1LWFA 3DLLL 4M3ZA 4AH9A 3TAPA 4KPYA 3NF7A 3P38A 4GV9A 1NKBA 1TK0A 1RDCA 3KLHA 5AQGA 1NMNA 3R6MA 4B08A 2KQ2A 4Y0WA 4CI6A 3T1AA 5AQOA 1Q9XA 5J2MA 3RVCA 2P9UB 3T19A 4NYFA 2Y1IA 3V1OA 1FW6A 1D8YA 3L4IA 3CJBA 2XHBA 2I7PA 2OTLN 4DQ8A 1RTHA 2KZMA 4IKFA 3DAWA 4CIEA 3AO2A 5BN9A 4W5QA 4Y1CA 1UWBA 3QICA 5DK5A 4JKBA 3ZT1A 3MECA 3VTIA 3CJ9A 3LP2A 4BGBA 3Q7BA 1ILYA 3CXCM 3C6AA 4KRFA 1WAFA 1Q86O 4EHTA 2BH1A 3P4IA 1XHZA 4M3XA 1RDWX 5JVGL 1YI2N 3DOLA 2JLEA 4C1NI 4B9NA 1S5JA 1BI4B 3O1WA 3EL2A 4C8NA 3THYA 3GG4A 2KFZA 2OPRA 4IOXA 5AR0A 1K8KB 3C95A 4FL9A 4O0JA 4J2AA 4CF8A 3OYBA 4CHYA 3QO9A 3NVMA 4JK9A 4JKFA 4BWJA 4OJRA 4CJFA 4CIFA 1NNEA 1VQ7N 1RBSA 3VGMA 1BISA 3TI0A 1L3VA 3OA9A 4K43A 3D2FA 2QWLA 3I33A 3TANA 1IH7A 4Z4FA 3D6RA 5AQJA 4CBXA 4IJAA 2QW9A 4AHSA 5HL7L 4HTLA 1WSFA 5EVZA 3CC4N 3CJ7A 1JLEA 4CJVA 1ITGA 1HRHA 3AARA 1X9SA 5KGXA 1R59O 3O4WA 3MEGA 3NH1A 2P9NB 3KZBA 3J80O 2KW4A 1QQMA 2Q97A 3L2WA 3F9KA 3BZCA 3THXA 2IGIA 3CERA 4OPKA 2KTQA 1VAZA 3CQYA 4BC5A 3QMLA 3THYB 3BZKA 3OYIA 5F1XA 3MK6A 3O9QA 4BRDA 2D5RA 2FC0A 4ZTFA 3PO5A 3SMSA 2HNDA 3A2FA 5AQUA 3ZT4A 1IO2A 4CEAA 3VQ6A 4CJRA 4WQ5C 1LWCA 1NK9A 1EP4A 1JKHA 5GAHP 3I55N 3M1FA 3AVJA 4F3TA 4YHHK 3RR8A 2Z1IA 5FPMA 3AY9A 2D0BA 2VWBA 4FLUA 2F9WA 3IG1A 4BDPA 3EE8A 3PIOL 4AHRA 4DTNA 4DQPA 5FPNA 1OH7A 4BROA 4E1MA 4BQZA 1KTQA 2UU9K 3NVKA 1NGBA 2F4VK 2NRTA 2AJQA 4FCYA 3R8EA 4BRNA 4N56A 2YHWA 5AQFA 4L8RB 3ZLJA 1QHAA 3U3YA 1CZBA 4IOCL 4CHZA 1U45A 4FWNA 4XIUA 4M41A 1BUPA 1X3NA 4QAGA 4RW7A 2PFUA 1IBKK 1BCMA 3K59A 4DTUA 3WXMB 3TAQA 5AQSA 1SKSA 3I8BA 1HX1A 2NUBA 4MLEA 3THVA 1Z6RA 4JEPA 1ZBSA 1C6VA 3AAQA 3Q7CA 2UUCK 1TL1A 4CF9A 4DV1K 1FJGK 2E1YA 3SUQA 3V6DA 3CPEA 2A3ZA 4M7XA 2XY5A 2P9PB 3VA0A 1L3UA 3R9PA 1QQNA 3ZEUA 2Z1JA 3K9KA 4B9QA 3OJSA 4H0VB 1GLEG 4G1QA 4KHPK 1S1UA 2FBXA 3LAMA 3FZFA 4FSVA 3V1RA 3VETA 2WC9A 4FZZA 3OBYA 4WE1A 3SUNA 3AVAA 1CXUA 5HRRA 3RMAA 4M42A 1O13A 1RDBA 2WTUA 1M1KO 4YNQA 3FZLA 3WXJA 4LF4K 1WSIA 2GV9A 2O4GA 1ATRA 3O9UA 3D45A 4B9LA 4CEFA 4FK4A 4JI0K 5J1EA 5DM6L 1JLBA 4LF9K 1NKEA 1HKGA 1V4SA 3O4NA 1Q7YO 4CZEA 3ATVA 2EX3A 3K9JA 3HM9A 4BC3A 4IDHA 4CF0A 4LD0A 1HKCA 4Y1DA 3OJUA 5LMUK 5BRDA 4H0PA 4JI5K 3RRGA 3MN5A 3V9XA 3QEXA 4DQQA 3HO1A 1BO5O 1HQEA 1QS4A 3KVGA 3A5NC 4DFMA 2JWKA 5F2RA 4PL8A 3L3VA 3ZSQA 4FWRA 3UKUA 5GADP 3CYMA 4FJ7A 3K5LA 3QIPA 3L4QA 3NCIA 4DV4K 1MU2A 2E2OA 2HW3A 4ELVA 4E89A 1RBUA 4BE1A 1LW0A 3NH0A 3M3ZA 3NGYA 1FKPA 1VSEA 4FZXC 3OBWA 4JI3K 4E3SA 2IVOA 4O8UA 2G8VA 2ZQBA 3T1YK 4CESA 2BGGA 4EIAA 5CZ2A 3O1BA 3L2QA 3QEPA 2QM1A 4CFDA 4NB4A 4AM7A 4BR4A 3ZSRA 4CF1A 2ASOA 3CD6N 1R0AA 1FK9A 1WOQA 1VQ5N 1TK8A 1D4XA 3PLAA 3CCEN 4NCAA 3H3OB 4WYBA 4FJ9A 1YHQN 1J5OA 3LM2A 2ZWHA 1GLJO 4CZMA 2YNIA 3VEXA 4IG0A 1SL1A 4JN4A 1P8ZA 5DM7L 4KTWA 3AV9A 4BRAA 2E6MA 4B9MA 3MN6A 3R1XA 2QWRA 4J2DA 2O8FA 1HYVA 1CZAN 1YF5L 2GWKA 1OVQA 1W9HA 3HSTB 2P9LB 4CFCA 4BE0A 4QS8A 3ASMA 3C7NA 3P5JA 1XMOK 3LL3A 3TSUA 2DPNA 2ZF5O 4CZHA 1T3VA 3VQPA 4AHUA 5MLCQ 2A42A 4GVMA 1TYQA 3BGRA 4MLHA 4WQ4C 1X1PA 4DLEA 4DSIA 4BGAA 3KTQA 4DB3A 3ID6A 4ICLA 1NJZA 4MFBA 3RSEA 5SZTA 2QA4N 1GLCG 1RTJA 4Z4GA 2F7TA 4PKGA 3UE5A 4BRFA 4DS4A 2GX9A 3CJ1A 1BCOA 2E1ZA 1HMVA 5LMNK 2RPIA 2O8CB 1XC9A 3LPUA 5M1PA 1HYZA 5CR4A 1X3MA 3TABA 1YIJN 5AQPA 5FDLA 5AJ3K 4A2AA 3LDSA 4OKJA 3QB0A 4KH4A 4DTXA 3ZETA 2RHKA 3H6EA 4FJNA 4UY8O 3HXMA 1TGOA 4FJIA 2UXCK 2A41A 4CEZA 4BRKA 2OPPA 3AO5A 2PYJA 2E6LA 3O8MA 4ISFA 3I56N 4H0OA 2PAVA 4FW2A 4IFEA 4XH5A 4JKGA 4A2BA 5JLHA 3A5OC 5HRSA 1NWKA 2P9UA 1SL0A 2HF4A 4B3MK 4CHPA 3J7AP 4Z4CA 2IC3A 4DSEA 1N34K 2GUPA 5K14A 4IFVA 4IBNA 2KLAA 1NMDA 2IIRA 3HPGA 1ASVA 4OLAA 3K0SA 5AQIA 3MWPA 3LDQA 1L3SA 4YOVA 2VG5A 2P9IB 3VEZA 4BRPA 2YKMA 3VQBA 2YI1A 3NMUA 4JRPA 2P9KA 3G25A 3W3DA 1S72N 1C1BA 1VSIA 2RE2A 1NGGA 1NG9A 4GY2B 3D2EB 4DR3K 3WEEA 1W2BM 5HRNA 4NYNA 1KAXA 3QNNA 1T44A 2LSNA 1NK5A 1U6ZA 2YKNA 3VQAA 4E1JA 3I0RA 5C24A 1JLAA 4DF8A 1SKRA 3DXKA 3I8DA 4FWOA 3IKMA 2O4IA 2Q0UA 2I7NA 4CECA 2HVHA 1C0UA 4OGEA 4KHQA 4Q0BA 1XC3A 5AQRA 4O4GA 1D9FA 1VHXA 4KBOA 3AA5X 3IAYA 5BPNA 3NF9A 4LSNA 2HHWA 3VEOA 4GKKK 5HLFA 1IBMK 2F9TA 1EWQA 1NK4A 2BANA 2RKIA 1VQNN 3IFRA 5ELZA 3KHYA 3TSPA 4FVMA 4CGGA 2ZJQL 1TAQA 2E88A 4C8OA 3DOKA 3C6TA 4KTQA 2VGMA 3VQ9A 4BRHA 5KQDA 1Y97A 2F8TA 1LAWA 4I6MA 4EZ6A 3V9SA 2OPSA 2HHVA 3VPZA 2P51A 1QVGM 1SL2A 3L3UA 3NF8A 4V19S 2IOCA 5M1NA 2QXLA 2R7YA 3SQ4A 4C8MA 3JYTA 3O9SA 2HHHK 4CJLA 5BR8K 4MO4A 2FLOA 3QFPA 5JICA 4DWIA 2Y1JA 3SJHA 4DG1A 4C1NK 3PIPL 1JL1A 4ZTJA 4FPAA 3NHGA 4CZKA 3WUHA 4AM6A 4DTRA 5FRMA 4YOYA 3IMXA 1BGXT 4FK0A 4W5TA 2E20A 2WONA 4IG3A 5HRPA 3OYDA 3HBTA 4O8KA 1XQSC 4QOZB 2D0AA 1VK0A 2NRRA 4I7FA 2FSKA 1EX4A 3GDQA 4YOTA 3JSMA 2OCEA 1TL3A 1U48A 1S9GA 5AQHA 3WNHA 1E4FT 3P1GA 4L3QA 4U67L 3UIQA 1JLFA 1EXQA 2RN2A 2NRXA 4LFBK 4ILJA 1RBRA 3H46O 3U3GA 3KD1E 3TTDA 3OYGA 3PY8A 3H1VX 3HVRA 3HM8A 3O9RA 1RILA 1GLAG 3EZWA 2VQEK 4BACA 2E2NA 4EP5A 5AQKA 4BC2A 3CQXA 3HPOA 4FJ5A 4CK1A 2KFNA 2HOEA 4CD3A 2IDOA 5LY3A 4IWVA 1VQ8N 1QTMA 3CC7N 1KLMA 4CJSA 3T3FA 4DHYA 1LV5A 4BRLA 1DTQA 1JCGA 2ASMA 5KPZA 4I6MB 3U9DA 3MXJA 3DWLA 3SBGA 3HOSA 4CZGA 1DTTA 1KQSM 5J2PA 4JS4A 4PL7A 5E84A 4DSJA 1OH6A 1BG3A 4FM0A 4M3RA 3VF4A 4JD2A 1S9EA 3OYFA 2FBYA 3B6OA 1VQLN 4KHWA 4IO8A 3AVHA 3A5LC 1SAZA 4CHOA 1B9FA 3MWTA 4OGCA 4GMJB 4B1ZA 5C42A 4OVLA 1KC8O 2QXFA 1CLQA 5GINA 4FW1A 1ASUA 3LWLA 4F8RA 3ZYYX 3UKRA 1A5VA 4CIGA 2O8BB 1IKVA 1DKGD 1GLBG 3OW2M 3CCJN 3ALYA 1HQUA 4K41A 3F9MA 1YJWN 3V4IA 1ESVA 4JHDB 5AZIB 5SWMA 1B9DA 3WEEB 3SUOA 5GAGP 4CJEA 4LH4A 3D2EA 4M3WA 4DTPA 3NF6A 4H5TA 4CJQA 2IS3A 1T7PA 3S3NA 3RR7A 4CD1A 3RWUA 4FJLA 5E41A 3DM2A 3CCSN 3OS2A 1TKTA 3KD5E 3S3MA 4JKCA 1VRUA 4DU1A 3HJFA 4O5FA 1U2VA 4H0YB 5BRFA 3L2VA 1K9MO 4YY3K 4FK2A 3KWIA 4CBWA 1RGIA 4AF1A 1DT9A 3CFRA 5AFUA 1X9WA 1VQMN 4Z0UA 1TK5A 2P5GA 3A0IX 3LDOA 4FLVA 1QSYA 1RBTA 2FF3B 1U47A 1B92A 5AQNA 1KXPA 1WAJA 1ZYQA 3AA4A 1XNRK 3V1QA 4HTUA 1GLFO 3E9LA 5KI6A 3DI6A 4EP4A 2PZSA 4HUEA 4FJHA 4TSXA 2OZMA 4KB1A 1BIZA 4B1UB 1UA1A 2Q2RA 3QERA 3KJVA 1SKWA 3VN5A 3D0PA 3E9PA 5BRHA 3MX5A 4NCBA 4PWDA 4H8KA 1NK8A 3ZETB 1GOBA 2D1KA 4H0XB 1Q18A 5FPEA 1NGJA 2VG7A 2O8DB 4JHDA 5AZIA 5AQWA 5H1SQ 1HNVA 3SPZA 3EY1A 1BQMA 1WBBA 3VEWA 3CQ8A 4FM2A 3UKRB 3MDQA 3OYEA 4F4KA 3ENOA 3NFAA 2WUSA 3MN7A 4B9UA 5FPDA 1KAZA 3PX4A 3AGKA 1TUYA 3QEWA 2UYTA 4HHTA 5J2QA 4KB0A 4CEOA 3ITHA 5AQZA 4JKEA 4M3TA 1QHTA 4JI2K 3PSFA 3THWB 2P9SB 4CJ7A 3K5NA 2YJFA 3CFPA 3VENA 3SYZA 3GBTA 1X9JA 4OKEA 3SUPA 2HHUA 1RNHA 3J7YP 4Z4IA 4CEEA 4BVOA 4RW9A 3OY9A 3C7NB 2P9LA 3BP8A 5T7BA 5FRNA 1C0GA 3D7EO 4IOAL 4PY5A 1A5XA 2PYLA 3DLRA 2V51B 4E7JA 3O9TA 3TAMA 2E4LA 1JXBA 3U6FA 3DRPA 5GIPA 3CFOA 4BDZA 4DQIA 4DLGA 4LC9B 2ZGYA 4OPHA 4HVJA 2VCPA 2GEMA 3PUFA 4FWMA 3J7ZO 2UXDK 3H3NO 3BDPA 4H4MA 4JI6K 1GOCA 3EE9A 1E3MA 3LPTA 1RT4A 4MQ3A 2WFBA 3AGRA 1YTAA 2IVPA 5M1QA 3SAGA 3WXKA 3LAKA 5JVHL 5TKWA 4YOXA 3VF6A 3O4QA 1WSJA 1BU6O 1N8RO 4DR2K 5ADXA 3QDKA 5A2QO 1VSLA 1XNQK 2D4WA 1HJRA 3AVLA 4Q5VA 2E2PA 4OLBA 3O80A 2W6KA 4DTMA 3G4SN 3JAMO 4RCHA 3ULEB 3JS6A 4Z4EA 5I3UA 2QKKA 4OX9K 2G8IA 4CERA 2QTDA 3DLKA 4CZJA 1KFSA 2B5JA 1WSGA 4HCCA 4CZIA 2YHAA 2PBDA 2NZTA 1XMQK 1ZC6A 3DLEA 4BR5A 4OO1J 3HTVA 5KRTA 4Z4HA 3T69A 2UUAK 4DSKA 4LY7A 4B8CA 1N36K 5CYQA 4KHUA 3DLBA 2KHOA 5CY4A 4FOEA 1YXQA 2RF2A 4A61A 1UA0A 3VMFB 4IDKA 5CE3A 4WFAL 3E1YA 3E66A 3WT0A 4FYDA 3E9OA 4DR4K 4AQYK 