1VSHA

Asv integrase core domain with zn(ii) cofactors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTEGRASE
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
source organism Rous sarcoma virus (strain schmidt-ruppin)
molecule tags Endonuclease
total genus 48
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vshA00
3K5OA 1B9FA 1TAQA 3RRHA 2XY6A 4KV8A 4TSXA 4DQIA 4HUGA 4N47A 4FM0A 3NF7A 1J53A 4CHOA 2KZMA 1C1CA 3DLGA 4B9TA 4DS4A 3TR8A 3OVNA 1LWCA 3U3YA 3DRPA 1QSYA 3QERA 1DTTA 1QS4A 1RNHA 3ZT2A 1X1PA 3DLHA 4NYNA 3AA4A 3VQQA 4CESA 4FJLA 4DSKA 4I9QA 4DTSA 2YV0X 1KLMA 1SKSA 4CJQA 3QIOA 4XIUA 3AVMA 3BDPA 3VQ9A 3EYZA 4FLYA 1GOCA 1LWFA 1ZBHA 4BE1A 1T7PA 1HQEA 3SQ0A 3OYNA 3ZSZA 4M45A 4FJKA 2HNZA 3D45A 1C1AA 3C94A 3DRRA 2JGUA 3VQ4A 4YFUA 1Y97A 3EY1A 5I3UA 3L2WA 3SI6A 2OYQA 1C0MA 3TWHA 3G0ZA 2HHWA 2WOMA 4Z4EA 4CEAA 1LW2A 3CFPA 2PY5A 1KCFA 2P5OA 2JLEA 4JLHA 2HHTA 2O4IA 1TAUA 4G1QA 4MQ3A 4QAGA 3HPGA 4CGFA 4DG1A 4YNQA 3KLHA 3K5LA 4BE0A 3MXIA 1NK6A 1U49A 4KTQA 1UA0A 4RW6A 3O4QA 3LP3A 4O44A 4HUEA 3LDSA 4CEZA 5KGWA 1WLJA 2RKIA 2F8TA 3ZT3A 4C8KA 4CECA 1CLQA 1HPZA 4E1NA 3HO1A 4DQPA 1LW0A 1VSDA 3E01A 4BE2A 4CJFA 4DQRA 3S3OA 2G8UA 2VWKA 2P1JA 4CK3A 5J2PA 1A5XA 1D9DA 4KKOA 1YTAA 5CY4A 4DF8A 3QEPA 4O0IA 2XO7A 3QEIA 4J2DA 1HRHA 1HNIA 1BGXT 5DMRA 3TAEA 3RMCA 2G8KA 4M41A 3UIQA 1K6YA 1C0UA 3A2FA 3HVTA 1NJWA 4KB0A 4CHZA 3SZ2A 3DLEA 3SV4A 3OYMA 3DOLA 1TK5A 3LPUA 1YT3A 1D5AA 4FM2A 3AVBA 1NK8A 3HPOA 3L3UA 2BDPA 3IG1A 1SL1A 2ZQBA 3ZT1A 3DM2A 3K58A 4PWDA 1C1BA 3TARA 3VQ8A 1NOZA 3U3GA 4O5BA 3QESA 1S6PA 3C6UA 4I7FA 1RT7A 1VSEA 1QHTA 2PYJA 1IKWA 3M8SA 4KFBA 3CM6A 4CHYA 3OYFA 4DF4A 3VQBA 1KLNA 3KD5E 2G8IA 4CEFA 2YNIA 3G10A 4OGCA 1WNSA 1ASVA 1RT4A 4O0JA 1RDAA 2FBVA 2DFHA 3P83D 3QINA 4GW6A 2KFNA 1EXQA 4ELUA 1TK0A 4B9SA 4ZHRA 3LALA 4B9MA 4Z4CA 5I42A 3LP0A 3V9SA 4CF9A 4AHVA 1MU2A 4W5TA 2GV9A 1C6VA 4M3WA 3SJJA 3QNNA 3TANA 1DLOA 1XWLA 3FFIA 1BQMA 3AVJA 4LSNA 3OJSA 4DU1A 2X78A 4HCCA 5HP1A 1J5OA 2YHBA 3VQDA 1ZBIA 3OYKA 3SCXA 3U6FA 3LWMA 3ZT0A 4CJUA 2IDOA 1Q9XA 1A5VA 4FLUA 5J2NA 3CYMA 1RBVA 3HXMA 4B08A 1L5UA 4CJLA 4DU3A 2Z1HA 3O4NA 3K57A 2QK9A 2E6LA 4Z4FA 1CZ9A 1WSIA 2VG5A 3B6OA 1JLBA 1UAXA 4ID1A 4KHQA 1HYSA 3HSTB 4E19A 4FXDA 1BISA 3DI6A 3LANA 4FW2A 4OKJA 3HP9A 4Y1DA 3TAMA 1T05A 4KRFA 1S9GA 4CHNA 4QCLA 1GOAA 3ZSRA 1BCOA 1BQNA 4IKFA 1KSPA 1DTQA 1YTUA 1NJZA 1JL2A 4CIEA 3DLBA 1VSLA 4M3XA 5KGXA 3ULDA 4CGGA 5KRTA 4N56A 3VQCA 1RT6A 3QNOA 4BDPA 5D3GA 1WSFA 4DFMA 5CZ1A 1JKHA 1WSHA 2HNDA 4AHSA 2PYLA 4FYDA 2YNHA 3SUOA 1ZYQA 1RDDA 4RG8A 2KQ2A 3OY9A 2ITGA 5DK5A 3OYBA 4DTRA 1N6QA 4IFYA 4QOZB 4DTPA 3NGZA 3QO9A 3CFRA 2OPQA 3K59A 4OLBA 4CJ3A 2DTUA 3V1QA 3RTVA 1KVCA 1RDBA 4OKKA 3NH2A 2P51A 3HPHA 4CGDA 2YNGA 1F21A 4EP5A 3SV3A 1UOCA 3S3MA 4CJTA 4KAZA 1IKVA 1RT1A 3ZT4A 4W5RA 5JS2A 3SPZA 4M3ZA 5CYQA 3ZSYA 4F2RA 2HHXA 5HBMA 4OKEA 1SL0A 2XHBA 4CFCA 4OLAA 3AA5X 4LSLA 2BE2A 1XHXA 1ZBFA 3P5JA 2FBYA 2E6MA 3NF8A 4KHWA 1HQUA 4FLTA 1WSEA 3O3GA 3OYLA 4CF8A 3ALYA 4CJPA 1BI4A 1VSIA 3V1OA 4PA1A 1SV5A 1S1XA 3T1AA 3OYAA 1ASWA 1L3TA 5KRSA 2Y1JA 4K8ZA 3AVIA 1LAVA 2GBZA 3WNFA 4HVJA 3NBPA 4DS5A 2WONA 1VSJA 4B8CA 1QSLA 3NF9A 1X9MA 4AHTA 3I8DA 3TAFA 2OZMA 3SPYA 4W5NA 1RDCA 3KLFA 1I3AA 3SYZA 4E7IA 3WNHA 1RBTA 2X6NA 2IAJA 3ZSQA 1O1WA 1NJXA 2GUIA 4H4MA 3DLKA 4B9VA 4C8NA 4NCAA 4Z4GA 2B6AA 3RMDA 1EETA 1NJYA 1HNVA 2FBTA 5C25A 3V4IA 3OYCA 2HHUA 2HHVA 1KRPA 3I0SA 5KI6A 4AHUA 1ASUA 3KK3A 1NK9A 2HVIA 5J1EA 1NK5A 2A1RA 3P1GA 3THVA 2ETJA 3AVHA 2A1SA 1REVA 2RF2A 4O4GA 3LWLA 1UWBA 2XY7A 2G8VA 3TAGA 3DLRA 1D8YA 4HTUA 1RTDA 5CZ2A 4OPJA 4CEBA 4FVMA 4R5PA 2W42A 3SQ4A 1L3SA 4FJXA 2F8SA 4Z4IA 1BIUA 3CQ8A 1TK8A 4IG3A 1N5YA 3LP1A 4FLXA 4BWMA 3V9ZA 2QXFA 1CXQA 3AVNA 1WAFA 4GMJB 3K2PA 1RT2A 3ZSVA 4DFKA 2Z1GA 3QETA 2XY8A 2XY5A 4C8MA 1RBSA 3WNEA 3RR8A 3C6TA 4FJ5A 2KTQA 4KHYA 4ID5A 1JLCA 2P5GA 4B3OA 4CIGA 3NGYA 5J2MA 2XRIA 3DYAA 4DSLA 4N76A 2DFEA 1L3UA 4M3UA 1JLAA 3SUPA 3BGRA 2ZE2A 4HHTA 1VRTA 2IGIA 1RBRA 1JLGA 3I0RA 1BI4B 1TKTA 3KJVA 4F4KA 1KTQA 2VG7A 3MEDA 4PQUA 4FJIA 2D5RA 3AVFA 3OJUA 4E7HA 4DSFA 3QEXA 3QIPA 4C8LA 3HP6A 1RCHA 1QSSA 1YVUA 3L2RA 4OVLA 3S3NA 4BWJA 3ITHA 3IRXA 1S6QA 4I9LA 4BDYA 4DLEA 4FJ8A 4F3TA 4AHCA 2HNYA 1NKBA 3NDKA 4N5SA 3T3FA 2X6SA 2Z1IA 4LY7A 2YHAA 1FK9A 3LP2A 4RW9A 4E7JA 3H08A 4DSEA 1IO2A 1JXEA 4K8XA 3O3FA 3RMBA 3F9KA 4J2AA 1IKYA 1QQCA 3KKRA 4FLZA 1U45A 5C24A 4I2PA 1TV6A 4FJMA 3OYEA 4DU4A 1RTIA 5K14A 3LZJA 4FK2A 4H8KA 4CK2A 3QLHA 4CK1A 4FJ7A 1CXUA 4KB1A 3B6PA 1G15A 1KVAA 2B5JA 3CFOA 5HRNA 4L8RB 4NCBA 3WNGA 4CJVA 1BHLA 1U47A 5C42A 4FLWA 3K5MA 4E0DA 3TAQA 4Q0BA 3LAKA 1S1WA 2D0CA 3AVCA 2OPRA 3RWUA 4FM1A 3JYTA 3LZIA 1KFDA 1BL3A 2DFFA 2LSNA 2RN2A 2ATQA 1LWEA 4CEOA 1LV5A 1VK0A 3DMJA 4BACA 4BDZA 2YKMA 4FW1A 3OYGA 1TKDA 4CHQA 1T8EA 3KKSA 1JLEA 5EU7A 1J9AA 3AVLA 2OPPA 3PUFA 4O55A 1Q9YA 4Z4HA 1GOBA 4KTWA 1VSHA 4Y1CA 3VA3A 3V9UA 4CGHA 4H4OA 3PX4A 2IC3A 4ZTFA 2G8HA 1TKZA 1QTMA 4CCHA 1SKWA 2OA8A 4CJ4A 1WAJA 3M8RA 4CJSA 1IKXA 3RRGA 2IOCA 4IG0A 4FJNA 3NFAA 2F96A 4CFAA 1LAWA 1FKOA 3OYDA 4DTNA 4CJEA 3ZSOA 2D0BA 4UQGA 4HCBA 4E7KA 1Q8IA 4HUFA 3S9HA 4M3TA 4DQSA 2QKBA 3VQPA 1U4BA 1FXXA 1L3VA 2B4JA 3T19A 4E1MA 3MXMA 4C8OA 5FRNA 3PO4A 3DRSA 4DFJA 4M3RA 3LAMA 4ICLA 4CJWA 3ZCMA 5SWMA 3HVRA 2AJQA 1U48A 1TL1A 1S1UA 3SQ2A 4KO0A 2BANA 1NK4A 3VQ5A 1RTJA 4FCYA 4DQQA 3VQ7A 3AO3A 1HJRA 1HYZA 1JLQA 3KK2A 4DTJA 5HRSA 4AILC 3ISNC 5FDLA 4EP4A 4DTUA 1Z25A 3D0PA 4EZ6A 5FROA 4LH5A 3KTQA 4E7LA 2KZZA 1S1TA 3ASMA 5HROA 3VQEA 3LPTA 4E3SA 4NYFA 3AO2A 3OS0A 4DTOA 3PY8A 3V81A 2KW4A 4JRQA 1RBUA 3ZSXA 1W9HA 1EP4A 4FZZA 1TVRA 2D0AA 3HT3A 1WN7A 3SUQA 3L2UA 1RT5A 3NCIA 1ITGA 3NAEA 3NF6A 2O4GA 3AO4A 1EX4A 1NK0A 2YKNA 4CEDA 2VG6A 3L8BA 4F3OA 1XHZA 1VSFA 2NUBA 1WSGA 4Q5VA 1JXBA 3PV8A 2HHQA 4E89A 2X74A 1W0HA 3EZ5A 3V9XA 2VWJA 5J2QA 3IAYA 3QEVA 3HL8A 3KLIA 4W5OA 3PX0A 3MAQA 4FLVA 3QEWA 3CM5A 4DFPA 4AH9A 4FK0A 2HW3A 2HHSA 1I39A 1KFSA 4J2BA 4RW8A 3L2VA 4CF1A 5T7BA 4J2EA 1S5JA 1XC9A 1SKRA 4B8AB 1R0AA 4CE9A 4KREA 4RW4A 4FJGA 4CGIA 4FJHA 1IH7A 1RTHA 3V9WA 3O3HA 1NK7A 2YNFA 3JSMA 4FZYA 4I2QA 3L2QA 4FK4A 1A5WA 2KFZA 4RW7A 3PX6A 5KTQA 3KIOA 3NH0A 2G8WA 3V1RA 4FJJA 1QE1A 4FJ9A 4JRPA 1SUQA 4WE1A 4DSJA 1KVBA 2E4LA 1D9FA 4IFVA 3V6DA 4OPKA 1JLFA 2HVHA 4B9LA 3C95A 2QKKA 4IDKA 3AVKA 4CGJA 1NOYA 1EKEA 4DLGA 4B9NA 4DTMA 2ZD1A 3MECA 1UA1A 4DTXA 2EX3A 3F73A 1RILA 4CIFA 3VA0A 1NKEA 1NKCA 4ELVA 4DMNA 4KPYA 1X9WA 3TI0A 3OYHA 5FRMA 1RT3A 2FBXA 2Q3SA 3L3VA 2OZSA 4F8RA 4NCGA 3PO5A 3KD1E 4EZ9A 3KLGA 4CFDA 3VN5A 3NH1A 4KTZA 3KK1A 2Y1IA 4CHPA 2HMIA 1TL3A 3M8PA 2BGGA 4FZXC 5JS1A 4PY5A 3NGIA 1VRUA 1VSKA 4M3YA 4AHRA 4F2SA 3RMAA 3NE6A 3MXJA 4GVMA 1C0TA 5HRRA 3OYIA 1SL2A 4CF2A 1X9SA 4CF0A 4JS4A 4ZTJA 4CJ5A 3OS2A 3K5NA 3SNNA 2EHGA 4CEQA 4IBNA 1TGOA 1WSJA 2OPSA 5HLFA 3RR7A 1BCMA 1U04A 1ZBUA 4KHUA 4JS5A 3ZSWA 4CJRA 1JL1A 4N41A 3HYFA 4MFBA 1ZBLA 4PUOA 2Z1JA 3DOKA 4LH4A 4M42A 2I5JA 3M8QA 1IG9A 3AVAA 2DY4A 4KHNA 1HMVA 3AO1A 3HM9A 3TAPA 2G8FA 3AV9A 3MEGA 1BIZA 5SZTA 2HB5A 4CEEA 1S1VA 2IS3A 3SUNA 1HYVA 1B9DA 4CFBA 5E41A 3OYJA 2PZSA 3KLEA 1Z26A 1VSMA 1B92A 3AA2A 5HRPA 3TABA 1T03A 4OJRA 4B9UA 1TKXA 2FC0A 3NHGA 4KI4A 3IS9A 4OGEA 4CERA 4ELTA 1S9EA 2RPIA 3AVGA 3CG7A 4LD0A 1XI1A 3VQ6A 4CJKA 4W5QA 3AO5A 4KI6A 4KHSA 3AA3A 5CYMA 4Z0UA 4DWIA 3HJFA 1FKPA 3SQ1A 1CZBA 3VQAA 3MEEA 2R7YA 3HK2A 4DSIA 1J54A 3OS1A
chains in the Genus database with same CATH superfamily
4GVEA 1IBLK 2E2OA 3RRHA 4TSXA 2KZMA 4FWNA 4DS4A 3DRPA 2GX9A 3QERA 4I6MA 1N32K 1BG3A 4FJLA 5F0XA 1KLMA 4XIUA 3BDPA 3VESA 2ZGYA 4M45A 4EAHD 1VQON 3MCAB 2WOMA 2P5OA 2JLEA 1U2VB 2O4IA 3KLHA 4LF6K 1NK6A 1UA0A 4LFCK 3SAFA 3ENBA 3H6EA 3FLCO 3ZT3A 4C8KA 2E2NA 3HO1A 4CK3A 2P1JA 5AFUH 1YF5L 3ZX3A 3QEIA 4J2DA 4JI2K 1BGXT 4E1JA 4M41A 3A2FA 4KB0A 4CHZA 3ENHA 2WTUA 3DOLA 1TK5A 2GUPA 1D5AA 3AVBA 3PSFA 5JLHA 3HPOA 2BDPA 3IG1A 5AQNA 3HOTA 4PWDA 3WQUA 1Q18A 1HJOA 4O5BA 3C6UA 4I7FA 1VSEA 3G6EN 3CCQN 1IKWA 4CHYA 4DF4A 1KLNA 3VEXA 4BG9A 1ASVA 1RT4A 2FBVA 2DFHA 4JEPA 4ZHRA 4B9MA 4Z4CA 3W3DA 4W5TA 1DLOA 1XWLA 4H03B 2OANA 3AVJA 4LSNA 3OJSA 1QZ6A 4HCCA 2X78A 1ZBIA 1NGBA 3U6FA 4FLUA 4FWRA 3FZMA 4YDUA 1EQYA 3QB0A 1L5UA 2Q0RA 2Z1HA 3K57A 1XUPO 1SQKA 4NXNK 1JLBA 5GIOA 3KK7A 4Y1DA 3TAMA 3HP9A 1S9GA 4H0TB 4DHYA 3BEXA 4JKGB 4IWVA 2D0OA 4LFAK 1NJZA 4B3MK 4CIEA 3DLBA 4JKDA 1RT6A 3O9QA 1WSFA 1JKHA 2IIRA 2PYLA 1RDDA 4CVNE 4YOUA 2VCPA 2NRWA 3UB5A 1HNZK 1YXQA 4BRNA 4OLBA 3HRGA 4OKKA 2P51A 3BZCA 4CGDA 1W7AA 1IKVA 3ZT4A 5JS2A 4F9OA 3SPZA 1VQ5N 4F2RA 3VERA 2O8EA 2Q36A 2ZF5O 1SL0A 2XHBA 4LSLA 5AQKA 3CCRN 4GV3A 3N4PA 3O5BA 4FVUA 5I9EB 4IXCA 3O3GA 2P9LA 2E2PA 2WBNA 3ALYA 5HOOA 1ASWA 2Y1JA 4B1UB 1QQMA 4B3SK 1LAVA 3NF9A 3I8DA 3SPYA 1RDCA 3KLFA 3D2FB 3C6AA 1RBTA 2X6NA 3OW2M 1NJXA 4A57A 2I7NA 4H4MA 1BO5O 3DLKA 4C8NA 4NCAA 2FBTA 5C25A 1KRPA 1ZXOA 1ASUA 3KK3A 1QQNA 2NZTA 2A1RA 3H1QA 2F4VK 4H5WA 1QVFM 2XY7A 5C0YA 4HTUA 1YJNN 2QK9A 4CEBA 4FJXA 4Z4IA 4WFNL 1TK8A 1E3MA 4IG3A 4FLXA 4BWMA 2ZJPL 1WAFA 4GMJB 3K2PA 3CCJN 3QETA 3BF1A 3WNEA 4OO1J 4FJ5A 2KTQA 4B3OA 5J2MA 2XRIA 3DYAA 4FO0A 3O9SA 4M3UA 2ZE2A 4HHTA 3DJCA 4DUZK 3WXMB 3KJVA 4F4KA 1OH5A 1T6DA 1BDGA 3OJUA 1S22A 4E7HA 1BA0A 4C8LA 3QIPA 3JXUA 1RGIA 4OVLA 3S3NA 3IRXA 1NGJA 4F3TA 5IT9O 3O8MA 4LF8K 3O9TA 3EN9A 4N5SA 2E5LK 4LY7A 4RW9A 3H08A 3OTOK 3P38A 1U45A 3R1XA 3CPEA 1HR0K 4CZEA 3VF2A 1RTIA 4CK2A 3MN9A 4FJ7A 3JAMO 3CFOA 4NCBA 2P9NA 4CJVA 4Q0BA 3LAKA 2NRZA 3KHYA 3KWIA 2BH1A 4C1NI 1BL3A 4CJ7A 3OYGA 4KH4A 4H5NA 3KKSA 5EU7A 1J9AA 4FWPA 3PUFA 4O55A 1TYQB 3NMUA 4JI6K 4KTWA 3P39A 3ENOA 4CGHA 3D6RA 3PX4A 2KHOA 1S3XA 1TKZA 5LMNK 2OA8A 4CJSA 4FJNA 4IG0A 1W97L 2V51B 4GV6A 4UQGA 4HCBA 2NRXA 3VQPA 4CZFA 1L3VA 2O8CA 1JCEA 1P8ZA 3VF6A 3DRSA 3FZLA 4XH5A 3LAMA 1MA9B 3U4LA 3HVRA 3FZKA 1M90O 1GLFO 1TL1A 4YORA 2BANA 3CC7N 5AQUA 1RTJA 1P90A 3AO3A 1JLQA 4AILC 5FDLA 3A5MC 4BRLA 3D0PA 3VTIA 4WFBL 2KZZA 4MDBA 3LDLA 3OS0A 3V81A 4H5VA 3HT3A 3SUQA 3L2UA 3UKRB 3NCIA 1ITGA 3NAEA 3AO4A 1NK0A 3ZETB 3L8BA 3THXA 1T44A 3F5TA 4FWSA 1WSGA 4Q5VA 1JXBA 4HWIA 4E89A 3EZ5A 4X65K 4H0YB 3VGKA 3KLIA 3PX0A 3MAQA 4OX9K 4AH9A 1NGGA 1I39A 3CETA 1KFSA 1SKRA 1HKBA 4RCHA 5BREA 4FJGA 1N8RO 4O8UA 4FJHA 1RTHA 4OPAA 3THWA 1NK7A 1JCGA 3VF4A 5BN8A 3PX6A 2VGMA 4CZMA 3NH0A 4FJ9A 3V1RA 4JRPA 4DSJA 2PFUA 4WE1A 1KVBA 3CJ1A 4OPKA 1JLFA 2ASPA 3K0SA 2QKKA 1EKEA 4B9NA 4KBOA 3G4SN 1IJJA 2EX3A 1N33K 1RILA 4BY9C 5FPMA 1X9WA 5FRMA 2Q3SA 3L3VA 3TSUA 4NCGA 3PO5A 3BY5A 4EZ9A 4CFDA 2Y1IA 3KK1A 4CHPA 1TL3A 3M8PA 5JS1A 4DUYK 3FZFA 3RMAA 4BR2A 1YIJN 3LM9A 4GVMA 2DPNA 1SL2A 1X9SA 4CEQA 1TGOA 1U04A 1ZBUA 5AQMA 4CJRA 4N41A 3EO3A 1J6ZA 5FPEA 2VWBA 1U2VA 3TAPA 1NWKA 1KAXA 1BIZA 2F9TA 5SZTA 2HB5A 1S1VA 1NM1A 3SUNA 1HYVA 4CFBA 5E41A 1X3NA 1B92A 3B8AX 2FXUA 2O8DB 1NGAA 4CW7B 4LD0A 3HOSA 3DLLL 3OBYA 4KHSA 5CYMA 4DV7K 3SQ1A 2R7YA 1SAZA 4DSIA 3K5OA 2XY6A 4K43A 3NF7A 4PHTX 3HBTA 2NRTA 3TR8A 1QSYA 1H1VA 1K8KB 5KQDA 3AGKA 4NYNA 3VQQA 1VQNN 2YV0X 5H1SQ 4CJQA 3QIOA 5BN9A 3VQ9A 1VQ9N 2ITMA 1HQEA 3CJBA 5TKYA 2HNZA 3DRRA 2JGUA 3M1FA 3L2WA 3SI6A 2OYQA 3O9RA 2HHWA 1XNQK 4BRQA 4FOEA 4DG1A 3MXIA 4CGFA 4BE0A 3E9LA 3SBTA 5M1QA 3I56N 3LP3A 2F8TA 1DKGD 1WLJA 2RKIA 4CECA 5AQVA 2V7YA 2F7TA 2KLAA 4DQPA 1Q86O 1VSDA 4BE2A 2G8UA 2VWKA 1Q82O 1A5XA 4KKOA 1YTAA 5CY4A 1IG8A 3H3NO 1HNIA 5DMRA 4V19S 1C0UA 3HVTA 1NJWA 3TU5A 5GINA 3DLEA 4JKGA 3LPUA 3L3UA 1SL1A 3EKUA 1XC3A 1WUAA 3TARA 4KH5A 3ZX2A 1QHTA 5AQZA 1N36K 3CCVN 3O4WA 3CJCA 4CEFA 4O0JA 5AQOA 1EXQA 1EWRA 4B9SA 3DWLA 2NLXA 3LALA 3LP0A 4CF9A 4AHVA 1C6VA 3ATUA 3QNNA 3G25A 2YHBA 3VQDA 3SCXA 3CHWA 3ZT0A 5KPTA 2IDOA 1A5VA 5J2NA 3CYMA 3HXMA 3HTVA 5JVGL 3O4NA 1CZ9A 2Q1NA 3MMVA 4BR0A 4ID1A 4QS9A 4KHQA 4E19A 4YOTA 3LANA 4FW2A 3THYB 4KRFA 4HTLA 4QCLA 4WQ4A 3ZSRA 3D2FA 1JL2A 5LJWA 3J8AA 5KGXA 4BC3A 4CGGA 4LF7K 3QNOA 3QMLA 3LM2A 5CZ1A 4JK9A 4FPAA 4JKBA 2YNHA 3HI0A 3M5RA 3L6QA 2KQ2A 5DK5A 4DTRA 4IFYA 3WQTA 4QOZB 4DTPA 3NGZA 4M7XA 3CFRA 4CZLA 5EVZA 4BRMA 4CJ3A 2E88A 4JKFA 3V1QA 4A2BA 1KVCA 2HBLA 2YNGA 3S3MA 1UOCA 5BPNA 4YDUC 4CJTA 4KAZA 4BC5A 2HHHK 5HBMA 5M1KA 1FJGK 5AQRA 2VQFK 4OKEA 2BE2A 1XHXA 4YHHK 3NF8A 1JCFA 