2V52B 1ZBIA 3ID8A 4BR7A 4X62K 3QNOA 1RDUA 3ZSWA 2HHTA 3NGZA 2DTUA 3HT3A 1LWEA 3VTHA 4RWTA 4E0DA 3QLHA 4WCEL 5GAEP 3DLGA 3VQ7A 4J8FA 4QS7A 4LF6K 2YNHA 3JXUA 4LF7K 3DXKB 1BL3A 4XH1A 4B3OA 2QI2A 2D0OA 3ZT3A 3CMEN 4DQRA 1RT6A 4WFBL 4GV6A 3ZSOA 4GVEA 4G9ZA 2GWJA 1GLLO 2CH5A 5AQMA 2CGJA 5KGWA 3QEIA 2HMIA 4BY9C 1EQYA 2ZJRL 3CM5A 3C0BA 3M8PA 4ELUA 3ULDA 4H5WA 1VSJA 5JS2A 4CCHA 2Q0RA 3NDKA 1SZ2A 2QKBA 4BG9A 2QK9A 4A59A 5B8HA 2YHBA 2W40A 2NRVA 2ZE2A 3HL8A 4I9LA 3SI6A 5IWAK 3M8RA 1VQ9N 4O5BA 5BN8A 3LP1A 5KQ8A 3EYZA 1RTIA 1TKDA 1HNIA 4NCGA 4FPBA 2HSTA 1IKXA 1RT1A 3AVFA 2H3GX 5C2DA 2YV0X 3CPWM 4JK8A 1SV5A 2NRWA 4LF8K 3SPYA 1HNWK 3CJAA 3DJCA 3KIOA 3VQ8A 4F3OA 1XWLA 3FFIA 2W6LA 1JLGA 4BRQA 4CW7B 4B3RK 4QCLA 4U7BA 4GV3A 3HRGA 2X6SA 2QEXN 4IFYA 2UUBK 3NGIA 3VOVA 4YOWA 2VQFK 4FZYA 3A5MC 2BTFA 1JCEA 4FWPA 3L2UA 3A8YA 5M1OA 3ZSVA 3O3FA 4IXCA 4BRCA 4C8KA 2IVNA 5IT9O 5FLXO 3K5OA 3VF2A 4B1XB 4JNEA 4DQSA 5D3GA 4E7HA 4M63C 3LANA 1T6DA 1BOTO 2YHYA 1VRTA 2YJEA 4J2EA 3O3GA 2QWPA 2V7YA 4JI7K 2HNYA 1T03A 4BQLA 3THXB 5C12A 1KCFA 3CCVN 1FKOA 1NJYA 3FLCO 3C94A 3RSEB 2A6AA 4IO9L 2XY7A 1VSHA 4X64K 2GUIA 1NK7A 4K8XA 3WXIA 3SV4A 2NNWA 2P9NA 3VGKA 3WNGA 3P83D 4CEBA 2HHXA 1KAYA 1YVNA 3ATUA 5LJVA 3H08A 3TAEA 5EX5A 3HP6A 3HK2A 3MXMA 1Q8IA 3WQTA 3K58A 3ZCMA 4NXNK 3O3HA 4C23A 4DU4A 3HI0A 1LOTB 2O8FB 1LW2A 3EZ5A 4KH5A 3ISNC 1NGHA 3CM6A 2JWLA 4I2PA 1E4GT 4FWQA 3ZT0A 1VQ6N 3OTOK 3MCPA 5C2FA 1RT7A 1K8KA 3SNNA 1JLQA 3QEVA 4FJJA 3KKSA 4KREA 1U49A 4W5RA 3ULEA 3MAQA 3SCXA 4DR6K 3G10A 4B1VA 4WFNL 3ZSZA 1Z25A 3C6UA 3KLGA 3I0SA 4CGIA 3CG7A 3HPHA 3LP0A 4LFCK 2G8FA 4CGHA 3E01A 1HKBA 4ELTA 1Z05A 3QBWA 1D5AA 2CGKA 1MDUB 2OYQA 1RT5A 3CIPA 2X74A 3PO4A 4BG8A 2EWSA 3FGUA 1JL2A 4GNIA 1NGEA 3O5BA 3S3OA 3TARA 5BPLA 1L3TA 4K8ZA 4CFBA 3OS1A 3UKUB 4H03B 1T6CA 4B1WB 1XI1A
chains in the Genus database with same CATH topology
5CZ1A 1WSIA 2GV9A 2O4GA 4CJ5A 2PY5A 1VRUA 4DU1A 3OYMA 2BE2A 3VQCA 3HJFA 4M3UA 2D0CA 3D45A 4YFUA 4CEFA 4B9LA 2QK9A 4KO0A 2X78A 4W5OA 4FK4A 5J1EA 3L2VA 1KVCA 4I2QA 4FK2A 1JLBA 1NKEA 4RW8A 1VSMA 3O4NA 3CFRA 1X9WA 2X6NA 4Z0UA 3LZIA 1TK5A 4RW6A 2EX3A 2P5GA 2HHQA 3KK3A 3HM9A 4FLVA 1QSYA 4DTSA 1RBTA 1U47A 3VQDA 4CEDA 4CF0A 4OKKA 3LALA 4LD0A 3SV3A 1B92A 4Y1DA 3OJUA 1WAJA 4UQGA 3QINA 5CYMA 3AA4A 1ZYQA 3RRGA 3QEXA 3V9XA 4DQQA 3V1QA 4HTUA 3HO1A 4DS5A 1QE1A 1HQEA 1QS4A 3DI6A 5KI6A 3VQ4A 4EP4A 4HUEA 2PZSA 4FJHA 4TSXA 4E7IA 4DFMA 1BIZA 2OZMA 4KB1A 3L3VA 3ZSQA 4CJUA 3QERA 1UA1A 2ETJA 3CYMA 3KJVA 1SKWA 4FJ7A 1RDDA 3VN5A 3K5LA 3D0PA 3V9ZA 2HVIA 1TAUA 3QIPA 3TAGA 4KKOA 1QSLA 1QQCA 3NCIA 3RMBA 1MU2A 1NJWA 3PX6A 4H8KA 3LWMA 4FLXA 4ELVA 3HP9A 1RBUA 4E89A 4BE1A 1NK8A 1GOBA 1LW0A 4CHQA 2OA8A 1LAVA 3NH0A 4CJKA 2VG7A 3NGYA 1BHLA 1FKPA 3L2RA 1VSEA 4FZXC 4CGDA 2DY4A 2VWJA 1CXQA 3DRRA 4CHNA 1HNVA 4E3SA 3SPZA 2W42A 1VSKA 4RW4A 3OS0A 3DMJA 3EY1A 4B9SA 5JS1A 2G8VA 1BQMA 2G8KA 3AO3A 2ZQBA 3CQ8A 3IS9A 4CESA 4FM2A 2BGGA 5CZ2A 3V81A 4KI6A 3OYEA 4F4KA 3AO4A 2DFFA 2OPQA 3NFAA 3L2QA 3QEPA 4M45A 4CK2A 4CFDA 4B9UA 3PX4A 3QEWA 1NKCA 4HHTA 5J2QA 3ZSRA 4KB0A 4CF1A 3ITHA 4CEOA 1S1XA 4FJKA 4M3TA 1QHTA 1R0AA 2HW3A 1FK9A 3OVNA 3V9WA 3K5MA 3AVGA 1TK8A 4PQUA 3MEDA 3LZJA 3OYNA 1TKXA 4NCAA 4PUOA 3TAFA 4ID5A 4R5PA 3K5NA 4KHSA 3CFPA 4E7LA 1ZBLA 3SYZA 1S1TA 3VQQA 3WNEA 3VQEA 5KRSA 4FJ9A 4OKEA 1J5OA 3SUPA 2HHUA 1RNHA 2YNIA 4IG0A 4N47A 4CEEA 4Z4IA 4LH5A 4RW9A 4FLTA 3OY9A 1SL1A 4N76A 1TV6A 4KTWA 5FROA 3AV9A 5T7BA 4H4OA 5FRNA 2E6MA 4B9MA 4PY5A 1A5XA 2ZD1A 2PYLA 4J2DA 1HYVA 2HHWA 2Z1GA 1RCHA 3DLRA 1JXEA 2KZZA 4FLYA 4E7JA 1VSDA 5C25A 3TAMA 1W9HA 2E4LA 3HSTB 1JLCA 1JXBA 3K2PA 3MEEA 3VQ5A 4CFCA 4BE0A 3U6FA 3ASMA 3DRPA 3P5JA 3G0ZA 1S1WA 3RMDA 3CFOA 4BDZA 3AVCA 4DQIA 4DLGA 3VQPA 4AHUA 4JS5A 4HUFA 1KVAA 2I5JA 4HVJA 4KTZA 2ATQA 3AO1A 3DRSA 4FXDA 1NOYA 3PUFA 4GVMA 2XO7A 3OYJA 4CF2A 3BGRA 3AA2A 3M8SA 1EETA 1X1PA 4DLEA 3OYCA 4DSIA 1FXXA 1YT3A 1C0TA 2EHGA 3BDPA 4H4MA 4CE9A 1GOCA 4KV8A 3LPTA 2GBZA 3KTQA 1RT4A 4ICLA 1ZBUA 4MQ3A 1NJZA 4MFBA 5SZTA 2JGUA 4FJ8A 1YTAA 2ITGA 3KK1A 1RTDA 4F2SA 4J2BA 1O1WA 3LAKA 4DFJA 1RTJA 4W5NA 4Z4GA 3DLHA 4CJWA 1J54A 4ID1A 4KAZA 4AHVA 3O4QA 1KFDA 4DS4A 1KSPA 3ZSXA 3SQ0A 4C8LA 1CZ9A 1RT3A 1WSJA 4F2RA 3AVMA 1BCOA 1RDAA 1HMVA 4FJMA 2RPIA 2YNFA 3L8BA 4FM1A 1TKZA 1XC9A 3LPUA 2XY6A 1T8EA 4BE2A 1HYZA 3TABA 5FDLA 1VSLA 2DFHA 4FJXA 3B6PA 4O55A 3LDSA 4M42A 4OKJA 3HVTA 1HJRA 3AVLA 2YNGA 4RG8A 3TR8A 4Q5VA 4DTXA 1L5UA 4AILC 4OLBA 4FJNA 3HXMA 1J9AA 1F21A 1TGOA 4FJIA 4DTMA 4CEZA 2OPPA 4CGJA 4DFKA 4Z4EA 1EKEA 1ZBFA 2IAJA 2P1JA 3AO5A 5I3UA 3OYAA 2E6LA 2QKKA 2PYJA 4CERA 4KHYA 2G8IA 4CFAA 2A1SA 3AVNA 4FW2A 1WNSA 2XRIA 3DLKA 3SQ2A 1D9DA 1KFSA 2B5JA 1WSGA 4HCCA 5HRSA 1LWFA 1SL0A 2YHAA 4CHPA 1S6PA 4JRQA 4Z4CA 4AH9A 4M3ZA 2IC3A 4DSEA 3TAPA 4KPYA 3NF7A 2XY8A 5K14A 3DLEA 4IFVA 4O44A 1NKBA 4IBNA 1RDCA 3OYKA 1TK0A 1ASWA 3KLHA 3AVKA 3HPGA 1ASVA 1K6YA 5KRTA 1U04A 4Z4HA 3M8QA 4OLAA 3AA3A 4DSKA 4LY7A 4B8CA 3QIOA 4B08A 5CYQA 1L3SA 2KQ2A 3DLBA 4KHUA 5CY4A 2VG5A 3T1AA 2RF2A 1UA0A 2YKMA 3VQBA 4IDKA 3ZSYA 1Q9XA 5J2MA 4JRPA 2WOMA 4FYDA 4O0IA 2F8TA 1C1BA 4NYFA 1VSIA 3T19A 2Y1IA 3V1OA 3NH2A 1ZBIA 1D8YA 2G8WA 4I9QA 5HRNA 2XHBA 4NYNA 2FBVA 3QNOA 1RTHA 3QNNA 3V9UA 4IKFA 2KZMA 2Q3SA 2LSNA 4CIEA 1NK5A 2YKNA 3VQAA 3AO2A 3ZSWA 4W5QA 1BI4A 3I0RA 5C24A 4Y1CA 1JLAA 1S1VA 1UWBA 5DK5A 2HHTA 3NGZA 3ZT1A 4DF8A 2DTUA 3MECA 3HT3A 1SKRA 1LWEA 3I8DA 3LP2A 4E0DA 3QLHA 4E19A 1Z26A 4KRFA 3DLGA 3F73A 1WAFA 2O4IA 1QSSA 4AHTA 4CECA 3VQ7A 1VSFA 3KLFA 4DU3A 2YNHA 1XHZA 1C0UA 2HVHA 4OGEA 4KHQA 4Q0BA 4M3XA 1S6QA 3KK2A 5HBMA 1BL3A 2DFEA 4O4GA 4BWMA 3ZT3A 3SQ1A 4B8AB 4DQRA 1D9FA 3AA5X 1SUQA 3IAYA 1RT6A 3NF9A 3DOLA 2JLEA 4LSNA 4B9NA 3ZSOA 1S5JA 4FJGA 1BI4B 4C8NA 1W0HA 2A1RA 5HLFA 4HCBA 4DTOA 2KFZA 2HNZA 2OPRA 1A5WA 1HYSA 5KGWA 3QEIA 2HMIA 1NK4A 1GOAA 2BANA 3C95A 2RKIA 2VWKA 1KLNA 2FBTA 3VA3A 3CM5A 3M8PA 5DMRA 4ELUA 3ULDA 3OYLA 4O0JA 4J2AA 1VSJA 4JLHA 4CF8A 4FVMA 4CGGA 1RT2A 1TAQA 2Z1HA 3QO9A 4CHYA 5JS2A 4C8OA 1NJXA 3NBPA 1BIUA 3DOKA 3C6TA 3QESA 4BWJA 4CJFA 4OJRA 4CIFA 4CCHA 3NDKA 4KTQA 3VQ9A 1RBSA 2QKBA 2P5OA 4KI4A 1BISA 1TVRA 1Y97A 1LAWA 4AHCA 3TI0A 2YHBA 1L3VA 3V9SA 1C0MA 2OPSA 4EZ6A 2HHVA 1I39A 2P51A 1SL2A 3TANA 1IH7A 2ZE2A 3L3UA 3NF8A 4B9TA 4Z4FA 4E7KA 3HL8A 2IOCA 4I9LA 3SI6A 5I42A 3M8RA 2R7YA 4O5BA 3SQ4A 3LP1A 4CGFA 3OYHA 4C8MA 3EYZA 4AHSA 3JYTA 1RTIA 1TKDA 1HNIA 1WSFA 3AVIA 4NCGA 1IKXA 4CJLA 1RT1A 3AVFA 2VG6A 3RRHA 1JLEA 2YV0X 4CJVA 4DFPA 1ITGA 2HB5A 4DWIA 1HRHA 2Y1JA 4BDYA 4DG1A 1X9SA 1DLOA 1SV5A 5KGXA 3SPYA 3MEGA 1UOCA 1JL1A 3NH1A 1NK6A 3ZT2A 4ZTJA 4ZHRA 3KIOA 4M3YA 3VQ8A 4DF4A 3NHGA 1XWLA 4F3OA 1ZBHA 3FFIA 1JLGA 2B4JA 4DTRA 2KW4A 5FRMA 4PA1A 4QCLA 1WN7A 2X6SA 3L2WA 1BGXT 3F9KA 1I3AA 4W5TA 4FK0A 4IFYA 2IGIA 2WONA 3NGIA 4OPKA 2KTQA 4FZYA 3KLIA 4IG3A 1T05A 5HRPA 3TWHA 3OYDA 5HROA 3OYIA 1J53A 3L2UA 2D5RA 4QOZB 2D0AA 2FC0A 4KHNA 4ZTFA 1VK0A 3ZSVA 3PO5A 1XHXA 3O3FA 2HNDA 4C8KA 4I7FA 3DYAA 3K5OA 3A2FA 5EU7A 5D3GA 4DQSA 1KRPA 1EX4A 4E7HA 3LANA 1IO2A 3ZT4A 4CEAA 5KTQA 5J2NA 4B3OA 4CJPA 3VQ6A 3KLEA 1U4BA 4CJRA 4N5SA 1LWCA 4DTJA 3JSMA 1VRTA 1NK9A 1Q9YA 1U48A 1TL3A 1EP4A 1S9GA 4FLWA 4OPJA 3WNHA 4J2EA 3O3GA 1JKHA 3P1GA 2HNYA 1T03A 3UIQA 1YTUA 3AVJA 4F3TA 1JLFA 1KCFA 4E1NA 1FKOA 1NJYA 1EXQA 3AVBA 2RN2A 3LP3A 3RR8A 2Z1IA 3C94A 1RBRA 3U3GA 2D0BA 4FLUA 2XY7A 1C1AA 