4B9QA 1JJ2M 5AR0A 5AQFA 4FLTA 4KHWA 1YUWA 4IOXA 3WXLA 5BPMA 4DR7K 2CGKA 4CBWA 1SZ2A 4H0OA 4HVJA 2WONA 1VSJA 4CI6A 4B8CA 4X64K 2CH5A 4AHTA 4PL7A 4W5NA 4JKEA 4ILHA 4A5BA 4JHDB 3ZSQA 1BA1A 4JI0K 2B6AA 3RMDA 3SK3A 5JVHL 2YHXA 1K8AO 3I0SA 5KI6A 3GL1A 2P9SB 4PKIA 2HVIA 4GY2B 1VHXA 2QTDA 4CD1A 5C2FA 4O4GA 1UWBA 2QWMA 3TAGA 5EY4A 3DLRA 5C15A 2HSTA 3CCEN 5CZ2A 3SQ4A 2W42A 2UU9K 4JI5K 2QXFA 3ZSVA 2XY8A 1NBWA 4ID5A 1TYQA 2HBKA 4N76A 2DFEA 3TTCA 2H3GX 4BR5A 1RBRA 3I0RA 1BI4B 1TKTA 4PQUA 2VG7A 5AZJB 1WBBA 4FJIA 3AVFA 4NLCA 4Y0WA 3HM8A 4BWJA 1ATSA 1S6QA 1NLVA 3VMFB 1S72N 3AAQA 4AHCA 1NKBA 3T3FA 2X6SA 4ILGB 5FPNA 2YHAA 3LP2A 3JS6A 2NNWA 3Q7BA 4DSEA 1VQ4N 1IO2A 4K8XA 2JWKA 4K0KK 5AQHA 4J2AA 2NRRA 1IKYA 1QQCA 5C24A 4I2PA 3FGUA 3OYEA 2P9UB 5FLXO 4CK1A 2UYTA 4H5RA 4JK7A 1ZC6A 2B5JA 1VQ6N 1QZ5A 3WXIA 1BHLA 5C42A 1HPMA 3K5MA 3TAQA 1D4XA 3RWUA 3O08A 3UKRA 2IVPA 3VEVA 3HZ6A 3ZETA 2ATQA 1VK0A 4LF4K 4BACA 4BDZA 1TKDA 4FW1A 4CHQA 3NVKA 3AVLA 2O8FB 5M1OA 1GLAG 1HUXA 4BQLA 3L4QA 3V9UA 3CC4N 4CCHA 4CJ4A 2HBJA 1IKXA 2IOCA 3NFAA 3O1BA 1FKOA 3D2EB 3MX2A 3ZSOA 4M3TA 3S9HA 4B1VA 4ISGA 1U4BA 1FXXA 2B4JA 3GBTA 4C8OA 4BC2A 3CCMN 2P9KB 3ZCMA 5SWMA 2W6LA 3M6GA 1HNXK 4IDHA 1NK4A 4IOAL 3GE1A 4ISEA 4JI3K 3R3LA 3VQ7A 1HYZA 3O9UA 4AM7A 3ISNC 2UUBK 4JAXA 2E1YA 4E7LA 4JI8K 3GOIA 1SS6A 3QBWA 1MWMA 2A42A 1YJWN 5DM6L 3LDOA 4JRQA 3MN6A 3ZSXA 1W9HA 1TVRA 1WN7A 4BVOA 4YOYA 3ID6A 4FWQA 4JI4K 3CCLN 2QWRA 1XHZA 2NUBA 3PV8A 3E9OA 4DR6K 3QEVA 3HL8A 4DFPA 2V7ZA 4EHTA 4RW8A 1BOTO 4CF1A 2V52B 1XC9A 4CZIA 4CZHA 1ILYA 4CGIA 3A8YA 2P9PB 3CF5L 3O1WA 1A5WA 2IVOA 3EE9A 5KTQA 1QVGM 2G8WA 4FJJA 4DV4K 1GLCG 2OCEA 4BC4A 1BU6O 4BREA 3C95A 1Q7YO 1DEJA 3E9PA 1NOYA 4C23A 3A5LC 3R9PA 4DTMA 2ZD1A 3MECA 4WQ5C 1UA1A 3F73A 1GLJO 4CIFA 1NKEA 4ELVA 1WOQA 4KPYA 3OYHA 2FBXA 3MK6A 3KVGA 4FL9A 4F8RA 4H0VB 1NJIO 1Z6RA 3NH1A 1K8KA 5LJVA 4PY5A 1VRUA 4YOVA 3MXJA 1C0TA 2UXBK 4JS4A 4CZGA 3SNNA 3TTDA 4KHUA 1BCMA 4YY3K 4JS5A 5AQIA 1JL1A 5GAEP 3DOKA 4M42A 3M8QA 3AO1A 2HMPA 3HM9A 2G8FA 1W2BM 3AV9A 2QWQA 4IO9L 3CCUN 3KLEA 2RE2A 2YX6A 1T03A 3O6WA 5IWAK 4KI4A 3IS9A 1TUUA 3LDQA 3LDPA 5C10A 4AQYK 1S9EA 4ELTA 2RPIA 3AVGA 1XI1A 4CJKA 4X62K 4KI6A 4FSVA 4DWIA 4IEEA 3HJFA 3C6HA 1CZBA 3VQAA 3EY1A 1TAQA 4DQIA 3CC2N 4AM6A 1J53A 1GLEG 4FWLA 3DLGA 3U3YA 4GV9A 1QS4A 3NVMA 3ZT2A 3DLHA 4DTSA 1SKSA 3T1HK 3AVMA 1IBMK 4FWOA 4PL8A 1LWFA 1ZBHA 4BE1A 3ZSZA 3KTQA 3VQ4A 3MDQA 4FOIA 1Y97A 3L0QA 4O8KA 4WQ5A 3G0ZA 1I94K 3ATVA 2ZM6K 3CFPA 3ZEUB 2HHTA 5GIPA 4G1QA 4QAGA 4BRKA 2YHWA 1N34K 4RW6A 2UXDK 5BRFA 3J7AP 1CLQA 4CEZA 2EWSA 3DXKB 5KGWA 4A2AA 1HPZA 4E1NA 1LW0A 3T1YK 4CJFA 1HKGA 4DQRA 5ELZA 3S3OA 3GG4A 2RHKA 3QEPA 1VQLN 4LF9K 4O0IA 1YI2N 2XO7A 3TAEA 4X66K 3THYA 3UIQA 1K6YA 4K42A 5CR4A 3M3ZA 3OYMA 1T3VA 2QW9A 5BR9A 4WFAL 4FM2A 3FR0A 2FSJA 5ADXH 1C1BA 4UY8O 1NOZA 3RSEB 3U3GA 4BROA 3QESA 4A5AA 2PYJA 1NGHA 3M8SA 4KFBA 3VQBA 2G8IA 4BRCA 1WNSA 5MLCQ 2KFNA 3QINA 4GW6A 4ELUA 4CD3A 1GLLO 3V9SA 1MU2A 3SJJA 1QHAA 3FFIA 1BQMA 3SAGA 1QQOA 3OYKA 3LWMA 4JKAA 3VEZA 1Q9XA 2YI1A 4B08A 2ZGZA 2E6LA 1BWFO 1UAXA 4DCHA 1HYSA 1VQKN 3DI6A 3SLCA 1GOAA 3MN7A 4JI7K 3K9KA 5AQPA 4IKFA 1YTUA 4BG8A 3T7ZA 1VSLA 1Y64A 5KRTA 4BDPA 4DFMA 4B1YB 2HNDA 3AY9A 4AHSA 4FYDA 5AQQA 4JI1K 2P9SA 1E4FT 4RG8A 3OY9A 1N6QA 2W6KA 1OVQA 3AAPA 3QO9A 5JICA 3K59A 2FF6A 2E8AA 3RTVA 3NH2A 1VAZA 4B3TK 2KKZA 3HPHA 4EP5A 1F21A 4YOXA 3SV3A 1RT1A 1ATRA 4ILJA 4W5RA 4M3ZA 4CFCA 5BPLA 3C0BA 3DXMB 1ZBFA 3P5JA 1E4GT 4B3RK 2GTDA 1VQMN 4YOWA 3OYLA 4GNIA 4WQ4C 1XMQK 3CI5A 1HKCA 1BI4A 3V1OA 1NGIA 5AZJA 1SV5A 1S1XA 3OYAA 1L3TA 4K8ZA 1R59O 3AVIA 5M1FA 3F9MA 2GBZA 4DS5A 3J80O 1QSLA 1X9MA 3TAFA 2W40A 5A2QO 1I3AA 3D7EO 4H0PA 3WNHA 4BRPA 4E7IA 3E66A 1O1WA 2ZWHA 4Z4GA 1LCUA 3V4IA 2A6AA 2P9UA 4H0XB 1KD1O 5J1EA 1NK5A 3THVA 3AVHA 2A1SA 4BRHA 3LWLA 1D8YA 1RTDA 4FVMA 1BIUA 4KHPK 1M1KO 4A61A 3V9ZA 1CXQA 3AVNA 1RT2A 4OPHA 2Z1GA 3J81O 4C8MA 1RBSA 3C6TA 2O8FA 4KHYA 1JLCA 4CIGA 2GWJA 5F2RA 4U7BA 2BTFA 3KWGA 1JLAA 3SUPA 4JV5K 5AQLA 2IGIA 4BGBA 2D4WA 1JLGA 2VGNA 3MX5A 3D2EA 2D5RA 4DSFA 3SBGA 2HF4A 4DV3K 3HP6A 1YVUA 1YAGA 2NRVA 3L2RA 4CBXA 3ITHA 3VGMA 4FJ8A 2HNYA 3VGLA 3NDKA 2OTLN 2P9KA 2Z1IA 4E7JA 1JXEA 3O3FA 3R6MA 3F9KA 4M63C 4CZJA 3KKRA 1TV6A 3EEQA 4FJMA 4DU4A 2OTJN 2ASOA 5K14A 3LZJA 1YJ9N 4H8KA 4FK2A 3QLHA 3B6PA 1G15A 1KVAA 1RFQA 4H5TA 2IVNA 3WNGA 4E0DA 1S1WA 3AVCA 2OPRA 4FM1A 5B8HA 3JYTA 3LZIA 3H1VX 1KFDA 4WCEL 2LSNA 4CEOA 3IDHA 1LV5A 2ZJRL 1T8EA 2PBDA 3S41A 1Q9YA 1GOBA 1VSHA 4Y1CA 4IZ9A 4GKJK 4ZTFA 2G8HA 3UKUB 1QTMA 1SKWA 1WAJA 4CFAA 1LAWA 1Q8IA 4DQSA 3MCPA 3A5NC 2P9PA 5FPDA 4MO4A 3T19A 3WEEB 5FRNA 3PO4A 3CMAN 4DFJA 4CJWA 4ICLA 1HNWK 4AF1A 1S1UA 4BR7A 5JLFA 3SQ2A 4KO0A 2ZJQL 4JNEA 4FCYA 3I55N 4DQQA 3KK2A 4DTJA 5HRSA 4DTUA 1Z25A 4JK8A 2A5XA 4LH5A 1S1TA 5HROA 3VQEA 1KAZA 3LPTA 4E3SA 2QEXN 3QBXA 4DTOA 1NMNA 2YCHA 4PKHA 5KPZA 3H46O 2O8BB 2D0AA 3P4IA 1ZBSA 1XMOK 2O4GA 3LL3A 4IOCL 3BUZB 4CEDA 4M7YA 2VG6A 3LDNA 3VTHA 4DR2K 1CZAN 1VSFA 2X74A 4GKKK 2VWJA 3IAYA 4JD2B 3QEWA 4JYAK 3CM5A 5GADP 4JN4A 4FK0A 2HW3A 4J2BA 5C2DA 4PKGA 5T7BA 3CXCM 1S5JA 4J8FA 5AJ3K 4B8AB 1R0AA 4CE9A 4KREA 2CH6A 4RW4A 2Q31A 1IH7A 1V4SA 3V9WA 3O3HA 2YNFA 3CJ9A 4I2QA 5AFUA 3L2QA 2KFZA 2YJFA 4RW7A 3FE1A 1NGEA 3KIOA 1QE1A 1NU0A 4EIAA 5E84A 5AQXA 2E4LA 3U9ZA 4IFVA 3V6DA 3CCSN 1YITN 2HVHA 3U8XA 4IDKA 3UE5A 4CGJA 4DLGA 4DTXA 1VQ7N 3P31A 1IBKK 4DV2K 4DR5K 4R79A 3TI0A 2OZSA 3VEYA 2PAVA 3KD1E 2WUSA 3PIPL 3KLGA 2AA4A 4KTZA 3ULEB 3C65A 5CE3A 3ZLJA 2HMIA 2P9IB 3O80A 4FZXC 1VSKA 4M3YA 3L4IA 5HRRA 4Z94A 3OYIA 4CF0A 4BR9A 4CJ5A 3OS2A 2EHGA 1DGKN 3RR7A 5HLFA 3HYFA 5AZIB 4BVPA 3E1YA 4KH6A 4DR3K 2I5JA 2DY4A 5TKWA 3AVAA 1IG9A 4KHNA 3ZEUA 2IS3A 1B9DA 3DXKA 3SAHA 3OYJA 1VSMA 2I7PA 5HRPA 4OJRA 3EE8A 4WF9L 3NHGA 2E1ZA 4OGEA 4CERA 2A3ZA 2YJEA 3ZX0A 3A5OC 4W5QA 4Z0UA 1FKPA 4RTFD 3MEEA 3BZKA 1B9FA 3MWPA 3W0LA 4KV8A 4HUGA 4N47A 4FM0A 2QM1A 3R8EA 4CHOA 4BRIA 1C1CA 5KPRA 4B9TA 3OVNA 1LWCA 2HOEA 3ID8A 1BUPA 1DTTA 1RNHA 3RSEA 1X1PA 3TTFA 4CESA 3AA4A 3C7NB 2FSNA 1XNRK 4DSKA 4I9QA 4BRFA 3VEOA 3EYZA 4FLYA 1GOCA 4IFEA 2FSKA 1T7PA 3SQ0A 3OYNA 4FJKA 3D45A 1C1AA 3C94A 4FWMA 5I3UA 4YFUA 3SMPA 1C0MA 3TWHA 1EO1A 4Z4EA 4WYBA 1LW2A 4CEAA 2PY5A 1KCFA 4JLHA 1TAUA 4MQ3A 4CBUA 3HPGA 4YNQA 3K5LA 2AP1A 1U49A 4KTQA 4FWKA 3O4QA 2FLOA 2GWKA 5BR8K 4O44A 4HUEA 2QI2A 3LDSA 4O5FA 3MN5A 1ESVA 3SJHA 4QS8A 3E01A 5J2PA 1NNEA 1D9DA 4DF8A 4BRGA 4XEIA 1MDUB 5DM7L 1HRHA 2G8KA 3RMCA 3KZBA 3QICA 2Q2RA 3SZ2A 3T69A 3SV4A 1YT3A 2HF3A 4NLBA 2O8DA 1NK8A 3VENA 4BR4A 2ZQBA 3BF3A 3ZT1A 3DM2A 5C12A 3K58A 2GELA 4U67L 3VQ8A 4I6MB 1YVNA 1S6PA 5GAGP 1RT7A 4B1WB 3CM6A 3OYFA 2JWLA 3KD5E 1OVYA 3VOVA 2YNIA 3G10A 2FF3B 4OGCA 1RDAA 3P83D 1TK0A 3A0IX 3FFKB 4DV5K 5I42A 3FZHA 1OH6A 4XH1A 2GV9A 4M3WA 3TANA 4DU1A 1OH8A 5HP1A 1J5OA 2D1KA 1NG9A 3CQXA 3G71N 4DV6K 4CJUA 4K25A 3DXMA 5LL6Z 1TUYA 1RBVA 2BUPA 4CJLA 4DU3A 2WC9A 4Z4FA 1WSIA 2QWNA 2VG5A 2QWOA 3B6OA 3CMEN 2QWLA 3HSTB 1KXPA 4FXDA 1WBDA 1BISA 4OKJA 2W41A 5HL7L 1T05A 5LMUK 1C0FA 4CHNA 1K9MO 5AQTA 1BCOA 1BQNA 4LC9B 1KSPA 1DTQA 5CHIA 4LF5K 4M3XA 3ULDA 2UUAK 4N56A 3VQCA 5D3GA 1VQ8N 1RDUA 1WSHA 5F1XA 4DV1K 3SUOA 1ZYQA 1NGFA 3OYBA 1RDWX 5KQ8A 2ITGA 1O13A 4MDAA 1Z05A 2OPQA 3I8BA 2DTUA 1RDBA 3QFUA 3OBWA 4IEIA 3N4QA 5CYQA 3ZSYA 2HHXA 3Q7CA 4OLAA 3AA5X 2FBYA 1YHQN 2E6MA 1HQUA 1XQSC 1WSEA 1GLDG 4DKWA 4CF8A 1LOTB 4CJPA 1VSIA 4PA1A 3T1AA 1Q81O 3WXJA 5KRSA 2QWPA 1KAYA 3PSIA 1ATNA 5E26A 3WNFA 3NBPA 2HBMA 2OZMA 2GEMA 3SYZA 2IAJA 2GUIA 4B9VA 3J7ZO 3CPWM 1K73O 1NJYA 1EETA 1X9JA 1HNVA 3H3OB 3OYCA 2HHUA 2HHVA 4G9ZA 4AHUA 2J4RA 1NK9A 3MWTA 3P1GA 3F2KA 1WB9A 2ETJA 2RF2A 3BP8A 1REVA 4B1ZA 5AQWA 2G8VA 1L3SA 4OPJA 4R5PA 2F8SA 2E20A 1IV0A 3CQ8A 1N5YA 1HLUA 3LP1A 4XH4A 4JKHA 4DFKA 4BRDA 3SMSA 2XY5A 3RR8A 3IMXA 2O8EB 1EWQA 4LFBK 2P5GA 3IUCA 5AQYA 3NGYA 4DSLA 1NGDA 1L3UA 3BGRA 3UKUA 2P9LB 1VRTA 1KTQA 3MEDA 3H45C 1U6ZA 3QEXA 4K41A 1DT9A 1RCHA 1QSSA 5LY3A 4NXMK 4IJNA 4DLEA 4I9LA 5ADXA 4BDYA 1KQSM 3WEEA 3RVCA 5BRHA 4BGAA 1FK9A 3RMBA 4FLZA 3CD6N 3TSQA 3WT0A 5BRDA 1X3MA 1CXUA 3WXKA 3EKSA 1J5EK 4DB3A 5JMVA 4KB1A 4L8RB 5HRNA 1U47A 4FLWA 2O8BA 5AQJA 2D0CA 3CJ7A 4JHDA 4A62A 3IKMA 2DFFA 4EFHA 2RN2A 1LWEA 3DMJA 2YKMA 1JLEA 4MO5A 2OPPA 3OA9A 4Z4HA 3VA3A 4JD2A 4H4OA 2IC3A 1C0GA 3M8RA 3RRGA 3VETA 2CGJA 2F96A 3OYDA 4DTNA 2VYPA 4CJEA 2A41A 3QFPA 2D0BA 3VEWA 4E7KA 4HUFA 2QKBA 2WFBA 4E1MA 3MXMA 5EXWA 4M3RA 2AJQA 4DQ8A 1U48A 3VQ5A 3CERA 3K9JA 4QS7A 1HJRA 1GLBG 3DAWA 4FPBA 2F9WA 3PIOL 4EP4A 4EZ6A 5FROA 2VQEK 3ASMA 3IFRA 4NYFA 2A40A 3AO2A 3PY8A 2KW4A 2P9NB 5AQGA 1RBUA 1EP4A 4FZZA 2UXCK 3OHRA 3ULEA 1RT5A 3NF6A 1EX4A 1MWKA 2P9IA 2YKNA 4CZKA 4F3OA 3TPQA 3ZYYX 3CJAA 4DR4K 2HHQA 1W0HA 3EL2A 3QDKA 4BRAA 3V9XA 1HX1A 5J2QA 2NRHA 3WUHA 4W5OA 3AGRA 4ISFA 1KC8O 4FLVA 2HHSA 5AZIA 2Q97A 3CIPA 3L2VA 4BQZA 4J2EA 4IO8A 4MLHA 2Q0UA 1NMDA 2O8CB 3AARA 3JSMA 4FZYA 4FK4A 2QA4N 2D0PA 4C1NK 4DR1K 4EHUA 1SUQA 5EOYA 1D9FA 3I33A 3HSCA 4B9LA 4DV0K 2YHYA 3AVKA 4JKCA 3PLAA 5M1PA 3VA0A 1NKCA 5EX5A 4L3QA 4DMNA 1RT3A 4NO7A 5AQSA 3VN5A 4RWTA 2CGLA 3EZWA 2BGGA 3NGIA 4AHRA 3C7NA 3THXB 3NE6A 2QXLA 4F2SA 4CF2A 4ZTJA 2UUCK 3K5NA 4IBNA 4MLEA 1WSJA 2OPSA 1OH7A 3U9DA 3ZSWA 3J7YP 3CQYA 1V4TA 4NB4A 4MFBA 1ZBLA 5GAHP 2Z1JA 4PUOA 4LH4A 1G99A 1NGCA 4A59A 1HMVA 4B1XB 3MEGA 3TSPA 4CEEA 3THWB 3VPZA 2PZSA 1Z26A 4IJAA 3AA2A 3TABA 1OKJA 2ASMA 4B9UA 1TKXA 2FC0A 3GDQA 3CG7A 1VQPN 3VQ6A 1FW6A 3AO5A 3AA3A 2E2QA 3HK2A 5M1NA 1T6CA 1J54A 3OS1A
chains in the Genus database with same CATH topology
3K5OA 1B9FA 1TAQA 3RRHA 2XY6A 4KV8A 4TSXA 4DQIA 4HUGA 4N47A 4FM0A 3NF7A 1J53A 4CHOA 2KZMA 1C1CA 3DLGA 4B9TA 4DS4A 3TR8A 3OVNA 1LWCA 3U3YA 3DRPA 1QSYA 3QERA 1DTTA 1QS4A 1RNHA 3ZT2A 1X1PA 3DLHA 4NYNA 3AA4A 3VQQA 4CESA 4FJLA 4DSKA 4I9QA 4DTSA 2YV0X 1KLMA 1SKSA 4CJQA 3QIOA 4XIUA 3AVMA 3BDPA 3VQ9A 3EYZA 4FLYA 1GOCA 1LWFA 1ZBHA 4BE1A 1T7PA 1HQEA 3SQ0A 3OYNA 3ZSZA 4M45A 4FJKA 2HNZA 3D45A 1C1AA 3C94A 3DRRA 2JGUA 3VQ4A 4YFUA 1Y97A 3EY1A 5I3UA 3L2WA 3SI6A 2OYQA 1C0MA 3TWHA 3G0ZA 2HHWA 2WOMA 4Z4EA 4CEAA 1LW2A 3CFPA 2PY5A 1KCFA 2P5OA 2JLEA 4JLHA 2HHTA 2O4IA 1TAUA 4G1QA 4MQ3A 4QAGA 3HPGA 4CGFA 4DG1A 4YNQA 3KLHA 3K5LA 4BE0A 3MXIA 1NK6A 1U49A 4KTQA 1UA0A 4RW6A 3O4QA 3LP3A 4O44A 4HUEA 3LDSA 4CEZA 5KGWA 1WLJA 2RKIA 2F8TA 3ZT3A 4C8KA 4CECA 1CLQA 1HPZA 4E1NA 3HO1A 4DQPA 1LW0A 1VSDA 3E01A 4BE2A 4CJFA 4DQRA 3S3OA 2G8UA 2VWKA 2P1JA 4CK3A 5J2PA 1A5XA 1D9DA 4KKOA 1YTAA 5CY4A 4DF8A 3QEPA 4O0IA 2XO7A 3QEIA 4J2DA 1HRHA 1HNIA 1BGXT 5DMRA 3TAEA 3RMCA 2G8KA 4M41A 3UIQA 1K6YA 1C0UA 3A2FA 3HVTA 1NJWA 4KB0A 4CHZA 3SZ2A 3DLEA 3SV4A 3OYMA 3DOLA 1TK5A 3LPUA 1YT3A 1D5AA 4FM2A 3AVBA 1NK8A 3HPOA 3L3UA 2BDPA 3IG1A 1SL1A 2ZQBA 3ZT1A 3DM2A 3K58A 4PWDA 1C1BA 3TARA 3VQ8A 1NOZA 3U3GA 4O5BA 3QESA 1S6PA 3C6UA 4I7FA 1RT7A 1VSEA 1QHTA 2PYJA 1IKWA 3M8SA 4KFBA 3CM6A 4CHYA 3OYFA 4DF4A 3VQBA 1KLNA 3KD5E 2G8IA 4CEFA 2YNIA 3G10A 4OGCA 1WNSA 1ASVA 1RT4A 4O0JA 1RDAA 2FBVA 2DFHA 3P83D 3QINA 4GW6A 2KFNA 1EXQA 4ELUA 1TK0A 4B9SA 4ZHRA 3LALA 4B9MA 4Z4CA 5I42A 3LP0A 3V9SA 4CF9A 4AHVA 1MU2A 4W5TA 2GV9A 1C6VA 4M3WA 3SJJA 3QNNA 3TANA 1DLOA 1XWLA 3FFIA 1BQMA 3AVJA 4LSNA 3OJSA 4DU1A 2X78A 4HCCA 5HP1A 1J5OA 2YHBA 3VQDA 1ZBIA 3OYKA 3SCXA 3U6FA 3LWMA 3ZT0A 4CJUA 2IDOA 1Q9XA 1A5VA 4FLUA 5J2NA 3CYMA 1RBVA 3HXMA 4B08A 1L5UA 4CJLA 4DU3A 2Z1HA 3O4NA 3K57A 2QK9A 2E6LA 4Z4FA 1CZ9A 1WSIA 2VG5A 3B6OA 1JLBA 1UAXA 4ID1A 4KHQA 1HYSA 3HSTB 4E19A 4FXDA 1BISA 3DI6A 3LANA 4FW2A 4OKJA 3HP9A 4Y1DA 3TAMA 1T05A 4KRFA 1S9GA 4CHNA 4QCLA 1GOAA 3ZSRA 1BCOA 1BQNA 4IKFA 1KSPA 1DTQA 1YTUA 1NJZA 1JL2A 4CIEA 3DLBA 1VSLA 4M3XA 5KGXA 3ULDA 4CGGA 5KRTA 4N56A 3VQCA 1RT6A 3QNOA 4BDPA 5D3GA 1WSFA 4DFMA 5CZ1A 1JKHA 1WSHA 2HNDA 4AHSA 2PYLA 4FYDA 2YNHA 3SUOA 1ZYQA 1RDDA 4RG8A 2KQ2A 3OY9A 2ITGA 5DK5A 3OYBA 4DTRA 1N6QA 4IFYA 4QOZB 4DTPA 3NGZA 3QO9A 3CFRA 2OPQA 3K59A 4OLBA 4CJ3A 2DTUA 3V1QA 3RTVA 1KVCA 1RDBA 4OKKA 3NH2A 2P51A 3HPHA 4CGDA 2YNGA 1F21A 4EP5A 3SV3A 1UOCA 3S3MA 4CJTA 4KAZA 1IKVA 1RT1A 3ZT4A 4W5RA 5JS2A 3SPZA 4M3ZA 5CYQA 3ZSYA 4F2RA 2HHXA 5HBMA 4OKEA 1SL0A 2XHBA 4CFCA 4OLAA 3AA5X 4LSLA 2BE2A 1XHXA 1ZBFA 