3KD1E 4EZ9A 2HHSA 1VSHA 3IG1A 3OYGA 4BDPA 2GUIA 1NK7A 3PY8A 4K8XA 3PX0A 4CJ4A 2G8HA 3SV4A 3HVRA 4AHRA 4DTNA 4DQPA 3IRXA 4GW6A 3WNGA 1IG9A 1RILA 1WSEA 3P83D 4CEBA 4E1MA 2HHXA 4BACA 1KTQA 4EP5A 4FJ5A 1RBVA 3HPOA 4CK1A 3H08A 2KFNA 3TAEA 1IKWA 3HP6A 3HK2A 1WSHA 4HUGA 1WLJA 3MXMA 4NCBA 1Q8IA 1X9MA 2IDOA 4CEQA 2AJQA 1YVUA 4FCYA 3K58A 3ZCMA 1QTMA 4N41A 4DMNA 1KLMA 4N56A 1G15A 4CJSA 3O3HA 3T3FA 4L8RB 4DU4A 3SZ2A 4CJ3A 1LV5A 5HP1A 4CK3A 3U3YA 1CZBA 1DTQA 3RTVA 1LW2A 3HYFA 3EZ5A 4FLZA 4CHZA 3MXJA 1U45A 4LSLA 4XIUA 3ISNC 4M41A 3CM6A 4I2PA 4QAGA 3SJJA 1DTTA 3NAEA 1IKYA 5J2PA 3ZT0A 3OYBA 4JS4A 4RW7A 4B9VA 4DSJA 2F96A 3KKRA 1BCMA 1N6QA 4FM0A 1RT7A 3K59A 4DTUA 3TAQA 2BDPA 4M3RA 3SNNA 1BQNA 1JLQA 1S9EA 3QEVA 1NOZA 1SKSA 4FJJA 2F8SA 3OYFA 4DSLA 3KKSA 1C1CA 2FBYA 2NUBA 3B6OA 4KFBA 3RMCA 1U49A 4KREA 3THVA 1UAXA 4W5RA 4KHWA 3MAQA 3AVHA 3WNFA 1HPZA 4DSFA 3SCXA 4CHOA 1C6VA 1B9FA 3G10A 3S9HA 2OZSA 4OGCA 3ZSZA 4GMJB 1Z25A 1NK0A 1TL1A 3C6UA 4CJTA 3I0SA 4CGIA 4CF9A 5C42A 3KLGA 4OVLA 3CG7A 3HPHA 3SUQA 2G8UA 2QXFA 3V6DA 1CLQA 4FW1A 1ASUA 3LWLA 3LP0A 4F8RA 4CIGA 1A5VA 2XY5A 1KVBA 3VA0A 1L3UA 3MXIA 4CGHA 2G8FA 3E01A 4PWDA 1IKVA 4ELTA 2Z1JA 3OJSA 1D5AA 3ALYA 4G1QA 1HQUA 1S1UA 2FBXA 3LAMA 3V1RA 3V4IA 2OYQA 1RT5A 5SWMA 2X74A 3K57A 4FZZA 3PO4A 1B9DA 3QETA 3SUOA 4WE1A 3SUNA 4CJEA 4LH4A 3AVAA 1CXUA 4DTPA 4M3WA 3NF6A 1JL2A 4CJQA 3S3OA 1REVA 2IS3A 3PV8A 5HRRA 3RMAA 3TARA 3NE6A 3S3NA 1L3TA 1T7PA 3RR7A 1RDBA 3RWUA 4FJLA 4K8ZA 4CFBA 3DM2A 5E41A 3OS1A 1N5YA 4YNQA 2B6AA 3OS2A 1TKTA 3KD5E 3S3MA 1XI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CZ1 A;  1WSI A;  2GV9 A;  2O4G A;  4CJ5 A;  2PY5 A;  1VRU A;  4DU1 A;  3OYM A;  2BE2 A;  3VQC A;  3HJF A;  4M3U A;  2D0C A;  3D45 A;  4YFU A;  4CEF A;  4B9L A;  2QK9 A;  4KO0 A;  2X78 A;  4W5O A;  4FK4 A;  5J1E A;  3L2V A;  1KVC A;  4I2Q A;  4FK2 A;  1JLB A;  1NKE A;  4RW8 A;  1VSM A;  3O4N A;  3CFR A;  1X9W A;  2X6N A;  4Z0U A;  3LZI A;  1TK5 A;  4RW6 A;  2EX3 A;  2P5G A;  2HHQ A;  3KK3 A;  3HM9 A;  4FLV A;  1QSY A;  4DTS A;  1RBT A;  1U47 A;  3VQD A;  4CED A;  4CF0 A;  4OKK A;  3LAL A;  4LD0 A;  3SV3 A;  1B92 A;  4Y1D A;  3OJU A;  1WAJ A;  4UQG A;  3QIN A;  5CYM A;  3AA4 A;  1ZYQ A;  3RRG A;  3QEX A;  3V9X A;  4DQQ A;  3V1Q A;  4HTU A;  3HO1 A;  4DS5 A;  1QE1 A;  1HQE A;  1QS4 A;  3DI6 A;  5KI6 A;  3VQ4 A;  4EP4 A;  4HUE A;  2PZS A;  4FJH A;  4TSX A;  4E7I A;  4DFM A;  1BIZ A;  2OZM A;  4KB1 A;  3L3V A;  3ZSQ A;  4CJU A;  3QER A;  1UA1 A;  2ETJ A;  3CYM A;  3KJV A;  1SKW A;  4FJ7 A;  1RDD A;  3VN5 A;  3K5L A;  3D0P A;  3V9Z A;  2HVI A;  1TAU A;  3QIP A;  3TAG A;  4KKO A;  1QSL A;  1QQC A;  3NCI A;  3RMB A;  1MU2 A;  1NJW A;  3PX6 A;  4H8K A;  3LWM A;  4FLX A;  4ELV A;  3HP9 A;  1RBU A;  4E89 A;  4BE1 A;  1NK8 A;  1GOB A;  1LW0 A;  4CHQ A;  2OA8 A;  1LAV A;  3NH0 A;  4CJK A;  2VG7 A;  3NGY A;  1BHL A;  1FKP A;  3L2R A;  1VSE A;  4FZX C;  4CGD A;  2DY4 A;  2VWJ A;  1CXQ A;  3DRR A;  4CHN A;  1HNV A;  4E3S A;  3SPZ A;  2W42 A;  1VSK A;  4RW4 A;  3OS0 A;  3DMJ A;  3EY1 A;  4B9S A;  5JS1 A;  2G8V A;  1BQM A;  2G8K A;  3AO3 A;  2ZQB A;  3CQ8 A;  3IS9 A;  4CES A;  4FM2 A;  2BGG A;  5CZ2 A;  3V81 A;  4KI6 A;  3OYE A;  4F4K A;  3AO4 A;  2DFF A;  2OPQ A;  3NFA A;  3L2Q A;  3QEP A;  4M45 A;  4CK2 A;  4CFD A;  4B9U A;  3PX4 A;  3QEW A;  1NKC A;  4HHT A;  5J2Q A;  3ZSR A;  4KB0 A;  4CF1 A;  3ITH A;  4CEO A;  1S1X A;  4FJK A;  4M3T A;  1QHT A;  1R0A A;  2HW3 A;  1FK9 A;  3OVN A;  3V9W A;  3K5M A;  3AVG A;  1TK8 A;  4PQU A;  3MED A;  3LZJ A;  3OYN A;  1TKX A;  4NCA A;  4PUO A;  3TAF A;  4ID5 A;  4R5P A;  3K5N A;  4KHS A;  3CFP A;  4E7L A;  1ZBL A;  3SYZ A;  1S1T A;  3VQQ A;  3WNE A;  3VQE A;  5KRS A;  4FJ9 A;  4OKE A;  1J5O A;  3SUP A;  2HHU A;  1RNH A;  2YNI A;  4IG0 A;  4N47 A;  4CEE A;  4Z4I A;  4LH5 A;  4RW9 A;  4FLT A;  3OY9 A;  1SL1 A;  4N76 A;  1TV6 A;  4KTW A;  5FRO A;  3AV9 A;  5T7B A;  4H4O A;  5FRN A;  2E6M A;  4B9M A;  4PY5 A;  1A5X A;  2ZD1 A;  2PYL A;  4J2D A;  1HYV A;  2HHW A;  2Z1G A;  1RCH A;  3DLR A;  1JXE A;  2KZZ A;  4FLY A;  4E7J A;  1VSD A;  5C25 A;  3TAM A;  1W9H A;  2E4L A;  3HST B;  1JLC A;  1JXB A;  3K2P A;  3MEE A;  3VQ5 A;  4CFC A;  4BE0 A;  3U6F A;  3ASM A;  3DRP A;  3P5J A;  3G0Z A;  1S1W A;  3RMD A;  3CFO A;  4BDZ A;  3AVC A;  4DQI A;  4DLG A;  3VQP A;  4AHU A;  4JS5 A;  4HUF A;  1KVA A;  2I5J A;  4HVJ A;  4KTZ A;  2ATQ A;  3AO1 A;  3DRS A;  4FXD A;  1NOY A;  3PUF A;  4GVM A;  2XO7 A;  3OYJ A;  4CF2 A;  3BGR A;  3AA2 A;  3M8S A;  1EET A;  1X1P A;  4DLE A;  3OYC A;  4DSI A;  1FXX A;  1YT3 A;  1C0T A;  2EHG A;  3BDP A;  4H4M A;  4CE9 A;  1GOC A;  4KV8 A;  3LPT A;  2GBZ A;  3KTQ A;  1RT4 A;  4ICL A;  1ZBU A;  4MQ3 A;  1NJZ A;  4MFB A;  5SZT A;  2JGU A;  4FJ8 A;  1YTA A;  2ITG A;  3KK1 A;  1RTD A;  4F2S A;  4J2B A;  1O1W A;  3LAK A;  4DFJ A;  1RTJ A;  4W5N A;  4Z4G A;  3DLH A;  4CJW A;  1J54 A;  4ID1 A;  4KAZ A;  4AHV A;  3O4Q A;  1KFD A;  4DS4 A;  1KSP A;  3ZSX A;  3SQ0 A;  4C8L A;  1CZ9 A;  1RT3 A;  1WSJ A;  4F2R A;  3AVM A;  1BCO A;  1RDA A;  1HMV A;  4FJM A;  2RPI A;  2YNF A;  3L8B A;  4FM1 A;  1TKZ A;  1XC9 A;  3LPU A;  2XY6 A;  1T8E A;  4BE2 A;  1HYZ A;  3TAB A;  5FDL A;  1VSL A;  2DFH A;  4FJX A;  3B6P A;  4O55 A;  3LDS A;  4M42 A;  4OKJ A;  3HVT A;  1HJR A;  3AVL A;  2YNG A;  4RG8 A;  3TR8 A;  4Q5V A;  4DTX A;  1L5U A;  4AIL C;  4OLB A;  4FJN A;  3HXM A;  1J9A A;  1F21 A;  1TGO A;  4FJI A;  4DTM A;  4CEZ A;  2OPP A;  4CGJ A;  4DFK A;  4Z4E A;  1EKE A;  1ZBF A;  2IAJ A;  2P1J A;  3AO5 A;  5I3U A;  3OYA A;  2E6L A;  2QKK A;  2PYJ A;  4CER A;  4KHY A;  2G8I A;  4CFA A;  2A1S A;  3AVN A;  4FW2 A;  1WNS A;  2XRI A;  3DLK A;  3SQ2 A;  1D9D A;  1KFS A;  2B5J A;  1WSG A;  4HCC A;  5HRS A;  1LWF A;  1SL0 A;  2YHA A;  4CHP A;  1S6P A;  4JRQ A;  4Z4C A;  4AH9 A;  4M3Z A;  2IC3 A;  4DSE A;  3TAP A;  4KPY A;  3NF7 A;  2XY8 A;  5K14 A;  3DLE A;  4IFV A;  4O44 A;  1NKB A;  4IBN A;  1RDC A;  3OYK A;  1TK0 A;  1ASW A;  3KLH A;  3AVK A;  3HPG A;  1ASV A;  1K6Y A;  5KRT A;  1U04 A;  4Z4H A;  3M8Q A;  4OLA A;  3AA3 A;  4DSK A;  4LY7 A;  4B8C A;  3QIO A;  4B08 A;  5CYQ A;  1L3S A;  2KQ2 A;  3DLB A;  4KHU A;  5CY4 A;  2VG5 A;  3T1A A;  2RF2 A;  1UA0 A;  2YKM A;  3VQB A;  4IDK A;  3ZSY A;  1Q9X A;  5J2M A;  4JRP A;  2WOM A;  4FYD A;  4O0I A;  2F8T A;  1C1B A;  4NYF A;  1VSI A;  3T19 A;  2Y1I A;  3V1O A;  3NH2 A;  1ZBI A;  1D8Y A;  2G8W A;  4I9Q A;  5HRN A;  2XHB A;  4NYN A;  2FBV A;  3QNO A;  1RTH A;  3QNN A;  3V9U A;  4IKF A;  2KZM A;  2Q3S A;  2LSN A;  4CIE A;  1NK5 A;  2YKN A;  3VQA A;  3AO2 A;  3ZSW A;  4W5Q A;  1BI4 A;  3I0R A;  5C24 A;  4Y1C A;  1JLA A;  1S1V A;  1UWB A;  5DK5 A;  2HHT A;  3NGZ A;  3ZT1 A;  4DF8 A;  2DTU A;  3MEC A;  3HT3 A;  1SKR A;  1LWE A;  3I8D A;  3LP2 A;  4E0D A;  3QLH A;  4E19 A;  1Z26 A;  4KRF A;  3DLG A;  3F73 A;  1WAF A;  2O4I A;  1QSS A;  4AHT A;  4CEC A;  3VQ7 A;  1VSF A;  3KLF A;  4DU3 A;  2YNH A;  1XHZ A;  1C0U A;  2HVH A;  4OGE A;  4KHQ A;  4Q0B A;  4M3X A;  1S6Q A;  3KK2 A;  5HBM A;  1BL3 A;  2DFE A;  4O4G A;  4BWM A;  3ZT3 A;  3SQ1 A;  4B8A B;  4DQR A;  1D9F A;  3AA5 X;  1SUQ A;  3IAY A;  1RT6 A;  3NF9 A;  3DOL A;  2JLE A;  4LSN A;  4B9N A;  3ZSO A;  1S5J A;  4FJG A;  1BI4 B;  4C8N A;  1W0H A;  2A1R A;  5HLF A;  4HCB A;  4DTO A;  2KFZ A;  2HNZ A;  2OPR A;  1A5W A;  1HYS A;  5KGW A;  3QEI A;  2HMI A;  1NK4 A;  1GOA A;  2BAN A;  3C95 A;  2RKI A;  2VWK A;  1KLN A;  2FBT A;  3VA3 A;  3CM5 A;  3M8P A;  5DMR A;  4ELU A;  3ULD A;  3OYL A;  4O0J A;  4J2A A;  1VSJ A;  4JLH A;  4CF8 A;  4FVM A;  4CGG A;  1RT2 A;  1TAQ A;  2Z1H A;  3QO9 A;  4CHY A;  5JS2 A;  4C8O A;  1NJX A;  3NBP A;  1BIU A;  3DOK A;  3C6T A;  3QES A;  4BWJ A;  4CJF A;  4OJR A;  4CIF A;  4CCH A;  3NDK A;  4KTQ A;  3VQ9 A;  1RBS A;  2QKB A;  2P5O A;  4KI4 A;  1BIS A;  1TVR A;  1Y97 A;  1LAW A;  4AHC A;  3TI0 A;  2YHB A;  1L3V A;  3V9S A;  1C0M A;  2OPS A;  4EZ6 A;  2HHV A;  1I39 A;  2P51 A;  1SL2 A;  3TAN A;  1IH7 A;  2ZE2 A;  3L3U A;  3NF8 A;  4B9T A;  4Z4F A;  4E7K A;  3HL8 A;  2IOC A;  4I9L A;  3SI6 A;  5I42 A;  3M8R A;  2R7Y A;  4O5B A;  3SQ4 A;  3LP1 A;  4CGF A;  3OYH A;  4C8M A;  3EYZ A;  4AHS A;  3JYT A;  1RTI A;  1TKD A;  1HNI A;  1WSF A;  3AVI A;  4NCG A;  1IKX A;  4CJL A;  1RT1 A;  3AVF A;  2VG6 A;  3RRH A;  1JLE A;  2YV0 X;  4CJV A;  4DFP A;  1ITG A;  2HB5 A;  4DWI A;  1HRH A;  2Y1J A;  4BDY A;  4DG1 A;  1X9S A;  1DLO A;  1SV5 A;  5KGX A;  3SPY A;  3MEG A;  1UOC A;  1JL1 A;  3NH1 A;  1NK6 A;  3ZT2 A;  4ZTJ A;  4ZHR A;  3KIO A;  4M3Y A;  3VQ8 A;  4DF4 A;  3NHG A;  1XWL A;  4F3O A;  1ZBH A;  3FFI A;  1JLG A;  2B4J A;  4DTR A;  2KW4 A;  5FRM A;  4PA1 A;  4QCL A;  1WN7 A;  2X6S A;  3L2W A;  1BGX T;  3F9K A;  1I3A A;  4W5T A;  4FK0 A;  4IFY A;  2IGI A;  2WON A;  3NGI A;  4OPK A;  2KTQ A;  4FZY A;  3KLI A;  4IG3 A;  1T05 A;  5HRP A;  3TWH A;  3OYD A;  5HRO A;  3OYI A;  1J53 A;  3L2U A;  2D5R A;  4QOZ B;  2D0A A;  2FC0 A;  4KHN A;  4ZTF A;  1VK0 A;  3ZSV A;  3PO5 A;  1XHX A;  3O3F A;  2HND A;  4C8K A;  4I7F A;  3DYA A;  3K5O A;  3A2F A;  5EU7 A;  5D3G A;  4DQS A;  1KRP A;  1EX4 A;  4E7H A;  3LAN A;  1IO2 A;  3ZT4 A;  4CEA A;  5KTQ A;  5J2N A;  4B3O A;  4CJP A;  3VQ6 A;  3KLE A;  1U4B A;  4CJR A;  4N5S A;  1LWC A;  4DTJ A;  3JSM A;  1VRT A;  1NK9 A;  1Q9Y A;  1U48 A;  1TL3 A;  1EP4 A;  1S9G A;  4FLW A;  4OPJ A;  3WNH A;  4J2E A;  3O3G A;  1JKH A;  3P1G A;  2HNY A;  1T03 A;  3UIQ A;  1YTU A;  3AVJ A;  4F3T A;  1JLF A;  1KCF A;  4E1N A;  1FKO A;  1NJY A;  1EXQ A;  3AVB A;  2RN2 A;  3LP3 A;  3RR8 A;  2Z1I A;  3C94 A;  1RBR A;  3U3G A;  2D0B A;  4FLU A;  2XY7 A;  1C1A A;  3KD1 E;  4EZ9 A;  2HHS A;  1VSH A;  3IG1 A;  3OYG A;  4BDP A;  2GUI A;  1NK7 A;  3PY8 A;  4K8X A;  3PX0 A;  4CJ4 A;  2G8H A;  3SV4 A;  3HVR A;  4AHR A;  4DTN A;  4DQP A;  3IRX A;  4GW6 A;  3WNG A;  1IG9 A;  1RIL A;  1WSE A;  3P83 D;  4CEB A;  4E1M A;  2HHX A;  4BAC A;  1KTQ A;  4EP5 A;  4FJ5 A;  1RBV A;  3HPO A;  4CK1 A;  3H08 A;  2KFN A;  3TAE A;  1IKW A;  3HP6 A;  3HK2 A;  1WSH A;  4HUG A;  1WLJ A;  3MXM A;  4NCB A;  1Q8I A;  1X9M A;  2IDO A;  4CEQ A;  2AJQ A;  1YVU A;  4FCY A;  3K58 A;  3ZCM A;  1QTM A;  4N41 A;  4DMN A;  1KLM A;  4N56 A;  1G15 A;  4CJS A;  3O3H A;  3T3F A;  4L8R B;  4DU4 A;  3SZ2 A;  4CJ3 A;  1LV5 A;  5HP1 A;  4CK3 A;  3U3Y A;  1CZB A;  1DTQ A;  3RTV A;  1LW2 A;  3HYF A;  3EZ5 A;  4FLZ A;  4CHZ A;  3MXJ A;  1U45 A;  4LSL A;  4XIU A;  3ISN C;  4M41 A;  3CM6 A;  4I2P A;  4QAG A;  3SJJ A;  1DTT A;  3NAE A;  1IKY A;  5J2P A;  3ZT0 A;  3OYB A;  4JS4 A;  4RW7 A;  4B9V A;  4DSJ A;  2F96 A;  3KKR A;  1BCM A;  1N6Q A;  4FM0 A;  1RT7 A;  3K59 A;  4DTU A;  3TAQ A;  2BDP A;  4M3R A;  3SNN A;  1BQN A;  1JLQ A;  1S9E A;  3QEV A;  1NOZ A;  1SKS A;  4FJJ A;  2F8S A;  3OYF A;  4DSL A;  3KKS A;  1C1C A;  2FBY A;  2NUB A;  3B6O A;  4KFB A;  3RMC A;  1U49 A;  4KRE A;  3THV A;  1UAX A;  4W5R A;  4KHW A;  3MAQ A;  3AVH A;  3WNF A;  1HPZ A;  4DSF A;  3SCX A;  4CHO A;  1C6V A;  1B9F A;  3G10 A;  3S9H A;  2OZS A;  4OGC A;  3ZSZ A;  4GMJ B;  1Z25 A;  1NK0 A;  1TL1 A;  3C6U A;  4CJT A;  3I0S A;  4CGI A;  4CF9 A;  5C42 A;  3KLG A;  4OVL A;  3CG7 A;  3HPH A;  3SUQ A;  2G8U A;  2QXF A;  3V6D A;  1CLQ A;  4FW1 A;  1ASU A;  3LWL A;  3LP0 A;  4F8R A;  4CIG A;  1A5V A;  2XY5 A;  1KVB A;  3VA0 A;  1L3U A;  3MXI A;  4CGH A;  2G8F A;  3E01 A;  4PWD A;  1IKV A;  4ELT A;  2Z1J A;  3OJS A;  1D5A A;  3ALY A;  4G1Q A;  1HQU A;  1S1U A;  2FBX A;  3LAM A;  3V1R A;  3V4I A;  2OYQ A;  1RT5 A;  5SWM A;  2X74 A;  3K57 A;  4FZZ A;  3PO4 A;  1B9D A;  3QET A;  3SUO A;  4WE1 A;  3SUN A;  4CJE A;  4LH4 A;  3AVA A;  1CXU A;  4DTP A;  4M3W A;  3NF6 A;  1JL2 A;  4CJQ A;  3S3O A;  1REV A;  2IS3 A;  3PV8 A;  5HRR A;  3RMA A;  3TAR A;  3NE6 A;  3S3N A;  1L3T A;  1T7P A;  3RR7 A;  1RDB A;  3RWU A;  4FJL A;  4K8Z A;  4CFB A;  3DM2 A;  5E41 A;  3OS1 A;  1N5Y A;  4YNQ A;  2B6A A;  3OS2 A;  1TKT A;  3KD5 E;  3S3M A;  1XI1 A; 
#chains in the Genus database with same CATH topology
 3J81 O;  2PY5 A;  3OYM A;  2BE2 A;  3M6G A;  3VQC A;  4JI4 K;  2D0C A;  3HSC A;  1IBL K;  4KO0 A;  1QVF M;  4IJN A;  1SS6 A;  1KVC A;  1H1V A;  1SQK A;  1VSM A;  1QZ6 A;  5AQQ A;  4NO7 A;  4JK7 A;  4DTS A;  3VQD A;  1G99 A;  1IJJ A;  1WBD A;  1DGK N;  3SMP A;  4LFA K;  4UQG A;  3QIN A;  5CYM A;  3U8X A;  4ISG A;  4A57 A;  2OTJ N;  4JI8 K;  4K25 A;  2W41 A;  4CZF A;  3BUZ B;  4CJU A;  2ETJ A;  1TAU A;  1ZXO A;  3V9Z A;  3FFK B;  2HVI A;  4KKO A;  1NM1 A;  1QQC A;  2GTD A;  3RMB A;  3THW A;  3LWM A;  4FLX A;  4DUZ K;  3HP9 A;  5TKY A;  5HOO A;  4CHQ A;  1LAV A;  2WBN A;  3J8A A;  4CJK A;  4A5A A;  1BA0 A;  1BHL A;  3L2R A;  2DY4 A;  4CGD A;  1NGI A;  4DV3 K;  3DRR A;  4CHN A;  2W42 A;  4B9S A;  3OS0 A;  4XH4 A;  1WB9 A;  2G8K A;  3AO3 A;  4KI6 A;  4K0K K;  3AO4 A;  2DFF A;  4ILG B;  4CK2 A;  1J6Z A;  1WUA A;  5C15 A;  4FJK A;  3V9W A;  2NRH A;  3K5M A;  4PQU A;  3EEQ A;  3LZJ A;  2OAN A;  3BF1 A;  3VES A;  1TKX A;  4ID5 A;  1ZBL A;  1S1T A;  3WNE A;  3VQE A;  1YAG A;  4JAX A;  3L0Q A;  4LH5 A;  4FLT A;  1TV6 A;  1W97 L;  4MDA A;  1RCH A;  4YOU A;  1VQK N;  2V7Z A;  3M5R A;  1JLC A;  3K2P A;  1Q82 O;  4WQ5 A;  3LDP A;  3P31 A;  1S1W A;  2ZM6 K;  3MX2 A;  3AVC A;  4JS5 A;  4HUF A;  2I5J A;  2HBL A;  4KTZ A;  1OKJ A;  1P90 A;  2ATQ A;  3DRS A;  4X66 K;  1NOY A;  2FXU A;  4CF2 A;  1ATN A;  3AA2 A;  3M8S A;  1NGD A;  1EET A;  3OYC A;  1FXX A;  3BEX A;  3VEY A;  3KK7 A;  4KV8 A;  3OHR A;  2GBZ A;  1HNX K;  4FJ8 A;  4Z94 A;  2ITG A;  3KK1 A;  2QWN A;  4MDB A;  1RTD A;  4F2S A;  4J2B A;  5LL6 Z;  1O1W A;  4DFJ A;  1NU0 A;  3DXM B;  3DLH A;  1J54 A;  4ID1 A;  2QWO A;  1KFD A;  5EY4 A;  5BR9 A;  3ZSX A;  3CCQ N;  4BRM A;  1BA1 A;  2YNF A;  4FM1 A;  2XY6 A;  3LDL A;  1QQO A;  4BE2 A;  4FJX A;  2DFH A;  4O55 A;  4CBU A;  2A5X A;  3FE1 A;  4LF5 K;  3QBX A;  3BF3 A;  1J9A A;  3VEV A;  4FOI A;  1EKE A;  4DSL A;  3CCM N;  2ZJP L;  4KHY A;  4JD2 B;  2A1S A;  1YIT N;  3SQ2 A;  2XRI A;  4FWL A;  2HMP A;  1S6P A;  5EXW A;  4JRQ A;  1OVY A;  2Q1N A;  2XY8 A;  4FWS A;  4O44 A;  4DUY K;  3OYK A;  4FVU A;  1ASW A;  1JCF A;  3AVK A;  4DR7 K;  3ENH A;  5AZJ B;  1HPM A;  1K6Y A;  1U04 A;  3M8Q A;  3AA3 A;  3QIO A;  5EOY A;  1YJ9 N;  4H0T B;  3IDH A;  2Q31 A;  3D2F B;  3ZSY A;  3IUC A;  4QS9 A;  5JLF A;  2WOM A;  3GOI A;  2ITM A;  4O0I A;  4NLC A;  3PSI A;  3VER A;  5KPR A;  3NH2 A;  2VGN A;  1NGC A;  2E2Q A;  2G8W A;  4I9Q