3P5JA 2FBYA 2E6MA 3NF8A 4KHWA 1HQUA 4FLTA 1WSEA 3O3GA 3OYLA 4CF8A 3ALYA 4CJPA 1BI4A 1VSIA 3V1OA 4PA1A 1SV5A 1S1XA 3T1AA 3OYAA 1ASWA 1L3TA 5KRSA 2Y1JA 4K8ZA 3AVIA 1LAVA 2GBZA 3WNFA 4HVJA 3NBPA 4DS5A 2WONA 1VSJA 4B8CA 1QSLA 3NF9A 1X9MA 4AHTA 3I8DA 3TAFA 2OZMA 3SPYA 4W5NA 1RDCA 3KLFA 1I3AA 3SYZA 4E7IA 3WNHA 1RBTA 2X6NA 2IAJA 3ZSQA 1O1WA 1NJXA 2GUIA 4H4MA 3DLKA 4B9VA 4C8NA 4NCAA 4Z4GA 2B6AA 3RMDA 1EETA 1NJYA 1HNVA 2FBTA 5C25A 3V4IA 3OYCA 2HHUA 2HHVA 1KRPA 3I0SA 5KI6A 4AHUA 1ASUA 3KK3A 1NK9A 2HVIA 5J1EA 1NK5A 2A1RA 3P1GA 3THVA 2ETJA 3AVHA 2A1SA 1REVA 2RF2A 4O4GA 3LWLA 1UWBA 2XY7A 2G8VA 3TAGA 3DLRA 1D8YA 4HTUA 1RTDA 5CZ2A 4OPJA 4CEBA 4FVMA 4R5PA 2W42A 3SQ4A 1L3SA 4FJXA 2F8SA 4Z4IA 1BIUA 3CQ8A 1TK8A 4IG3A 1N5YA 3LP1A 4FLXA 4BWMA 3V9ZA 2QXFA 1CXQA 3AVNA 1WAFA 4GMJB 3K2PA 1RT2A 3ZSVA 4DFKA 2Z1GA 3QETA 2XY8A 2XY5A 4C8MA 1RBSA 3WNEA 3RR8A 3C6TA 4FJ5A 2KTQA 4KHYA 4ID5A 1JLCA 2P5GA 4B3OA 4CIGA 3NGYA 5J2MA 2XRIA 3DYAA 4DSLA 4N76A 2DFEA 1L3UA 4M3UA 1JLAA 3SUPA 3BGRA 2ZE2A 4HHTA 1VRTA 2IGIA 1RBRA 1JLGA 3I0RA 1BI4B 1TKTA 3KJVA 4F4KA 1KTQA 2VG7A 3MEDA 4PQUA 4FJIA 2D5RA 3AVFA 3OJUA 4E7HA 4DSFA 3QEXA 3QIPA 4C8LA 3HP6A 1RCHA 1QSSA 1YVUA 3L2RA 4OVLA 3S3NA 4BWJA 3ITHA 3IRXA 1S6QA 4I9LA 4BDYA 4DLEA 4FJ8A 4F3TA 4AHCA 2HNYA 1NKBA 3NDKA 4N5SA 3T3FA 2X6SA 2Z1IA 4LY7A 2YHAA 1FK9A 3LP2A 4RW9A 4E7JA 3H08A 4DSEA 1IO2A 1JXEA 4K8XA 3O3FA 3RMBA 3F9KA 4J2AA 1IKYA 1QQCA 3KKRA 4FLZA 1U45A 5C24A 4I2PA 1TV6A 4FJMA 3OYEA 4DU4A 1RTIA 5K14A 3LZJA 4FK2A 4H8KA 4CK2A 3QLHA 4CK1A 4FJ7A 1CXUA 4KB1A 3B6PA 1G15A 1KVAA 2B5JA 3CFOA 5HRNA 4L8RB 4NCBA 3WNGA 4CJVA 1BHLA 1U47A 5C42A 4FLWA 3K5MA 4E0DA 3TAQA 4Q0BA 3LAKA 1S1WA 2D0CA 3AVCA 2OPRA 3RWUA 4FM1A 3JYTA 3LZIA 1KFDA 1BL3A 2DFFA 2LSNA 2RN2A 2ATQA 1LWEA 4CEOA 1LV5A 1VK0A 3DMJA 4BACA 4BDZA 2YKMA 4FW1A 3OYGA 1TKDA 4CHQA 1T8EA 3KKSA 1JLEA 5EU7A 1J9AA 3AVLA 2OPPA 3PUFA 4O55A 1Q9YA 4Z4HA 1GOBA 4KTWA 1VSHA 4Y1CA 3VA3A 3V9UA 4CGHA 4H4OA 3PX4A 2IC3A 4ZTFA 2G8HA 1TKZA 1QTMA 4CCHA 1SKWA 2OA8A 4CJ4A 1WAJA 3M8RA 4CJSA 1IKXA 3RRGA 2IOCA 4IG0A 4FJNA 3NFAA 2F96A 4CFAA 1LAWA 1FKOA 3OYDA 4DTNA 4CJEA 3ZSOA 2D0BA 4UQGA 4HCBA 4E7KA 1Q8IA 4HUFA 3S9HA 4M3TA 4DQSA 2QKBA 3VQPA 1U4BA 1FXXA 1L3VA 2B4JA 3T19A 4E1MA 3MXMA 4C8OA 5FRNA 3PO4A 3DRSA 4DFJA 4M3RA 3LAMA 4ICLA 4CJWA 3ZCMA 5SWMA 3HVRA 2AJQA 1U48A 1TL1A 1S1UA 3SQ2A 4KO0A 2BANA 1NK4A 3VQ5A 1RTJA 4FCYA 4DQQA 3VQ7A 3AO3A 1HJRA 1HYZA 1JLQA 3KK2A 4DTJA 5HRSA 4AILC 3ISNC 5FDLA 4EP4A 4DTUA 1Z25A 3D0PA 4EZ6A 5FROA 4LH5A 3KTQA 4E7LA 2KZZA 1S1TA 3ASMA 5HROA 3VQEA 3LPTA 4E3SA 4NYFA 3AO2A 3OS0A 4DTOA 3PY8A 3V81A 2KW4A 4JRQA 1RBUA 3ZSXA 1W9HA 1EP4A 4FZZA 1TVRA 2D0AA 3HT3A 1WN7A 3SUQA 3L2UA 1RT5A 3NCIA 1ITGA 3NAEA 3NF6A 2O4GA 3AO4A 1EX4A 1NK0A 2YKNA 4CEDA 2VG6A 3L8BA 4F3OA 1XHZA 1VSFA 2NUBA 1WSGA 4Q5VA 1JXBA 3PV8A 2HHQA 4E89A 2X74A 1W0HA 3EZ5A 3V9XA 2VWJA 5J2QA 3IAYA 3QEVA 3HL8A 3KLIA 4W5OA 3PX0A 3MAQA 4FLVA 3QEWA 3CM5A 4DFPA 4AH9A 4FK0A 2HW3A 2HHSA 1I39A 1KFSA 4J2BA 4RW8A 3L2VA 4CF1A 5T7BA 4J2EA 1S5JA 1XC9A 1SKRA 4B8AB 1R0AA 4CE9A 4KREA 4RW4A 4FJGA 4CGIA 4FJHA 1IH7A 1RTHA 3V9WA 3O3HA 1NK7A 2YNFA 3JSMA 4FZYA 4I2QA 3L2QA 4FK4A 1A5WA 2KFZA 4RW7A 3PX6A 5KTQA 3KIOA 3NH0A 2G8WA 3V1RA 4FJJA 1QE1A 4FJ9A 4JRPA 1SUQA 4WE1A 4DSJA 1KVBA 2E4LA 1D9FA 4IFVA 3V6DA 4OPKA 1JLFA 2HVHA 4B9LA 3C95A 2QKKA 4IDKA 3AVKA 4CGJA 1NOYA 1EKEA 4DLGA 4B9NA 4DTMA 2ZD1A 3MECA 1UA1A 4DTXA 2EX3A 3F73A 1RILA 4CIFA 3VA0A 1NKEA 1NKCA 4ELVA 4DMNA 4KPYA 1X9WA 3TI0A 3OYHA 5FRMA 1RT3A 2FBXA 2Q3SA 3L3VA 2OZSA 4F8RA 4NCGA 3PO5A 3KD1E 4EZ9A 3KLGA 4CFDA 3VN5A 3NH1A 4KTZA 3KK1A 2Y1IA 4CHPA 2HMIA 1TL3A 3M8PA 2BGGA 4FZXC 5JS1A 4PY5A 3NGIA 1VRUA 1VSKA 4M3YA 4AHRA 4F2SA 3RMAA 3NE6A 3MXJA 4GVMA 1C0TA 5HRRA 3OYIA 1SL2A 4CF2A 1X9SA 4CF0A 4JS4A 4ZTJA 4CJ5A 3OS2A 3K5NA 3SNNA 2EHGA 4CEQA 4IBNA 1TGOA 1WSJA 2OPSA 5HLFA 3RR7A 1BCMA 1U04A 1ZBUA 4KHUA 4JS5A 3ZSWA 4CJRA 1JL1A 4N41A 3HYFA 4MFBA 1ZBLA 4PUOA 2Z1JA 3DOKA 4LH4A 4M42A 2I5JA 3M8QA 1IG9A 3AVAA 2DY4A 4KHNA 1HMVA 3AO1A 3HM9A 3TAPA 2G8FA 3AV9A 3MEGA 1BIZA 5SZTA 2HB5A 4CEEA 1S1VA 2IS3A 3SUNA 1HYVA 1B9DA 4CFBA 5E41A 3OYJA 2PZSA 3KLEA 1Z26A 1VSMA 1B92A 3AA2A 5HRPA 3TABA 1T03A 4OJRA 4B9UA 1TKXA 2FC0A 3NHGA 4KI4A 3IS9A 4OGEA 4CERA 4ELTA 1S9EA 2RPIA 3AVGA 3CG7A 4LD0A 1XI1A 3VQ6A 4CJKA 4W5QA 3AO5A 4KI6A 4KHSA 3AA3A 5CYMA 4Z0UA 4DWIA 3HJFA 1FKPA 3SQ1A 1CZBA 3VQAA 3MEEA 2R7YA 3HK2A 4DSIA 1J54A 3OS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K5O A;  1B9F A;  1TAQ A;  3RRH A;  2XY6 A;  4KV8 A;  4TSX A;  4DQI A;  4HUG A;  4N47 A;  4FM0 A;  3NF7 A;  1J53 A;  4CHO A;  2KZM A;  1C1C A;  3DLG A;  4B9T A;  4DS4 A;  3TR8 A;  3OVN A;  1LWC A;  3U3Y A;  3DRP A;  1QSY A;  3QER A;  1DTT A;  1QS4 A;  1RNH A;  3ZT2 A;  1X1P A;  3DLH A;  4NYN A;  3AA4 A;  3VQQ A;  4CES A;  4FJL A;  4DSK A;  4I9Q A;  4DTS A;  2YV0 X;  1KLM A;  1SKS A;  4CJQ A;  3QIO A;  4XIU A;  3AVM A;  3BDP A;  3VQ9 A;  3EYZ A;  4FLY A;  1GOC A;  1LWF A;  1ZBH A;  4BE1 A;  1T7P A;  1HQE A;  3SQ0 A;  3OYN A;  3ZSZ A;  4M45 A;  4FJK A;  2HNZ A;  3D45 A;  1C1A A;  3C94 A;  3DRR A;  2JGU A;  3VQ4 A;  4YFU A;  1Y97 A;  3EY1 A;  5I3U A;  3L2W A;  3SI6 A;  2OYQ A;  1C0M A;  3TWH A;  3G0Z A;  2HHW A;  2WOM A;  4Z4E A;  4CEA A;  1LW2 A;  3CFP A;  2PY5 A;  1KCF A;  2P5O A;  2JLE A;  4JLH A;  2HHT A;  2O4I A;  1TAU A;  4G1Q A;  4MQ3 A;  4QAG A;  3HPG A;  4CGF A;  4DG1 A;  4YNQ A;  3KLH A;  3K5L A;  4BE0 A;  3MXI A;  1NK6 A;  1U49 A;  4KTQ A;  1UA0 A;  4RW6 A;  3O4Q A;  3LP3 A;  4O44 A;  4HUE A;  3LDS A;  4CEZ A;  5KGW A;  1WLJ A;  2RKI A;  2F8T A;  3ZT3 A;  4C8K A;  4CEC A;  1CLQ A;  1HPZ A;  4E1N A;  3HO1 A;  4DQP A;  1LW0 A;  1VSD A;  3E01 A;  4BE2 A;  4CJF A;  4DQR A;  3S3O A;  2G8U A;  2VWK A;  2P1J A;  4CK3 A;  5J2P A;  1A5X A;  1D9D A;  4KKO A;  1YTA A;  5CY4 A;  4DF8 A;  3QEP A;  4O0I A;  2XO7 A;  3QEI A;  4J2D A;  1HRH A;  1HNI A;  1BGX T;  5DMR A;  3TAE A;  3RMC A;  2G8K A;  4M41 A;  3UIQ A;  1K6Y A;  1C0U A;  3A2F A;  3HVT A;  1NJW A;  4KB0 A;  