A;  2QWM A;  3MMV A;  2FBV A;  3V9U A;  3QFU A;  2Q3S A;  1BDG A;  1BI4 A;  1S1V A;  3N4Q A;  4E19 A;  1Z26 A;  3CCU N;  3F73 A;  1QSS A;  4AHT A;  1VSF A;  3KLF A;  4DU3 A;  4F9O A;  1S6Q A;  3KK2 A;  5HBM A;  4WF9 L;  2DFE A;  4BWM A;  3SQ1 A;  4B8A B;  1LCU A;  1SUQ A;  3O08 A;  4FJG A;  3TTF A;  3CC2 N;  1W0H A;  2A1R A;  4HCB A;  4NLB A;  4DTO A;  2HNZ A;  1A5W A;  3G6E N;  1HYS A;  4IEE A;  2J4R A;  4BRE A;  1GOA A;  2VWK A;  1KLN A;  2FBT A;  3VA3 A;  5DMR A;  3N4P A;  3OYL A;  4JLH A;  1VQO N;  1RT2 A;  2Z1H A;  3T7Z A;  1NJX A;  3NBP A;  1BIU A;  3GL1 A;  3QES A;  2FSN A;  1EWR A;  3HOT A;  3AAP A;  2P5O A;  4KI4 A;  1RFQ A;  1TVR A;  4AHC A;  1C0M A;  1I39 A;  4B9T A;  4E7K A;  5I42 A;  1HLU A;  1OH5 A;  4CGF A;  5BRE A;  3OYH A;  4DR5 K;  3KWG A;  4PKI A;  3LDN A;  3AVI A;  3TPQ A;  5F0X A;  2VG6 A;  3RRH A;  4DFP A;  2HB5 A;  3SBT A;  3CMA N;  4BDY A;  3FZK A;  4DV2 K;  1DLO A;  5BPM A;  3EN9 A;  1UOC A;  1NBW A;  1NK6 A;  3ZT2 A;  4ZHR A;  2HF3 A;  4ISE A;  4M3Y A;  4DF4 A;  1ZBH A;  3SAF A;  2B4J A;  1VQ4 N;  4PA1 A;  3H45 C;  1V4T A;  1WN7 A;  2E5L K;  2FF6 A;  1I3A A;  3MN9 A;  4A62 A;  2AA4 A;  4WQ4 A;  3KLI A;  2P9S A;  4BR2 A;  1T05 A;  3TWH A;  1KD1 O;  5HRO A;  1Q81 O;  1K73 O;  1J53 A;  4KHN A;  5C0Y A;  1XHX A;  5JMV A;  3DYA A;  5EU7 A;  1KRP A;  1J5E K;  3CI5 A;  5KTQ A;  5J2N A;  4CJP A;  3KLE A;  1U4B A;  4N5S A;  3ZX0 A;  4DTJ A;  1Q9Y A;  1C0F A;  4FLW A;  4B3T K;  4OPJ A;  4DV0 K;  3GE1 A;  4R79 A;  1YTU A;  4OPA A;  3ZX2 A;  2BUP A;  4E1N A;  3AVB A;  3LP3 A;  5M1K A;  2O8D A;  2HHS A;  1C1A A;  4EZ9 A;  2QWQ A;  5CHI A;  3PX0 A;  4CJ4 A;  2G8H A;  3CCR N;  5AQT A;  3IRX A;  4GW6 A;  1IG9 A;  4H5V A;  5KPT A;  1WSE A;  2P9K B;  1RBV A;  4IZ9 A;  3EKS A;  1IKW A;  4DCH A;  1WSH A;  2P9I A;  4HUG A;  1WLJ A;  4DR1 K;  1X9M A;  4CEQ A;  5E26 A;  3R3L A;  4YOR A;  1YVU A;  5AQX A;  4N41 A;  4RTF D;  4DMN A;  4EAH D;  1G15 A;  4BR9 A;  3SZ2 A;  2ZGZ A;  4CJ3 A;  5HP1 A;  4CK3 A;  3C65 A;  4BR0 A;  3HYF A;  4PHT X;  4FLZ A;  3RTV A;  2O8E A;  4LSL A;  3CHW A;  3SJJ A;  2ASP A;  3NAE A;  3CCL N;  1IKY A;  1U2V B;  3SK3 A;  5M1F A;  4B9V A;  2F96 A;  3EKU A;  1DEJ A;  3KKR A;  4JKG B;  1N6Q A;  1NLV A;  4M7Y A;  2BDP A;  1BQN A;  1NJI O;  1NOZ A;  4CVN E;  2F8S A;  1C1C A;  1HUX A;  3RMC A;  4KFB A;  1UAX A;  3MCA B;  4ILH A;  1GLD G;  1S22 A;  3CJC A;  3F5T A;  3WNF A;  1HPZ A;  3WQU A;  4DSF A;  3O6W A;  2OZS A;  3S9H A;  1NK0 A;  4CJT A;  4JYA K;  2G8U A;  3WXL A;  2O8C A;  1KVB A;  2NRZ A;  1N32 K;  3MXI A;  2O8B A;  1MA9 B;  4EHU A;  3ENB A;  3L6Q A;  2GEL A;  3FZH A;  3K57 A;  2YCH A;  3QET A;  1VQP N;  1IV0 A;  1REV A;  3PV8 A;  3NE6 A;  1N5Y A;  3W0L A;  2B6A A;  1M90 O;  1TYQ B;  5CZ1 A;  4PKH A;  2HBM A;  4CJ5 A;  4JV5 K;  3VGL A;  4M3U A;  5AQV A;  4YFU A;  2X78 A;  4H5R A;  2A40 A;  4W5O A;  4I2Q A;  1BWF O;  5AZJ A;  4RW8 A;  2X6N A;  3LZI A;  2HHQ A;  4RW6 A;  3KK3 A;  1YJN N;  4MO5 A;  4CED A;  4OKK A;  3LAL A;  3SV3 A;  2NLX A;  3EO3 A;  4XEI A;  1EO1 A;  3G71 N;  4JI1 K;  3B8A X;  3U9Z A;  4JKH A;  3SLC A;  4DS5 A;  1QE1 A;  3VQ4 A;  4NXM K;  4E7I A;  1NGF A;  5C10 A;  1RDD A;  3TAG A;  1QSL A;  1NJW A;  3PX6 A;  1K8A O;  3LM9 A;  2OA8 A;  1MWM A;  2VWJ A;  1JJ2 M;  1CXQ A;  4BVP A;  1VSK A;  4RW4 A;  3DMJ A;  5JS1 A;  3IS9 A;  5AFU H;  3V81 A;  2OPQ A;  3DXM A;  1OH8 A;  4M45 A;  5ADX H;  2Q36 A;  2AP1 A;  1NKC A;  3TU5 A;  4DV7 K;  4KH6 A;  3TSQ A;  1S1X A;  3CF5 L;  4K42 A;  3OVN A;  3AVG A;  5AQL A;  3MED A;  3OYN A;  4PUO A;  3TAF A;  4R5P A;  4KHS A;  5I9E B;  1IG8 A;  4E7L A;  3VQQ A;  2HBJ A;  5KRS A;  1HNZ K;  2D0P A;  1Y64 A;  4N47 A;  2UXB K;  2YX6 A;  4IEI A;  4B1Y B;  4N76 A;  4CZL A;  5FRO A;  4YDU C;  4H4O A;  2O8E B;  2HBK A;  2ZD1 A;  4BRI A;  2Z1G A;  1JXE A;  1ATS A;  4FLY A;  2KZZ A;  3TTC A;  3S41 A;  1VSD A;  4HWI A;  5AQY A;  5C25 A;  4B3S K;  2VYP A;  3MEE A;  3VQ5 A;  5GIO A;  3G0Z A;  3FR0 A;  4A5B A;  3RMD A;  2YHX A;  1MWK A;  1KVA A;  3U4L A;  3AO1 A;  4FXD A;  3CET A;  4DV5 K;  1XUP O;  2XO7 A;  3OYJ A;  3F2K A;  1HJO A;  4JKA A;  3HZ6 A;  4X65 K;  4FO0 A;  1YT3 A;  1C0T A;  2E8A A;  2EHG A;  4CE9 A;  3FZM A;  1I94 K;  1ZBU A;  2JGU A;  3T1H K;  4H5N A;  1HR0 K;  4BRG A;  4YDU A;  4W5N A;  4CJW A;  4KAZ A;  4AHV A;  5LJW A;  1KSP A;  4DKW A;  1TUU A;  3SQ0 A;  4C8L A;  3ZEU B;  1CZ9 A;  1NGA A;  1RT3 A;  4EFH A;  3AVM A;  4F2R A;  1RDA A;  4FJM A;  3BY5 A;  2P9P A;  3SAH A;  3L8B A;  1TKZ A;  3UB5 A;  1T8E A;  2CH6 A;  3H1Q A;  3P39 A;  3B6P A;  4FWK A;  1S3X A;  3HVT A;  2YNG A;  4RG8 A;  2FSJ A;  3TR8 A;  1L5U A;  2CGL A;  4AIL C;  1F21 A;  4CGJ A;  4DFK A;  3ZX3 A;  1ZBF A;  2IAJ A;  2KKZ A;  2P1J A;  3OYA A;  3C6H A;  4DV6 K;  4GKJ K;  4CFA A;  4BC4 A;  1QZ5 A;  3AVN A;  1WNS A;  4JKD A;  1D9D A;  1W7A A;  1N33 K;  1YUW A;  1LWF A;  3DLL L;  4M3Z A;  4AH9 A;  3TAP A;  4KPY A;  3NF7 A;  3P38 A;  4GV9 A;  1NKB A;  1TK0 A;  1RDC A;  3KLH A;  5AQG A;  1NMN A;  3R6M A;  4B08 A;  2KQ2 A;  4Y0W A;  4CI6 A;  3T1A A;  5AQO A;  1Q9X A;  5J2M A;  3RVC A;  2P9U B;  3T19 A;  4NYF A;  2Y1I A;  3V1O A;  1FW6 A;  1D8Y A;  3L4I A;  3CJB A;  2XHB A;  2I7P A;  2OTL N;  4DQ8 A;  1RTH A;  2KZM A;  4IKF A;  3DAW A;  4CIE A;  3AO2 A;  5BN9 A;  4W5Q A;  4Y1C A;  1UWB A;  3QIC A;  5DK5 A;  4JKB A;  3ZT1 A;  3MEC A;  3VTI A;  3CJ9 A;  3LP2 A;  4BGB A;  3Q7B A;  1ILY A;  3CXC M;  3C6A A;  4KRF A;  1WAF A;  1Q86 O;  4EHT A;  2BH1 A;  3P4I A;  1XHZ A;  4M3X A;  1RDW X;  5JVG L;  1YI2 N;  3DOL A;  2JLE A;  4C1N I;  4B9N A;  1S5J A;  1BI4 B;  3O1W A;  3EL2 A;  4C8N A;  3THY A;  3GG4 A;  2KFZ A;  2OPR A;  4IOX A;  5AR0 A;  1K8K B;  3C95 A;  4FL9 A;  4O0J A;  4J2A A;  4CF8 A;  3OYB A;  4CHY A;  3QO9 A;  3NVM A;  4JK9 A;  4JKF A;  4BWJ A;  4OJR A;  4CJF A;  4CIF A;  1NNE A;  1VQ7 N;  1RBS A;  3VGM A;  1BIS A;  3TI0 A;  1L3V A;  3OA9 A;  4K43 A;  3D2F A;  2QWL A;  3I33 A;  3TAN A;  1IH7 A;  4Z4F A;  3D6R A;  5AQJ A;  4CBX A;  4IJA A;  2QW9 A;  4AHS A;  5HL7 L;  4HTL A;  1WSF A;  5EVZ A;  3CC4 N;  3CJ7 A;  1JLE A;  4CJV A;  1ITG A;  1HRH A;  3AAR A;  1X9S A;  5KGX A;  1R59 O;  3O4W A;  3MEG A;  3NH1 A;  2P9N B;  3KZB A;  3J80 O;  2KW4 A;  1QQM A;  2Q97 A;  3L2W A;  3F9K A;  3BZC A;  3THX A;  2IGI A;  3CER A;  4OPK A;  2KTQ A;  1VAZ A;  3CQY A;  4BC5 A;  3QML A;  3THY B;  3BZK A;  3OYI A;  5F1X A;  3MK6 A;  3O9Q A;  4BRD A;  2D5R A;  2FC0 A;  4ZTF A;  3PO5 A;  3SMS A;  2HND A;  3A2F A;  5AQU A;  3ZT4 A;  1IO2 A;  4CEA A;  3VQ6 A;  4CJR A;  4WQ5 C;  1LWC A;  1NK9 A;  1EP4 A;  1JKH A;  5GAH P;  3I55 N;  3M1F A;  3AVJ A;  4F3T A;  4YHH K;  3RR8 A;  2Z1I A;  5FPM A;  3AY9 A;  2D0B A;  2VWB A;  4FLU A;  2F9W A;  3IG1 A;  4BDP A;  3EE8 A;  3PIO L;  4AHR A;  4DTN A;  4DQP A;  5FPN A;  1OH7 A;  4BRO A;  4E1M A;  4BQZ A;  1KTQ A;  2UU9 K;  3NVK A;  1NGB A;  2F4V K;  2NRT A;  2AJQ A;  4FCY A;  3R8E A;  4BRN A;  4N56 A;  2YHW A;  5AQF A;  4L8R B;  3ZLJ A;  1QHA A;  3U3Y A;  1CZB A;  4IOC L;  4CHZ A;  1U45 A;  4FWN A;  4XIU A;  4M41 A;  1BUP A;  1X3N A;  4QAG A;  4RW7 A;  2PFU A;  1IBK K;  1BCM A;  3K59 A;  4DTU A;  3WXM B;  3TAQ A;  5AQS A;  1SKS A;  3I8B A;  1HX1 A;  2NUB A;  4MLE A;  3THV A;  1Z6R A;  4JEP A;  1ZBS A;  1C6V A;  3AAQ A;  3Q7C A;  2UUC K;  1TL1 A;  4CF9 A;  4DV1 K;  1FJG K;  2E1Y A;  3SUQ A;  3V6D A;  3CPE A;  2A3Z A;  4M7X A;  2XY5 A;  2P9P B;  3VA0 A;  1L3U A;  3R9P A;  1QQN A;  3ZEU A;  2Z1J A;  3K9K A;  4B9Q A;  3OJS A;  4H0V B;  1GLE G;  4G1Q A;  4KHP K;  1S1U A;  2FBX A;  3LAM A;  3FZF A;  4FSV A;  3V1R A;  3VET A;  2WC9 A;  4FZZ A;  3OBY A;  4WE1 A;  3SUN A;  3AVA A;  1CXU A;  5HRR A;  3RMA A;  4M42 A;  1O13 A;  1RDB A;  2WTU A;  1M1K O;  4YNQ A;  3FZL A;  3WXJ A;  4LF4 K;  1WSI A;  2GV9 A;  2O4G A;  1ATR A;  3O9U A;  3D45 A;  4B9L A;  4CEF A;  4FK4 A;  4JI0 K;  5J1E A;  5DM6 L;  1JLB A;  4LF9 K;  1NKE A;  1HKG A;  1V4S A;  3O4N A;  1Q7Y O;  4CZE A;  3ATV A;  2EX3 A;  3K9J A;  3HM9 A;  4BC3 A;  4IDH A;  4CF0 A;  4LD0 A;  1HKC A;  4Y1D A;  3OJU A;  5LMU K;  5BRD A;  4H0P A;  4JI5 K;  3RRG A;  3MN5 A;  3V9X A;  3QEX A;  4DQQ A;  3HO1 A;  1BO5 O;  1HQE A;  1QS4 A;  3KVG A;  3A5N C;  4DFM A;  2JWK A;  5F2R A;  4PL8 A;  3L3V A;  3ZSQ A;  4FWR A;  3UKU A;  5GAD P;  3CYM A;  4FJ7 A;  3K5L A;  3QIP A;  3L4Q A;  3NCI A;  4DV4 K;  1MU2 A;  2E2O A;  2HW3 A;  4ELV A;  4E89 A;  1RBU A;  4BE1 A;  1LW0 A;  3NH0 A;  3M3Z A;  3NGY A;  1FKP A;  1VSE A;  4FZX C;  3OBW A;  4JI3 K;  4E3S A;  2IVO A;  4O8U A;  2G8V A;  2ZQB A;  3T1Y K;  4CES A;  2BGG A;  4EIA A;  5CZ2 A;  3O1B A;  3L2Q A;  3QEP A;  2QM1 A;  4CFD A;  4NB4 A;  4AM7 A;  4BR4 A;  3ZSR A;  4CF1 A;  2ASO A;  3CD6 N;  1R0A A;  1FK9 A;  1WOQ A;  1VQ5 N;  1TK8 A;  1D4X A;  3PLA A;  3CCE N;  4NCA A;  3H3O B;  4WYB A;  4FJ9 A;  1YHQ N;  1J5O A;  3LM2 A;  2ZWH A;  1GLJ O;  4CZM A;  2YNI A;  3VEX A;  4IG0 A;  1SL1 A;  4JN4 A;  1P8Z A;  5DM7 L;  4KTW A;  3AV9 A;  4BRA A;  2E6M A;  4B9M A;  3MN6 A;  3R1X A;  2QWR A;  4J2D A;  2O8F A;  1HYV A;  1CZA N;  1YF5 L;  2GWK A;  1OVQ A;  1W9H A;  3HST B;  2P9L B;  4CFC A;  4BE0 A;  4QS8 A;  3ASM A;  3C7N A;  3P5J A;  1XMO K;  3LL3 A;  3TSU A;  2DPN A;  2ZF5 O;  4CZH A;  1T3V A;  3VQP A;  4AHU A;  5MLC Q;  2A42 A;  4GVM A;  1TYQ A;  3BGR A;  4MLH A;  4WQ4 C;  1X1P A;  4DLE A;  4DSI A;  4BGA A;  3KTQ A;  4DB3 A;  3ID6 A;  4ICL A;  1NJZ A;  4MFB A;  3RSE A;  5SZT A;  2QA4 N;  1GLC G;  1RTJ A;  4Z4G A;  2F7T A;  4PKG A;  3UE5 A;  4BRF A;  4DS4 A;  2GX9 A;  3CJ1 A;  1BCO A;  2E1Z A;  1HMV A;  5LMN K;  2RPI A;  2O8C B;  1XC9 A;  3LPU A;  5M1P A;  1HYZ A;  5CR4 A;  1X3M A;  3TAB A;  1YIJ N;  5AQP A;  5FDL A;  5AJ3 K;  4A2A A;  3LDS A;  4OKJ A;  3QB0 A;  4KH4 A;  4DTX A;  3ZET A;  2RHK A;  3H6E A;  4FJN A;  4UY8 O;  3HXM A;  1TGO A;  4FJI A;  2UXC K;  2A41 A;  4CEZ A;  4BRK A;  2OPP A;  3AO5 A;  2PYJ A;  2E6L A;  3O8M A;  4ISF A;  3I56 N;  4H0O A;  2PAV A;  4FW2 A;  4IFE A;  4XH5 A;  4JKG A;  4A2B A;  5JLH A;  3A5O C;  5HRS A;  1NWK A;  2P9U A;  1SL0 A;  2HF4 A;  4B3M K;  4CHP A;  3J7A P;  4Z4C A;  2IC3 A;  4DSE A;  1N34 K;  2GUP A;  5K14 A;  4IFV A;  4IBN A;  2KLA A;  1NMD A;  2IIR A;  3HPG A;  1ASV A;  4OLA A;  3K0S A;  5AQI A;  3MWP A;  3LDQ A;  1L3S A;  4YOV A;  2VG5 A;  2P9I B;  3VEZ A;  4BRP A;  2YKM A;  3VQB A;  2YI1 A;  3NMU A;  4JRP A;  2P9K A;  3G25 A;  3W3D A;  1S72 N;  1C1B A;  1VSI A;  2RE2 A;  1NGG A;  1NG9 A;  4GY2 B;  3D2E B;  4DR3 K;  3WEE A;  1W2B M;  5HRN A;  4NYN A;  1KAX A;  3QNN A;  1T44 A;  2LSN A;  1NK5 A;  1U6Z A;  2YKN A;  3VQA A;  4E1J A;  3I0R A;  5C24 A;  1JLA A;  4DF8 A;  1SKR A;  3DXK A;  3I8D A;  4FWO A;  3IKM A;  2O4I A;  2Q0U A;  2I7N A;  4CEC A;  2HVH A;  1C0U A;  4OGE A;  4KHQ A;  4Q0B A;  1XC3 A;  5AQR A;  4O4G A;  1D9F A;  1VHX A;  4KBO A;  3AA5 X;  3IAY A;  5BPN A;  3NF9 A;  4LSN A;  2HHW A;  3VEO A;  4GKK K;  5HLF A;  1IBM K;  2F9T A;  1EWQ A;  1NK4 A;  2BAN A;  2RKI A;  1VQN N;  3IFR A;  5ELZ A;  3KHY A;  3TSP A;  4FVM A;  4CGG A;  2ZJQ L;  1TAQ A;  2E88 A;  4C8O A;  3DOK A;  3C6T A;  4KTQ A;  2VGM A;  3VQ9 A;  4BRH A;  5KQD A;  1Y97 A;  2F8T A;  1LAW A;  4I6M A;  4EZ6 A;  3V9S A;  2OPS A;  2HHV A;  3VPZ A;  2P51 A;  1QVG M;  1SL2 A;  3L3U A;  3NF8 A;  4V19 S;  2IOC A;  5M1N A;  2QXL A;  2R7Y A;  3SQ4 A;  4C8M A;  3JYT A;  3O9S A;  2HHH K;  4CJL A;  5BR8 K;  4MO4 A;  2FLO A;  3QFP A;  5JIC A;  4DWI A;  2Y1J A;  3SJH A;  4DG1 A;  4C1N K;  3PIP L;  1JL1 A;  4ZTJ A;  4FPA A;  3NHG A;  4CZK A;  3WUH A;  4AM6 A;  4DTR A;  5FRM A;  4YOY A;  3IMX A;  1BGX T;  4FK0 A;  4W5T A;  2E20 A;  2WON A;  4IG3 A;  5HRP A;  3OYD A;  3HBT A;  4O8K A;  1XQS C;  4QOZ B;  2D0A A;  1VK0 A;  2NRR A;  4I7F A;  2FSK A;  1EX4 A;  3GDQ A;  4YOT A;  3JSM A;  2OCE A;  1TL3 A;  1U48 A;  1S9G A;  5AQH A;  3WNH A;  1E4F T;  3P1G A;  4L3Q A;  4U67 L;  3UIQ A;  1JLF A;  1EXQ A;  2RN2 A;  2NRX A;  4LFB K;  4ILJ A;  1RBR A;  3H46 O;  3U3G A;  3KD1 E;  3TTD A;  3OYG A;  3PY8 A;  3H1V X;  3HVR A;  3HM8 A;  3O9R A;  1RIL A;  1GLA G;  3EZW A;  2VQE K;  4BAC A;  2E2N A;  4EP5 A;  5AQK A;  4BC2 A;  3CQX A;  3HPO A;  4FJ5 A;  4CK1 A;  2KFN A;  2HOE A;  4CD3 A;  2IDO A;  5LY3 A;  4IWV A;  1VQ8 N;  1QTM A;  3CC7 N;  1KLM A;  4CJS A;  3T3F A;  4DHY A;  1LV5 A;  4BRL A;  1DTQ A;  1JCG A;  2ASM A;  5KPZ A;  4I6M B;  3U9D A;  3MXJ A;  3DWL A;  3SBG A;  3HOS A;  4CZG A;  1DTT A;  1KQS M;  5J2P A;  4JS4 A;  4PL7 A;  5E84 A;  4DSJ A;  1OH6 A;  1BG3 A;  4FM0 A;  4M3R A;  3VF4 A;  4JD2 A;  1S9E A;  3OYF A;  2FBY A;  3B6O A;  1VQL N;  4KHW A;  4IO8 A;  3AVH A;  3A5L C;  1SAZ A;  4CHO A;  1B9F A;  3MWT A;  4OGC A;  4GMJ B;  4B1Z A;  5C42 A;  4OVL A;  1KC8 O;  2QXF A;  1CLQ A;  5GIN A;  4FW1 A;  1ASU A;  3LWL A;  4F8R A;  3ZYY X;  3UKR A;  1A5V A;  4CIG A;  2O8B B;  1IKV A;  1DKG D;  1GLB G;  3OW2 M;  3CCJ N;  3ALY A;  1HQU A;  4K41 A;  3F9M A;  1YJW N;  3V4I A;  1ESV A;  4JHD B;  5AZI B;  5SWM A;  1B9D A;  3WEE B;  3SUO A;  5GAG P;  4CJE A;  4LH4 A;  3D2E A;  4M3W A;  4DTP A;  3NF6 A;  4H5T A;  4CJQ A;  2IS3 A;  1T7P A;  3S3N A;  3RR7 A;  4CD1 A;  3RWU A;  4FJL A;  5E41 A;  3DM2 A;  3CCS N;  3OS2 A;  1TKT A;  3KD5 E;  3S3M A;  4JKC A;  1VRU A;  4DU1 A;  3HJF A;  4O5F A;  1U2V A;  4H0Y B;  5BRF A;  3L2V A;  1K9M O;  4YY3 K;  4FK2 A;  3KWI A;  4CBW A;  1RGI A;  4AF1 A;  1DT9 A;  3CFR A;  5AFU A;  1X9W A;  1VQM N;  4Z0U A;  1TK5 A;  2P5G A;  3A0I X;  3LDO A;  4FLV A;  1QSY A;  1RBT A;  2FF3 B;  1U47 A;  1B92 A;  5AQN A;  1KXP A;  1WAJ A;  1ZYQ A;  3AA4 A;  1XNR K;  3V1Q A;  4HTU A;  1GLF O;  3E9L A;  5KI6 A;  3DI6 A;  4EP4 A;  2PZS A;  4HUE A;  4FJH A;  4TSX A;  2OZM A;  4KB1 A;  1BIZ A;  4B1U B;  1UA1 A;  2Q2R A;  3QER A;  3KJV A;  1SKW A;  3VN5 A;  3D0P A;  3E9P A;  5BRH A;  3MX5 A;  4NCB A;  4PWD A;  4H8K A;  1NK8 A;  3ZET B;  1GOB A;  2D1K A;  4H0X B;  1Q18 A;  5FPE A;  1NGJ A;  2VG7 A;  2O8D B;  4JHD A;  5AZI A;  5AQW A;  5H1S Q;  1HNV A;  3SPZ A;  3EY1 A;  1BQM A;  1WBB A;  3VEW A;  3CQ8 A;  4FM2 A;  3UKR B;  3MDQ A;  3OYE A;  4F4K A;  3ENO A;  3NFA A;  2WUS A;  3MN7 A;  4B9U A;  5FPD A;  1KAZ A;  3PX4 A;  3AGK A;  1TUY A;  3QEW A;  2UYT A;  4HHT A;  5J2Q A;  4KB0 A;  4CEO A;  3ITH A;  5AQZ A;  4JKE A;  4M3T A;  1QHT A;  4JI2 K;  3PSF A;  3THW B;  2P9S B;  4CJ7 A;  3K5N A;  2YJF A;  3CFP A;  3VEN A;  3SYZ A;  3GBT A;  1X9J A;  4OKE A;  3SUP A;  2HHU A;  1RNH A;  3J7Y P;  4Z4I A;  4CEE A;  4BVO