4CHZ A;  3SZ2 A;  3DLE A;  3SV4 A;  3OYM A;  3DOL A;  1TK5 A;  3LPU A;  1YT3 A;  1D5A A;  4FM2 A;  3AVB A;  1NK8 A;  3HPO A;  3L3U A;  2BDP A;  3IG1 A;  1SL1 A;  2ZQB A;  3ZT1 A;  3DM2 A;  3K58 A;  4PWD A;  1C1B A;  3TAR A;  3VQ8 A;  1NOZ A;  3U3G A;  4O5B A;  3QES A;  1S6P A;  3C6U A;  4I7F A;  1RT7 A;  1VSE A;  1QHT A;  2PYJ A;  1IKW A;  3M8S A;  4KFB A;  3CM6 A;  4CHY A;  3OYF A;  4DF4 A;  3VQB A;  1KLN A;  3KD5 E;  2G8I A;  4CEF A;  2YNI A;  3G10 A;  4OGC A;  1WNS A;  1ASV A;  1RT4 A;  4O0J A;  1RDA A;  2FBV A;  2DFH A;  3P83 D;  3QIN A;  4GW6 A;  2KFN A;  1EXQ A;  4ELU A;  1TK0 A;  4B9S A;  4ZHR A;  3LAL A;  4B9M A;  4Z4C A;  5I42 A;  3LP0 A;  3V9S A;  4CF9 A;  4AHV A;  1MU2 A;  4W5T A;  2GV9 A;  1C6V A;  4M3W A;  3SJJ A;  3QNN A;  3TAN A;  1DLO A;  1XWL A;  3FFI A;  1BQM A;  3AVJ A;  4LSN A;  3OJS A;  4DU1 A;  2X78 A;  4HCC A;  5HP1 A;  1J5O A;  2YHB A;  3VQD A;  1ZBI A;  3OYK A;  3SCX A;  3U6F A;  3LWM A;  3ZT0 A;  4CJU A;  2IDO A;  1Q9X A;  1A5V A;  4FLU A;  5J2N A;  3CYM A;  1RBV A;  3HXM A;  4B08 A;  1L5U A;  4CJL A;  4DU3 A;  2Z1H A;  3O4N A;  3K57 A;  2QK9 A;  2E6L A;  4Z4F A;  1CZ9 A;  1WSI A;  2VG5 A;  3B6O A;  1JLB A;  1UAX A;  4ID1 A;  4KHQ A;  1HYS A;  3HST B;  4E19 A;  4FXD A;  1BIS A;  3DI6 A;  3LAN A;  4FW2 A;  4OKJ A;  3HP9 A;  4Y1D A;  3TAM A;  1T05 A;  4KRF A;  1S9G A;  4CHN A;  4QCL A;  1GOA A;  3ZSR A;  1BCO A;  1BQN A;  4IKF A;  1KSP A;  1DTQ A;  1YTU A;  1NJZ A;  1JL2 A;  4CIE A;  3DLB A;  1VSL A;  4M3X A;  5KGX A;  3ULD A;  4CGG A;  5KRT A;  4N56 A;  3VQC A;  1RT6 A;  3QNO A;  4BDP A;  5D3G A;  1WSF A;  4DFM A;  5CZ1 A;  1JKH A;  1WSH A;  2HND A;  4AHS A;  2PYL A;  4FYD A;  2YNH A;  3SUO A;  1ZYQ A;  1RDD A;  4RG8 A;  2KQ2 A;  3OY9 A;  2ITG A;  5DK5 A;  3OYB A;  4DTR A;  1N6Q A;  4IFY A;  4QOZ B;  4DTP A;  3NGZ A;  3QO9 A;  3CFR A;  2OPQ A;  3K59 A;  4OLB A;  4CJ3 A;  2DTU A;  3V1Q A;  3RTV A;  1KVC A;  1RDB A;  4OKK A;  3NH2 A;  2P51 A;  3HPH A;  4CGD A;  2YNG A;  1F21 A;  4EP5 A;  3SV3 A;  1UOC A;  3S3M A;  4CJT A;  4KAZ A;  1IKV A;  1RT1 A;  3ZT4 A;  4W5R A;  5JS2 A;  3SPZ A;  4M3Z A;  5CYQ A;  3ZSY A;  4F2R A;  2HHX A;  5HBM A;  4OKE A;  1SL0 A;  2XHB A;  4CFC A;  4OLA A;  3AA5 X;  4LSL A;  2BE2 A;  1XHX A;  1ZBF A;  3P5J A;  2FBY A;  2E6M A;  3NF8 A;  4KHW A;  1HQU A;  4FLT A;  1WSE A;  3O3G A;  3OYL A;  4CF8 A;  3ALY A;  4CJP A;  1BI4 A;  1VSI A;  3V1O A;  4PA1 A;  1SV5 A;  1S1X A;  3T1A A;  3OYA A;  1ASW A;  1L3T A;  5KRS A;  2Y1J A;  4K8Z A;  3AVI A;  1LAV A;  2GBZ A;  3WNF A;  4HVJ A;  3NBP A;  4DS5 A;  2WON A;  1VSJ A;  4B8C A;  1QSL A;  3NF9 A;  1X9M A;  4AHT A;  3I8D A;  3TAF A;  2OZM A;  3SPY A;  4W5N A;  1RDC A;  3KLF A;  1I3A A;  3SYZ A;  4E7I A;  3WNH A;  1RBT A;  2X6N A;  2IAJ A;  3ZSQ A;  1O1W A;  1NJX A;  2GUI A;  4H4M A;  3DLK A;  4B9V A;  4C8N A;  4NCA A;  4Z4G A;  2B6A A;  3RMD A;  1EET A;  1NJY A;  1HNV A;  2FBT A;  5C25 A;  3V4I A;  3OYC A;  2HHU A;  2HHV A;  1KRP A;  3I0S A;  5KI6 A;  4AHU A;  1ASU A;  3KK3 A;  1NK9 A;  2HVI A;  5J1E A;  1NK5 A;  2A1R A;  3P1G A;  3THV A;  2ETJ A;  3AVH A;  2A1S A;  1REV A;  2RF2 A;  4O4G A;  3LWL A;  1UWB A;  2XY7 A;  2G8V A;  3TAG A;  3DLR A;  1D8Y A;  4HTU A;  1RTD A;  5CZ2 A;  4OPJ A;  4CEB A;  4FVM A;  4R5P A;  2W42 A;  3SQ4 A;  1L3S A;  4FJX A;  2F8S A;  4Z4I A;  1BIU A;  3CQ8 A;  1TK8 A;  4IG3 A;  1N5Y A;  3LP1 A;  4FLX A;  4BWM A;  3V9Z A;  2QXF A;  1CXQ A;  3AVN A;  1WAF A;  4GMJ B;  3K2P A;  1RT2 A;  3ZSV A;  4DFK A;  2Z1G A;  3QET A;  2XY8 A;  2XY5 A;  4C8M A;  1RBS A;  3WNE A;  3RR8 A;  3C6T A;  4FJ5 A;  2KTQ A;  4KHY A;  4ID5 A;  1JLC A;  2P5G A;  4B3O A;  4CIG A;  3NGY A;  5J2M A;  2XRI A;  3DYA A;  4DSL A;  4N76 A;  2DFE A;  1L3U A;  4M3U A;  1JLA A;  3SUP A;  3BGR A;  2ZE2 A;  4HHT A;  1VRT A;  2IGI A;  1RBR A;  1JLG A;  3I0R A;  1BI4 B;  1TKT A;  3KJV A;  4F4K A;  1KTQ A;  2VG7 A;  3MED A;  4PQU A;  4FJI A;  2D5R A;  3AVF A;  3OJU A;  4E7H A;  4DSF A;  3QEX A;  3QIP A;  4C8L A;  3HP6 A;  1RCH A;  1QSS A;  1YVU A;  3L2R A;  4OVL A;  3S3N A;  4BWJ A;  3ITH A;  3IRX A;  1S6Q A;  4I9L A;  4BDY A;  4DLE A;  4FJ8 A;  4F3T A;  4AHC A;  2HNY A;  1NKB A;  3NDK A;  4N5S A;  3T3F A;  2X6S A;  2Z1I A;  4LY7 A;  2YHA A;  1FK9 A;  3LP2 A;  4RW9 A;  4E7J A;  3H08 A;  4DSE A;  1IO2 A;  1JXE A;  4K8X A;  3O3F A;  3RMB A;  3F9K A;  4J2A A;  1IKY A;  1QQC A;  3KKR A;  4FLZ A;  1U45 A;  5C24 A;  4I2P A;  1TV6 A;  4FJM A;  3OYE A;  4DU4 A;  1RTI A;  5K14 A;  3LZJ A;  4FK2 A;  4H8K A;  4CK2 A;  3QLH A;  4CK1 A;  4FJ7 A;  1CXU A;  4KB1 A;  3B6P A;  1G15 A;  1KVA A;  2B5J A;  3CFO A;  5HRN A;  4L8R B;  4NCB A;  3WNG A;  4CJV A;  1BHL A;  1U47 A;  5C42 A;  4FLW A;  3K5M A;  4E0D A;  3TAQ A;  4Q0B A;  3LAK A;  1S1W A;  2D0C A;  3AVC A;  2OPR A;  3RWU A;  4FM1 A;  3JYT A;  3LZI A;  1KFD A;  1BL3 A;  2DFF A;  2LSN A;  2RN2 A;  2ATQ A;  1LWE A;  4CEO A;  1LV5 A;  1VK0 A;  3DMJ A;  4BAC A;  4BDZ A;  2YKM A;  4FW1 A;  3OYG A;  1TKD A;  4CHQ A;  1T8E A;  3KKS A;  1JLE A;  5EU7 A;  1J9A A;  3AVL A;  2OPP A;  3PUF A;  4O55 A;  1Q9Y A;  4Z4H A;  1GOB A;  4KTW A;  1VSH A;  4Y1C A;  3VA3 A;  3V9U A;  4CGH A;  4H4O A;  3PX4 A;  2IC3 A;  4ZTF A;  2G8H A;  1TKZ A;  1QTM A;  4CCH A;  1SKW A;  2OA8 A;  4CJ4 A;  1WAJ A;  3M8R A;  4CJS A;  1IKX A;  3RRG A;  2IOC A;  4IG0 A;  4FJN A;  3NFA A;  2F96 A;  4CFA A;  1LAW A;  1FKO A;  3OYD A;  4DTN A;  4CJE A;  3ZSO A;  2D0B A;  4UQG A;  4HCB A;  4E7K A;  1Q8I A;  4HUF A;  3S9H A;  4M3T A;  4DQS A;  2QKB A;  3VQP A;  1U4B A;  1FXX A;  1L3V A;  2B4J A;  3T19 A;  4E1M A;  3MXM A;  4C8O A;  5FRN A;  3PO4 A;  3DRS A;  4DFJ A;  4M3R A;  3LAM A;  4ICL A;  4CJW A;  3ZCM A;  5SWM A;  3HVR A;  2AJQ A;  1U48 A;  1TL1 A;  1S1U A;  3SQ2 A;  4KO0 A;  2BAN A;  1NK4 A;  3VQ5 A;  1RTJ A;  4FCY A;  4DQQ A;  3VQ7 A;  3AO3 A;  1HJR A;  1HYZ A;  1JLQ A;  3KK2 A;  4DTJ A;  5HRS A;  4AIL C;  3ISN C;  5FDL A;  4EP4 A;  4DTU A;  