A;  4RW9 A;  3OY9 A;  3C7N B;  2P9L A;  3BP8 A;  5T7B A;  5FRN A;  1C0G A;  3D7E O;  4IOA L;  4PY5 A;  1A5X A;  2PYL A;  3DLR A;  2V51 B;  4E7J A;  3O9T A;  3TAM A;  2E4L A;  1JXB A;  3U6F A;  3DRP A;  5GIP A;  3CFO A;  4BDZ A;  4DQI A;  4DLG A;  4LC9 B;  2ZGY A;  4OPH A;  4HVJ A;  2VCP A;  2GEM A;  3PUF A;  4FWM A;  3J7Z O;  2UXD K;  3H3N O;  3BDP A;  4H4M A;  4JI6 K;  1GOC A;  3EE9 A;  1E3M A;  3LPT A;  1RT4 A;  4MQ3 A;  2WFB A;  3AGR A;  1YTA A;  2IVP A;  5M1Q A;  3SAG A;  3WXK A;  3LAK A;  5JVH L;  5TKW A;  4YOX A;  3VF6 A;  3O4Q A;  1WSJ A;  1BU6 O;  1N8R O;  4DR2 K;  5ADX A;  3QDK A;  5A2Q O;  1VSL A;  1XNQ K;  2D4W A;  1HJR A;  3AVL A;  4Q5V A;  2E2P A;  4OLB A;  3O80 A;  2W6K A;  4DTM A;  3G4S N;  3JAM O;  4RCH A;  3ULE B;  3JS6 A;  4Z4E A;  5I3U A;  2QKK A;  4OX9 K;  2G8I A;  4CER A;  2QTD A;  3DLK A;  4CZJ A;  1KFS A;  2B5J A;  1WSG A;  4HCC A;  4CZI A;  2YHA A;  2PBD A;  2NZT A;  1XMQ K;  1ZC6 A;  3DLE A;  4BR5 A;  4OO1 J;  3HTV A;  5KRT A;  4Z4H A;  3T69 A;  2UUA K;  4DSK A;  4LY7 A;  4B8C A;  1N36 K;  5CYQ A;  4KHU A;  3DLB A;  2KHO A;  5CY4 A;  4FOE A;  1YXQ A;  2RF2 A;  4A61 A;  1UA0 A;  3VMF B;  4IDK A;  5CE3 A;  4WFA L;  3E1Y A;  3E66 A;  3WT0 A;  4FYD A;  3E9O A;  4DR4 K;  4AQY K;  2V52 B;  1ZBI A;  3ID8 A;  4BR7 A;  4X62 K;  3QNO A;  1RDU A;  3ZSW A;  2HHT A;  3NGZ A;  2DTU A;  3HT3 A;  1LWE A;  3VTH A;  4RWT A;  4E0D A;  3QLH A;  4WCE L;  5GAE P;  3DLG A;  3VQ7 A;  4J8F A;  4QS7 A;  4LF6 K;  2YNH A;  3JXU A;  4LF7 K;  3DXK B;  1BL3 A;  4XH1 A;  4B3O A;  2QI2 A;  2D0O A;  3ZT3 A;  3CME N;  4DQR A;  1RT6 A;  4WFB L;  4GV6 A;  3ZSO A;  4GVE A;  4G9Z A;  2GWJ A;  1GLL O;  2CH5 A;  5AQM A;  2CGJ A;  5KGW A;  3QEI A;  2HMI A;  4BY9 C;  1EQY A;  2ZJR L;  3CM5 A;  3C0B A;  3M8P A;  4ELU A;  3ULD A;  4H5W A;  1VSJ A;  5JS2 A;  4CCH A;  2Q0R A;  3NDK A;  1SZ2 A;  2QKB A;  4BG9 A;  2QK9 A;  4A59 A;  5B8H A;  2YHB A;  2W40 A;  2NRV A;  2ZE2 A;  3HL8 A;  4I9L A;  3SI6 A;  5IWA K;  3M8R A;  1VQ9 N;  4O5B A;  5BN8 A;  3LP1 A;  5KQ8 A;  3EYZ A;  1RTI A;  1TKD A;  1HNI A;  4NCG A;  4FPB A;  2HST A;  1IKX A;  1RT1 A;  3AVF A;  2H3G X;  5C2D A;  2YV0 X;  3CPW M;  4JK8 A;  1SV5 A;  2NRW A;  4LF8 K;  3SPY A;  1HNW K;  3CJA A;  3DJC A;  3KIO A;  3VQ8 A;  4F3O A;  1XWL A;  3FFI A;  2W6L A;  1JLG A;  4BRQ A;  4CW7 B;  4B3R K;  4QCL A;  4U7B A;  4GV3 A;  3HRG A;  2X6S A;  2QEX N;  4IFY A;  2UUB K;  3NGI A;  3VOV A;  4YOW A;  2VQF K;  4FZY A;  3A5M C;  2BTF A;  1JCE A;  4FWP A;  3L2U A;  3A8Y A;  5M1O A;  3ZSV A;  3O3F A;  4IXC A;  4BRC A;  4C8K A;  2IVN A;  5IT9 O;  5FLX O;  3K5O A;  3VF2 A;  4B1X B;  4JNE A;  4DQS A;  5D3G A;  4E7H A;  4M63 C;  3LAN A;  1T6D A;  1BOT O;  2YHY A;  1VRT A;  2YJE A;  4J2E A;  3O3G A;  2QWP A;  2V7Y A;  4JI7 K;  2HNY A;  1T03 A;  4BQL A;  3THX B;  5C12 A;  1KCF A;  3CCV N;  1FKO A;  1NJY A;  3FLC O;  3C94 A;  3RSE B;  2A6A A;  4IO9 L;  2XY7 A;  1VSH A;  4X64 K;  2GUI A;  1NK7 A;  4K8X A;  3WXI A;  3SV4 A;  2NNW A;  2P9N A;  3VGK A;  3WNG A;  3P83 D;  4CEB A;  2HHX A;  1KAY A;  1YVN A;  3ATU A;  5LJV A;  3H08 A;  3TAE A;  5EX5 A;  3HP6 A;  3HK2 A;  3MXM A;  1Q8I A;  3WQT A;  3K58 A;  3ZCM A;  4NXN K;  3O3H A;  4C23 A;  4DU4 A;  3HI0 A;  1LOT B;  2O8F B;  1LW2 A;  3EZ5 A;  4KH5 A;  3ISN C;  1NGH A;  3CM6 A;  2JWL A;  4I2P A;  1E4G T;  4FWQ A;  3ZT0 A;  1VQ6 N;  3OTO K;  3MCP A;  5C2F A;  1RT7 A;  1K8K A;  3SNN A;  1JLQ A;  3QEV A;  4FJJ A;  3KKS A;  4KRE A;  1U49 A;  4W5R A;  3ULE A;  3MAQ A;  3SCX A;  4DR6 K;  3G10 A;  4B1V A;  4WFN L;  3ZSZ A;  1Z25 A;  3C6U A;  3KLG A;  3I0S A;  4CGI A;  3CG7 A;  3HPH A;  3LP0 A;  4LFC K;  2G8F A;  4CGH A;  3E01 A;  1HKB A;  4ELT A;  1Z05 A;  3QBW A;  1D5A A;  2CGK A;  1MDU B;  2OYQ A;  1RT5 A;  3CIP A;  2X74 A;  3PO4 A;  4BG8 A;  2EWS A;  3FGU A;  1JL2 A;  4GNI A;  1NGE A;  3O5B A;  3S3O A;  3TAR A;  5BPL A;  1L3T A;  4K8Z A;  4CFB A;  3OS1 A;  3UKU B;  4H03 B;  1T6C A;  4B1W B;  1XI1 A; 
#chains in the Genus database with same CATH homology
 5CZ1 A;  1WSI A;  2GV9 A;  2O4G A;  4CJ5 A;  2PY5 A;  1VRU A;  4DU1 A;  3OYM A;  2BE2 A;  3VQC A;  3HJF A;  4M3U A;  2D0C A;  3D45 A;  4YFU A;  4CEF A;  4B9L A;  2QK9 A;  4KO0 A;  2X78 A;  4W5O A;  4FK4 A;  5J1E A;  3L2V A;  1KVC A;  4I2Q A;  4FK2 A;  1JLB A;  1NKE A;  4RW8 A;  1VSM A;  3O4N A;  3CFR A;  1X9W A;  2X6N A;  4Z0U A;  3LZI A;  1TK5 A;  4RW6 A;  2EX3 A;  2P5G A;  2HHQ A;  3KK3 A;  3HM9 A;  4FLV A;  1QSY A;  4DTS A;  1RBT A;  1U47 A;  3VQD A;  4CED A;  4CF0 A;  4OKK A;  3LAL A;  4LD0 A;  3SV3 A;  1B92 A;  4Y1D A;  3OJU A;  1WAJ A;  4UQG A;  3QIN A;  5CYM A;  3AA4 A;  1ZYQ A;  3RRG A;  3QEX A;  3V9X A;  4DQQ A;  3V1Q A;  4HTU A;  3HO1 A;  4DS5 A;  1QE1 A;  1HQE A;  1QS4 A;  3DI6 A;  5KI6 A;  3VQ4 A;  4EP4 A;  4HUE A;  2PZS A;  4FJH A;  4TSX A;  4E7I A;  4DFM A;  1BIZ A;  2OZM A;  4KB1 A;  3L3V A;  3ZSQ A;  4CJU A;  3QER A;  1UA1 A;  2ETJ A;  3CYM A;  3KJV A;  1SKW A;  4FJ7 A;  1RDD A;  3VN5 A;  3K5L A;  3D0P A;  3V9Z A;  2HVI A;  1TAU A;  3QIP A;  3TAG A;  4KKO A;  1QSL A;  1QQC A;  3NCI A;  3RMB A;  1MU2 A;  1NJW A;  3PX6 A;  4H8K A;  3LWM A;  4FLX A;  4ELV A;  3HP9 A;  1RBU A;  4E89 A;  4BE1 A;  1NK8 A;  1GOB A;  1LW0 A;  4CHQ A;  2OA8 A;  1LAV A;  3NH0 A;  4CJK A;  2VG7 A;  3NGY A;  1BHL A;  1FKP A;  3L2R A;  1VSE A;  4FZX C;  4CGD A;  2DY4 A;  2VWJ A;  1CXQ A;  3DRR A;  4CHN A;  1HNV A;  4E3S A;  3SPZ A;  2W42 A;  1VSK A;  4RW4 A;  3OS0 A;  3DMJ A;  3EY1 A;  4B9S A;  5JS1 A;  2G8V A;  1BQM A;  2G8K A;  3AO3 A;  2ZQB A;  3CQ8 A;  3IS9 A;  4CES A;  4FM2 A;  2BGG A;  5CZ2 A;  3V81 A;  4KI6 A;  3OYE A;  4F4K A;  3AO4 A;  2DFF A;  2OPQ A;  3NFA A;  3L2Q A;  3QEP A;  4M45 A;  4CK2 A;  4CFD A;  4B9U A;  3PX4 A;  3QEW A;  1NKC A;  4HHT A;  5J2Q A;  3ZSR A;  4KB0 A;  4CF1 A;  3ITH A;  4CEO A;  1S1X A;  4FJK A;  4M3T A;  1QHT A;  1R0A A;  2HW3 A;  1FK9 A;  3OVN A;  3V9W A;  3K5M A;  3AVG A;  1TK8 A;  4PQU A;  3MED A;  3LZJ A;  3OYN A;  1TKX A;  4NCA A;  4PUO A;  3TAF A;  4ID5 A;  4R5P A;  3K5N A;  4KHS A;  3CFP A;  4E7L A;  1ZBL A;  3SYZ A;  1S1T A;  3VQQ A;  3WNE A;  3VQE A;  5KRS A;  4FJ9 A;  4OKE A;  1J5O A;  3SUP A;  2HHU A;  1RNH A;  2YNI A;  4IG0 A;  4N47 A;  4CEE A;  4Z4I A;  4LH5 A;  4RW9 A;  4FLT A;  3OY9 A;  1SL1 A;  4N76 A;  1TV6 A;  4KTW A;  5FRO A;  3AV9 A;  5T7B A;  4H4O A;  5FRN A;  2E6M A;  4B9M A;  4PY5 A;  1A5X A;  2ZD1 A;  2PYL A;  4J2D A;  1HYV A;  2HHW A;  2Z1G A;  1RCH A;  3DLR A;  1JXE A;  2KZZ A;  4FLY A;  4E7J A;  1VSD A;  5C25 A;  3TAM A;  1W9H A;  2E4L A;  3HST B;  1JLC A;  1JXB A;  3K2P A;  3MEE A;  3VQ5 A;  4CFC A;  4BE0 A;  3U6F A;  3ASM A;  3DRP A;  3P5J A;  3G0Z A;  1S1W A;  3RMD A;  3CFO A;  4BDZ A;  3AVC A;  4DQI A;  4DLG A;  3VQP A;  4AHU A;  4JS5 A;  4HUF A;  1KVA A;  2I5J A;  4HVJ A;  4KTZ A;  2ATQ A;  3AO1 A;  3DRS A;  4FXD A;  1NOY A;  3PUF A;  4GVM A;  2XO7 A;  3OYJ A;  4CF2 A;  3BGR A;  3AA2 A;  3M8S A;  1EET A;  1X1P A;  4DLE A;  3OYC A;  4DSI A;  1FXX A;  1YT3 A;  1C0T A;  2EHG A;  3BDP A;  4H4M A;  4CE9 A;  1GOC A;  4KV8 A;  3LPT A;  2GBZ A;  3KTQ A;  1RT4 A;  4ICL A;  1ZBU A;  4MQ3 A;  1NJZ A;  4MFB A;  5SZT A;  2JGU A;  4FJ8 A;  1YTA A;  2ITG A;  3KK1 A;  1RTD A;  4F2S A;  4J2B A;  1O1W A;  3LAK A;  4DFJ A;  1RTJ A;  4W5N A;  4Z4G A;  3DLH A;  4CJW A;  1J54 A;  4ID1 A;  4KAZ A;  4AHV A;  3O4Q A;  1KFD A;  4DS4 A;  1KSP A;  3ZSX A;  3SQ0 A;  4C8L A;  1CZ9 A;  1RT3 A;  1WSJ A;  4F2R A;  3AVM A;  1BCO A;  1RDA A;  1HMV A;  4FJM A;  2RPI A;  2YNF A;  3L8B A;  4FM1 A;  1TKZ A;  1XC9 A;  3LPU A;  2XY6 A;  1T8E A;  4BE2 A;  1HYZ A;  3TAB A;  5FDL A;  1VSL A;  2DFH A;  4FJX A;  3B6P A;  4O55 A;  3LDS A;  4M42 A;  4OKJ A;  3HVT A;  1HJR A;  3AVL A;  2YNG A;  4RG8 A;  3TR8 A;  4Q5V A;  4DTX A;  1L5U A;  4AIL C;  4OLB A;  4FJN A;  3HXM A;  1J9A A;  1F21 A;  1TGO A;  4FJI A;  4DTM A;  4CEZ A;  2OPP A;  4CGJ A;  4DFK A;  4Z4E A;  1EKE A;  1ZBF A;  2IAJ A;  2P1J A;  3AO5 A;  5I3U A;  3OYA A;  2E6L A;  2QKK A;  2PYJ A;  4CER A;  4KHY A;  2G8I A;  4CFA A;  2A1S A;  3AVN A;  4FW2 A;  1WNS A;  2XRI A;  3DLK A;  3SQ2 A;  1D9D A;  1KFS A;  2B5J A;  1WSG A;  4HCC A;  5HRS A;  1LWF A;  1SL0 A;  2YHA A;  4CHP A;  1S6P A;  4JRQ A;  4Z4C A;  4AH9 A;  4M3Z A;  2IC3 A;  4DSE A;  3TAP A;  4KPY A;  3NF7 A;  2XY8 A;  5K14 A;  3DLE A;  4IFV A;  4O44 A;  1NKB A;  4IBN A;  1RDC A;  3OYK A;  1TK0 A;  1ASW A;  3KLH A;  3AVK A;  3HPG A;  1ASV A;  1K6Y A;  5KRT A;  1U04 A;  4Z4H A;  3M8Q A;  4OLA A;  3AA3 A;  4DSK A;  4LY7 A;  4B8C A;  3QIO A;  4B08 A;  5CYQ A;  1L3S A;  2KQ2 A;  3DLB A;  4KHU A;  5CY4 A;  2VG5 A;  3T1A A;  2RF2 A;  1UA0 A;  2YKM A;  3VQB A;  4IDK A;  3ZSY A;  1Q9X A;  5J2M A;  4JRP A;  2WOM A;  4FYD A;  4O0I A;  2F8T A;  1C1B A;  4NYF A;  1VSI A;  3T19 A;  2Y1I A;  3V1O A;  3NH2 A;  1ZBI A;  1D8Y A;  2G8W A;  4I9Q A;  5HRN A;  2XHB A;  4NYN A;  2FBV A;  3QNO A;  1RTH A;  3QNN A;  3V9U A;  4IKF A;  2KZM A;  2Q3S A;  2LSN A;  4CIE A;  1NK5 A;  2YKN A;  3VQA A;  3AO2 A;  3ZSW A;  4W5Q A;  1BI4 A;  3I0R A;  5C24 A;  4Y1C A;  1JLA A;  1S1V A;  1UWB A;  5DK5 A;  2HHT A;  3NGZ A;  3ZT1 A;  4DF8 A;  2DTU A;  3MEC A;  3HT3 A;  1SKR A;  1LWE A;  3I8D A;  3LP2 A;  4E0D A;  3QLH A;  4E19 A;  1Z26 A;  4KRF A;  3DLG A;  3F73 A;  1WAF A;  2O4I A;  1QSS A;  4AHT A;  4CEC A;  3VQ7 A;  1VSF A;  3KLF A;  4DU3 A;  2YNH A;  1XHZ A;  1C0U A;  2HVH A;  4OGE A;  4KHQ A;  4Q0B A;  4M3X A;  1S6Q A;  3KK2 A;  5HBM A;  1BL3 A;  2DFE A;  4O4G A;  4BWM A;  3ZT3 A;  3SQ1 A;  4B8A B;  4DQR A;  1D9F A;  3AA5 X;  1SUQ A;  3IAY A;  1RT6 A;  3NF9 A;  3DOL A;  2JLE A;  4LSN A;  4B9N A;  3ZSO A;  1S5J A;  4FJG A;  1BI4 B;  4C8N A;  1W0H A;  2A1R A;  5HLF A;  4HCB A;  4DTO A;  2KFZ A;  2HNZ A;  2OPR A;  1A5W A;  1HYS A;  5KGW A;  3QEI A;  2HMI A;  1NK4 A;  1GOA A;  2BAN A;  3C95 A;  2RKI A;  2VWK A;  1KLN A;  2FBT A;  3VA3 A;  3CM5 A;  3M8P A;  5DMR A;  4ELU A;  3ULD A;  3OYL A;  4O0J A;  4J2A A;  1VSJ A;  4JLH A;  4CF8 A;  4FVM A;  4CGG A;  1RT2 A;  1TAQ A;  2Z1H A;  3QO9 A;  4CHY A;  5JS2 A;  4C8O A;  1NJX A;  3NBP A;  1BIU A;  3DOK A;  3C6T A;  3QES A;  4BWJ A;  4CJF A;  4OJR A;  4CIF A;  4CCH A;  3NDK A;  4KTQ A;  3VQ9 A;  1RBS A;  2QKB A;  2P5O A;  4KI4 A;  1BIS A;  1TVR A;  1Y97 A;  1LAW A;  4AHC A;  3TI0 A;  2YHB A;  1L3V A;  3V9S A;  1C0M A;  2OPS A;  4EZ6 A;  2HHV A;  1I39 A;  2P51 A;  1SL2 A;  3TAN A;  1IH7 A;  2ZE2 A;  3L3U A;  3NF8 A;  4B9T A;  4Z4F A;  4E7K A;  3HL8 A;  2IOC A;  4I9L A;  3SI6 A;  5I42 A;  3M8R A;  2R7Y A;  4O5B A;  3SQ4 A;  3LP1 A;  4CGF A;  3OYH A;  4C8M A;  3EYZ A;  4AHS A;  3JYT A;  1RTI A;  1TKD A;  1HNI A;  1WSF A;  3AVI A;  4NCG A;  1IKX A;  4CJL A;  1RT1 A;  3AVF A;  2VG6 A;  3RRH A;  1JLE A;  2YV0 X;  4CJV A;  4DFP A;  1ITG A;  2HB5 A;  4DWI A;  1HRH A;  2Y1J A;  4BDY A;  4DG1 A;  1X9S A;  1DLO A;  1SV5 A;  5KGX A;  3SPY A;  3MEG A;  1UOC A;  1JL1 A;  3NH1 A;  1NK6 A;  3ZT2 A;  4ZTJ A;  4ZHR A;  3KIO A;  4M3Y A;  3VQ8 A;  4DF4 A;  3NHG A;  1XWL A;  4F3O A;  1ZBH A;  3FFI A;  1JLG A;  2B4J A;  4DTR A;  2KW4 A;  5FRM A;  4PA1 A;  4QCL A;  1WN7 A;  2X6S A;  3L2W A;  1BGX T;  3F9K A;  1I3A A;  4W5T A;  4FK0 A;  4IFY A;  2IGI A;  2WON A;  3NGI A;  4OPK A;  2KTQ A;  4FZY A;  3KLI A;  4IG3 A;  1T05 A;  5HRP A;  3TWH A;  3OYD A;  5HRO A;  3OYI A;  1J53 A;  3L2U A;  2D5R A;  4QOZ B;  2D0A A;  2FC0 A;  4KHN A;  4ZTF A;  1VK0 A;  3ZSV A;  3PO5 A;  1XHX A;  3O3F A;  2HND A;  4C8K A;  4I7F A;  3DYA A;  3K5O A;  3A2F A;  5EU7 A;  5D3G A;  4DQS A;  1KRP A;  1EX4 A;  4E7H A;  3LAN A;  1IO2 A;  3ZT4 A;  4CEA A;  5KTQ A;  5J2N A;  4B3O A;  4CJP A;  3VQ6 A;  3KLE A;  1U4B A;  4CJR A;  4N5S A;  1LWC A;  4DTJ A;  3JSM A;  1VRT A;  1NK9 A;  1Q9Y A;  1U48 A;  1TL3 A;  1EP4 A;  1S9G A;  4FLW A;  4OPJ A;  3WNH A;  4J2E A;  3O3G A;  1JKH A;  3P1G A;  2HNY A;  1T03 A;  3UIQ A;  1YTU A;  3AVJ A;  4F3T A;  1JLF A;  1KCF A;  4E1N A;  1FKO A;  1NJY A;  1EXQ A;  3AVB A;  2RN2 A;  3LP3 A;  3RR8 A;  2Z1I A;  3C94 A;  1RBR A;  3U3G A;  2D0B A;  4FLU A;  2XY7 A;  1C1A A;  3KD1 E;  4EZ9 A;  2HHS A;  1VSH A;  3IG1 A;  3OYG A;  4BDP A;  2GUI A;  1NK7 A;  3PY8 A;  4K8X A;  3PX0 A;  4CJ4 A;  2G8H A;  3SV4 A;  3HVR A;  4AHR A;  4DTN A;  4DQP A;  3IRX A;  4GW6 A;  3WNG A;  1IG9 A;  1RIL A;  1WSE A;  3P83 D;  4CEB A;  4E1M A;  2HHX A;  4BAC A;  1KTQ A;  4EP5 A;  4FJ5 A;  1RBV A;  3HPO A;  4CK1 A;  3H08 A;  2KFN A;  3TAE A;  1IKW A;  3HP6 A;  3HK2 A;  1WSH A;  4HUG A;  1WLJ A;  3MXM A;  4NCB A;  1Q8I A;  1X9M A;  2IDO A;  4CEQ A;  2AJQ A;  1YVU A;  4FCY A;  3K58 A;  3ZCM A;  1QTM A;  4N41 A;  4DMN A;  1KLM A;  4N56 A;  1G15 A;  4CJS A;  3O3H A;  3T3F A;  4L8R B;  4DU4 A;  3SZ2 A;  4CJ3 A;  1LV5 A;  5HP1 A;  4CK3 A;  3U3Y A;  1CZB A;  1DTQ A;  3RTV A;  1LW2 A;  3HYF A;  3EZ5 A;  4FLZ A;  4CHZ A;  3MXJ A;  1U45 A;  4LSL A;  4XIU A;  3ISN C;  4M41 A;  3CM6 A;  4I2P A;  4QAG A;  3SJJ A;  1DTT A;  3NAE A;  1IKY A;  5J2P A;  3ZT0 A;  3OYB A;  4JS4 A;  4RW7 A;  4B9V A;  4DSJ A;  2F96 A;  3KKR A;  1BCM A;  1N6Q A;  4FM0 A;  1RT7 A;  3K59 A;  4DTU A;  3TAQ A;  2BDP A;  4M3R A;  3SNN A;  1BQN A;  1JLQ A;  1S9E A;  3QEV A;  1NOZ A;  1SKS A;  4FJJ A;  2F8S A;  3OYF A;  4DSL A;  3KKS A;  1C1C A;  2FBY A;  2NUB A;  3B6O A;  4KFB A;  3RMC A;  1U49 A;  4KRE A;  3THV A;  1UAX A;  4W5R A;  4KHW A;  3MAQ A;  3AVH A;  3WNF A;  1HPZ A;  4DSF A;  3SCX A;  4CHO A;  1C6V A;  1B9F A;  3G10 A;  3S9H A;  2OZS A;  4OGC A;  3ZSZ A;  4GMJ B;  1Z25 A;  1NK0 A;  1TL1 A;  3C6U A;  4CJT A;  3I0S A;  4CGI A;  4CF9 A;  5C42 A;  3KLG A;  4OVL A;  3CG7 A;  3HPH A;  3SUQ A;  2G8U A;  2QXF A;  3V6D A;  1CLQ A;  4FW1 A;  1ASU A;  3LWL A;  3LP0 A;  4F8R A;  4CIG A;  1A5V A;  2XY5 A;  1KVB A;  3VA0 A;  1L3U A;  3MXI A;  4CGH A;  2G8F A;  3E01 A;  4PWD A;  1IKV A;  4ELT A;  2Z1J A;  3OJS A;  1D5A A;  3ALY A;  4G1Q A;  1HQU A;  1S1U A;  2FBX A;  3LAM A;  3V1R A;  3V4I A;  2OYQ A;  1RT5 A;  5SWM A;  2X74 A;  3K57 A;  4FZZ A;  3PO4 A;  1B9D A;  3QET A;  3SUO A;  4WE1 A;  3SUN A;  4CJE A;  4LH4 A;  3AVA A;  1CXU A;  4DTP A;  4M3W A;  3NF6 A;  1JL2 A;  4CJQ A;  3S3O A;  1REV A;  2IS3 A;  3PV8 A;  5HRR A;  3RMA A;  3TAR A;  3NE6 A;  3S3N A;  1L3T A;  1T7P A;  3RR7 A;  1RDB A;  3RWU A;  4FJL A;  4K8Z A;  4CFB A;  3DM2 A;  5E41 A;  3OS1 A;  1N5Y A;  4YNQ A;  2B6A A;  3OS2 A;  1TKT A;  3KD5 E;  3S3M A;  1XI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...