1Z25 A;  3D0P A;  4EZ6 A;  5FRO A;  4LH5 A;  3KTQ A;  4E7L A;  2KZZ A;  1S1T A;  3ASM A;  5HRO A;  3VQE A;  3LPT A;  4E3S A;  4NYF A;  3AO2 A;  3OS0 A;  4DTO A;  3PY8 A;  3V81 A;  2KW4 A;  4JRQ A;  1RBU A;  3ZSX A;  1W9H A;  1EP4 A;  4FZZ A;  1TVR A;  2D0A A;  3HT3 A;  1WN7 A;  3SUQ A;  3L2U A;  1RT5 A;  3NCI A;  1ITG A;  3NAE A;  3NF6 A;  2O4G A;  3AO4 A;  1EX4 A;  1NK0 A;  2YKN A;  4CED A;  2VG6 A;  3L8B A;  4F3O A;  1XHZ A;  1VSF A;  2NUB A;  1WSG A;  4Q5V A;  1JXB A;  3PV8 A;  2HHQ A;  4E89 A;  2X74 A;  1W0H A;  3EZ5 A;  3V9X A;  2VWJ A;  5J2Q A;  3IAY A;  3QEV A;  3HL8 A;  3KLI A;  4W5O A;  3PX0 A;  3MAQ A;  4FLV A;  3QEW A;  3CM5 A;  4DFP A;  4AH9 A;  4FK0 A;  2HW3 A;  2HHS A;  1I39 A;  1KFS A;  4J2B A;  4RW8 A;  3L2V A;  4CF1 A;  5T7B A;  4J2E A;  1S5J A;  1XC9 A;  1SKR A;  4B8A B;  1R0A A;  4CE9 A;  4KRE A;  4RW4 A;  4FJG A;  4CGI A;  4FJH A;  1IH7 A;  1RTH A;  3V9W A;  3O3H A;  1NK7 A;  2YNF A;  3JSM A;  4FZY A;  4I2Q A;  3L2Q A;  4FK4 A;  1A5W A;  2KFZ A;  4RW7 A;  3PX6 A;  5KTQ A;  3KIO A;  3NH0 A;  2G8W A;  3V1R A;  4FJJ A;  1QE1 A;  4FJ9 A;  4JRP A;  1SUQ A;  4WE1 A;  4DSJ A;  1KVB A;  2E4L A;  1D9F A;  4IFV A;  3V6D A;  4OPK A;  1JLF A;  2HVH A;  4B9L A;  3C95 A;  2QKK A;  4IDK A;  3AVK A;  4CGJ A;  1NOY A;  1EKE A;  4DLG A;  4B9N A;  4DTM A;  2ZD1 A;  3MEC A;  1UA1 A;  4DTX A;  2EX3 A;  3F73 A;  1RIL A;  4CIF A;  3VA0 A;  1NKE A;  1NKC A;  4ELV A;  4DMN A;  4KPY A;  1X9W A;  3TI0 A;  3OYH A;  5FRM A;  1RT3 A;  2FBX A;  2Q3S A;  3L3V A;  2OZS A;  4F8R A;  4NCG A;  3PO5 A;  3KD1 E;  4EZ9 A;  3KLG A;  4CFD A;  3VN5 A;  3NH1 A;  4KTZ A;  3KK1 A;  2Y1I A;  4CHP A;  2HMI A;  1TL3 A;  3M8P A;  2BGG A;  4FZX C;  5JS1 A;  4PY5 A;  3NGI A;  1VRU A;  1VSK A;  4M3Y A;  4AHR A;  4F2S A;  3RMA A;  3NE6 A;  3MXJ A;  4GVM A;  1C0T A;  5HRR A;  3OYI A;  1SL2 A;  4CF2 A;  1X9S A;  4CF0 A;  4JS4 A;  4ZTJ A;  4CJ5 A;  3OS2 A;  3K5N A;  3SNN A;  2EHG A;  4CEQ A;  4IBN A;  1TGO A;  1WSJ A;  2OPS A;  5HLF A;  3RR7 A;  1BCM A;  1U04 A;  1ZBU A;  4KHU A;  4JS5 A;  3ZSW A;  4CJR A;  1JL1 A;  4N41 A;  3HYF A;  4MFB A;  1ZBL A;  4PUO A;  2Z1J A;  3DOK A;  4LH4 A;  4M42 A;  2I5J A;  3M8Q A;  1IG9 A;  3AVA A;  2DY4 A;  4KHN A;  1HMV A;  3AO1 A;  3HM9 A;  3TAP A;  2G8F A;  3AV9 A;  3MEG A;  1BIZ A;  5SZT A;  2HB5 A;  4CEE A;  1S1V A;  2IS3 A;  3SUN A;  1HYV A;  1B9D A;  4CFB A;  5E41 A;  3OYJ A;  2PZS A;  3KLE A;  1Z26 A;  1VSM A;  1B92 A;  3AA2 A;  5HRP A;  3TAB A;  1T03 A;  4OJR A;  4B9U A;  1TKX A;  2FC0 A;  3NHG A;  4KI4 A;  3IS9 A;  4OGE A;  4CER A;  4ELT A;  1S9E A;  2RPI A;  3AVG A;  3CG7 A;  4LD0 A;  1XI1 A;  3VQ6 A;  4CJK A;  4W5Q A;  3AO5 A;  4KI6 A;  4KHS A;  3AA3 A;  5CYM A;  4Z0U A;  4DWI A;  3HJF A;  1FKP A;  3SQ1 A;  1CZB A;  3VQA A;  3MEE A;  2R7Y A;  3HK2 A;  4DSI A;  1J54 A;  3OS1 A; 
#chains in the Genus database with same CATH topology
 4GVE A;  1IBL K;  2E2O A;  3RRH A;  4TSX A;  2KZM A;  4FWN A;  4DS4 A;  3DRP A;  2GX9 A;  3QER A;  4I6M A;  1N32 K;  1BG3 A;  4FJL A;  5F0X A;  1KLM A;  4XIU A;  3BDP A;  3VES A;  2ZGY A;  4M45 A;  4EAH D;  1VQO N;  3MCA B;  2WOM A;  2P5O A;  2JLE A;  1U2V B;  2O4I A;  3KLH A;  4LF6 K;  1NK6 A;  1UA0 A;  4LFC K;  3SAF A;  3ENB A;  3H6E A;  3FLC O;  3ZT3 A;  4C8K A;  2E2N A;  3HO1 A;  4CK3 A;  2P1J A;  5AFU H;  1YF5 L;  3ZX3 A;  3QEI A;  4J2D A;  4JI2 K;  1BGX T;  4E1J A;  4M41 A;  3A2F A;  4KB0 A;  4CHZ A;  3ENH A;  2WTU A;  3DOL A;  1TK5 A;  2GUP A;  1D5A A;  3AVB A;  3PSF A;  5JLH A;  3HPO A;  2BDP A;  3IG1 A;  5AQN A;  3HOT A;  4PWD A;  3WQU A;  1Q18 A;  1HJO A;  4O5B A;  3C6U A;  4I7F A;  1VSE A;  3G6E N;  3CCQ N;  1IKW A;  4CHY A;  4DF4 A;  1KLN A;  3VEX A;  4BG9 A;  1ASV A;  1RT4 A;  2FBV A;  2DFH A;  4JEP A;  4ZHR A;  4B9M A;  4Z4C A;  3W3D A;  4W5T A;  1DLO A;  1XWL A;  4H03 B;  2OAN A;  3AVJ A;  4LSN A;  3OJS A;  1QZ6 A;  4HCC A;  2X78 A;  1ZBI A;  1NGB A;  3U6F A;  4FLU A;  4FWR A;  3FZM A;  4YDU A;  1EQY A;  3QB0 A;  1L5U A;  2Q0R A;  2Z1H A;  3K57 A;  1XUP O;  1SQK A;  4NXN K;  1JLB A;  5GIO A;  3KK7 A;  4Y1D A;  3TAM A;  3HP9 A;  1S9G A;  4H0T B;  4DHY A;  3BEX A;  4JKG B;  4IWV A;  2D0O A;  4LFA K;  1NJZ A;  4B3M K;  4CIE A;  3DLB A;  4JKD A;  1RT6 A;  3O9Q A;  1WSF A;  1JKH A;  2IIR A;  2PYL A;  1RDD A;  4CVN E;  4YOU A;  2VCP A;  2NRW A;  3UB5 A;  1HNZ K;  1YXQ A;  4BRN A;  4OLB A;  3HRG A;  4OKK A;  2P51 A;  3BZC A;  4CGD A;  1W7A A;  1IKV A;  3ZT4 A;  5JS2 A;  4F9O A;  3SPZ A;  1VQ5 N;  4F2R A;  3VER A;  2O8E A;  2Q36 A;  2ZF5 O;  1SL0 A;  2XHB A;  4LSL A;  5AQK A;  3CCR N;  4GV3 A;  3N4P A;  3O5B A;  4FVU A;  5I9E B;  4IXC A;  3O3G A;  2P9L A;  2E2P A;  2WBN A;  3ALY A;  5HOO A;  1ASW A;  2Y1J A;  4B1U B;  1QQM A;  4B3S K;  1LAV A;  3NF9 A;  3I8D A;  3SPY A;  1RDC A;  3KLF A;  3D2F B;  3C6A A;  1RBT A;  2X6N A;  3OW2 M;  1NJX A;  4A57 A;  2I7N A;  4H4M A;  1BO5 O;  3DLK A;  4C8N A;  4NCA A;  2FBT A;  5C25 A;  1KRP A;  1ZXO A;  1ASU A;  3KK3 A;  1QQN A;  2NZT A;  2A1R A;  3H1Q A;  2F4V K;  4H5W A;  1QVF M;  2XY7 A;  5C0Y A;  4HTU A;  1YJN N;  2QK9 A;  4CEB A;  4FJX A;  4Z4I A;  4WFN L;  1TK8 A;  1E3M A;  4IG3 A;  4FLX A;  4BWM A;  2ZJP L;  1WAF A;  4GMJ B;  3K2P A;  3CCJ N;  3QET A;  3BF1 A;  3WNE A;  4OO1 J;  4FJ5 A;  2KTQ A;  4B3O A;  5J2M A;  2XRI A;  3DYA A;  4FO0 A;  3O9S A;  4M3U A;  2ZE2 A;  4HHT A;  3DJC A;  4DUZ K;  3WXM B;  3KJV A;  4F4K A;  1OH5 A;  1T6D A;  1BDG A;  3OJU A;  1S22 A;  4E7H A;  1BA0 A;  4C8L A;  3QIP A;  3JXU A;  1RGI A;  4OVL A;  3S3N A;  3IRX A;  1NGJ A;  4F3T A;  5IT9 O;  3O8M A;  4LF8 K;  3O9T A;  3EN9 A;  4N5S A;  2E5L K;  4LY7 A;  4RW9 A;  3H08 A;  3OTO K;  3P38 A;  1U45 A;  3R1X A;  3CPE A;  1HR0 K;  4CZE A;  3VF2 A;  1RTI A;  4CK2 A;  3MN9 A;  4FJ7 A;  3JAM O;  3CFO A;  4NCB A;  2P9N A;  4CJV A;  4Q0B A;  3LAK A;  2NRZ A;  3KHY A;  3KWI A;  2BH1 A;  4C1N I;  1BL3 A;  4CJ7 A;  3OYG A;  4KH4 A;  4H5N A;  3KKS A;  5EU7 A;  1J9A A;  4FWP A;  3PUF A;  4O55 A;  1TYQ B;  3NMU A;  4JI6 K;  4KTW A;  3P39 A;  3ENO A;  4CGH A;  3D6R A;  3PX4 A;  2KHO A;  1S3X A;  1TKZ A;  5LMN K;  2OA8 A;  4CJS A;  4FJN A;  4IG0 A;  1W97 L;  2V51 B;  4GV6 A;  4UQG A;  4HCB A;  2NRX A;  3VQP A;  4CZF A;  1L3V A;  2O8C A;  1JCE A;  1P8Z A;  3VF6 A;  3DRS A;  3FZL A;  4XH5 A;  3LAM A;  1MA9 B;  3U4L A;  3HVR A;  3FZK A;  1M90 O;  1GLF O;  1TL1 A;  4YOR A;  2BAN A;  3CC7 N;  5AQU A;  1RTJ A;  1P90 A;  3AO3 A;  1JLQ A;  4AIL C;  5FDL A;  3A5M C;  4BRL A;  3D0P A;  3VTI A;  4WFB L;  2KZZ A;  4MDB A;  3LDL A;  3OS0 A;  3V81 A;  4H5V A;  3HT3 A;  3SUQ A;  3L2U A;  3UKR B;  3NCI A;  1ITG A;  3NAE A;  3AO4 A;  1NK0 A;  3ZET B;  3L8B A;  3THX A;  1T44 A;  3F5T A;  4FWS A;  1WSG A;  4Q5V A;  1JXB A;  4HWI A;  4E89 A;  3EZ5 A;  4X65 K;  4H0Y B;  3VGK A;  3KLI A;  3PX0 A;  3MAQ A;  4OX9 K;  4AH9 A;  1NGG A;  1I39 A;  3CET A;  1KFS A;  1SKR A;  1HKB A;  4RCH A;  5BRE A;  4FJG A;  1N8R O;  4O8U A;  4FJH A;  1RTH A;  4OPA A;  3THW A;  1NK7 A;  1JCG A;  3VF4 A;  5BN8 A;  3PX6 A;  2VGM A;  4CZM A;  3NH0 A;  4FJ9 A;  3V1R A;  4JRP A;  4DSJ A;  2PFU A;  4WE1 A;  1KVB A;  3CJ1 A;  4OPK A;  1JLF A;  2ASP A;  3K0S A;  2QKK A;  1EKE A;  4B9N A;  4KBO A;  3G4S N;  1IJJ A;  2EX3 A;  1N33 K;  1RIL A;  4BY9 C;  5FPM A;  1X9W A;  5FRM A;  2Q3S A;  3L3V A;  3TSU A;  4NCG A;  3PO5 A;  3BY5 A;  4EZ9 A;  4CFD A;  2Y1I A;  3KK1 A;  4CHP A;  1TL3 A;  3M8P A;  5JS1 A;  4DUY K;  3FZF A;  3RMA A;  4BR2 A;  1YIJ N;  3LM9 A;  4GVM A;  2DPN A;  1SL2 A;  1X9S A;  4CEQ A;  1TGO A;  1U04 A;  1ZBU A;  5AQM A;  4CJR A;  4N41 A;  3EO3 A;  1J6Z A;  5FPE A;  2VWB A;  1U2V A;  3TAP A;  1NWK A;  1KAX A;  1BIZ A;  2F9T A;  5SZT A;  2HB5 A;  1S1V A;  1NM1 A;  3SUN A;  1HYV A;  4CFB A;  5E41 A;  1X3N A;  1B92 A;  3B8A X;  2FXU A;  2O8D B;  1NGA A;  4CW7 B;  4LD0 A;  3HOS A;  3DLL L;  3OBY A;  4KHS A;  5CYM A;  4DV7 K;  3SQ1 A;  2R7Y A;  1SAZ A;  4DSI A;  3K5O A;  2XY6 A;  4K43 A;  3NF7 A;  4PHT X;  3HBT A;  2NRT A;  3TR8 A;  1QSY A;  1H1V A;  1K8K B;  5KQD A;  3AGK A;  4NYN A;  3VQQ A;  1VQN N;  2YV0 X;  5H1S Q;  4CJQ A;  3QIO A;  5BN9 A;  3VQ9 A;  1VQ9 N;  2ITM A;  1HQE A;  3CJB A;  5TKY A;  2HNZ A;  3DRR A;  2JGU A;  3M1F A;  3L2W A;  3SI6 A;  2OYQ A;  3O9R A;  2HHW A;  1XNQ K;  4BRQ A;  4FOE A;  4DG1 A;  3MXI A;  4CGF A;  4BE0 A;  3E9L A;  3SBT A;  5M1Q A;  3I56 N;  3LP3 A;  2F8T A;  1DKG D;  1WLJ A;  2RKI A;  4CEC A;  5AQV A;  2V7Y A;  2F7T A;  2KLA A;  4DQP A;  1Q86 O;  1VSD A;  4BE2 A;  2G8U A;  2VWK A;  1Q82 O;  1A5X A;  4KKO A;  1YTA A;  5CY4 A;  1IG8 A;  3H3N O;  1HNI A;  5DMR A;  4V19 S;  1C0U A;  3HVT A;  1NJW A;  3TU5 A;  5GIN A;  3DLE A;  4JKG A;  3LPU A;  3L3U A;  1SL1 A;  3EKU A;  1XC3 A;  1WUA A;  3TAR A;  4KH5 A;  3ZX2 A;  1QHT A;  5AQZ A;  1N36 K;  3CCV N;  3O4W A;  3CJC A;  4CEF A;  4O0J A;  5AQO A;  1EXQ A;  1EWR A;  4B9S A;  3DWL A;  2NLX A;  3LAL A;  3LP0 A;  4CF9 A;  4AHV A;  1C6V A;  3ATU A;  3QNN A;  3G25 A;  2YHB A;  3VQD A;  3SCX A;  3CHW A;  3ZT0 A;  5KPT A;  2IDO A;  1A5V A;  5J2N A;  3CYM A;  3HXM A;  3HTV A;  5JVG L;  3O4N A;  1CZ9 A;  2Q1N A;  3MMV A;  4BR0 A;  4ID1 A;  4QS9 A;  4KHQ A;  4E19 A;  4YOT A;  3LAN A;  4FW2 A;  3THY B;  4KRF A;  4HTL A;  4QCL A;  4WQ4 A;  3ZSR A;  3D2F A;  1JL2 A;  5LJW A;  3J8A A;  5KGX A;  4BC3 A;  4CGG A;  4LF7 K;  3QNO A;  3QML A;  3LM2 A;  5CZ1 A;  4JK9 A;  4FPA A;  4JKB A;  2YNH A;  3HI0 A;  3M5R A;  3L6Q A;  2KQ2 A;  5DK5 A;  4DTR A;  4IFY A;  3WQT A;  4QOZ B;  4DTP A;  3NGZ A;  4M7X A;  3CFR A;  4CZL A;  5EVZ A;  4BRM A;  4CJ3 A;  2E88 A;  4JKF A;  3V1Q A;  4A2B A;  1KVC A;  2HBL A;  2YNG A;  3S3M A;  1UOC A;  5BPN A;  4YDU C;  4CJT A;  4KAZ A;  4BC5 A;  2HHH K;  5HBM A;  5M1K A;  1FJG K;  5AQR A;  2VQF K;  4OKE A;  2BE2 A;  1XHX A;  4YHH K;  3NF8 A;  1JCF A;  4B9Q A;  1JJ2 M;  5AR0 A;  5AQF A;  4FLT A;  4KHW A;  1YUW A;  4IOX A;  3WXL A;  5BPM A;  4DR7 K;  2CGK A;  4CBW A;  1SZ2 A;  4H0O A;  4HVJ A;  2WON A;  1VSJ A;  4CI6 A;  4B8C A;  4X64 K;  2CH5 A;  4AHT A;  4PL7 A;  4W5N A;  4JKE A;  4ILH A;  4A5B A;  4JHD B;  3ZSQ A;  1BA1 A;  4JI0 K;  2B6A A;  3RMD A;  3SK3 A;  5JVH L;  2YHX A;  1K8A O;  3I0S A;  5KI6 A;  3GL1 A;  2P9S B;  4PKI A;  2HVI A;  4GY2 B;  1VHX A;  2QTD A;  4CD1 A;  5C2F A;  4O4G A;  1UWB A;  2QWM A;  3TAG A;  5EY4 A;  3DLR A;  5C15 A;  2HST A;  3CCE N;  5CZ2 A;  3SQ4 A;  2W42 A;  2UU9 K;  4JI5 K;  2QXF A;  3ZSV A;  2XY8 A;  1NBW A;  4ID5 A;  1TYQ A;  2HBK A;  4N76 A;  2DFE A;  3TTC A;  2H3G X;  4BR5 A;  1RBR A;  3I0R A;  1BI4 B;  1TKT A;  4PQU A;  2VG7 A;  5AZJ B;  1WBB A;  4FJI A;  3AVF A;  4NLC A;  4Y0W A;  3HM8 A;  4BWJ A;  1ATS A;  1S6Q A;  1NLV A;  3VMF B;  1S72 N;  3AAQ A;  4AHC A;  1NKB A;  3T3F A;  2X6S A;  4ILG B;  5FPN A;  2YHA A;  3LP2 A;  3JS6 A;  2NNW A;  3Q7B A;  4DSE A;  1VQ4 N;  1IO2 A;  4K8X A;  2JWK A;  4K0K K;  5AQH A;  4J2A A;  2NRR A;  1IKY A;  1QQC A;  5C24 A;  4I2P A;  3FGU A;  3OYE A;  2P9U B;  5FLX O;  4CK1 A;  2UYT A;  4H5R A;  4JK7 A;  1ZC6 A;  2B5J A;  1VQ6 N;  1QZ5 A;  3WXI A;  1BHL A;  5C42 A;  1HPM A;  3K5M A;  3TAQ A;  1D4X A;  3RWU A;  3O08 A;  3UKR A;  2IVP A;  3VEV A;  3HZ6 A;  3ZET A;  2ATQ A;  1VK0 A;  4LF4 K;  4BAC A;  4BDZ A;  1TKD A;  4FW1 A;  4CHQ A;  3NVK A;  3AVL A;  2O8F B;  5M1O A;  1GLA G;  1HUX A;  4BQL A;  3L4Q A;  3V9U A;  3CC4 N;  4CCH A;  4CJ4 A;  2HBJ A;  1IKX A;  2IOC A;  3NFA A;  3O1B A;  1FKO A;  3D2E B;  3MX2 A;  3ZSO A;  4M3T A;  3S9H A;  4B1V A;  4ISG A;  1U4B A;  1FXX A;  2B4J A;  3GBT A;  4C8O A;  4BC2 A;  3CCM N;  2P9K B;  3ZCM A;  5SWM A;  2W6L A;  3M6G A;  1HNX K;  4IDH A;  1NK4 A;  4IOA L;  3GE1 A;  4ISE A;  4JI3 K;  3R3L A;  3VQ7 A;  1HYZ A;  3O9U A;  4AM7 A;  3ISN C;  2UUB K;  4JAX A;  2E1Y A;  4E7L A;  4JI8 K;  3GOI A;  1SS6 A;  3QBW A;  1MWM A;  2A42 A;  1YJW N;  5DM6 L;  3LDO A;  4JRQ A;  3MN6 A;  3ZSX A;  1W9H A;  1TVR A;  1WN7 A;  4BVO A;  4YOY A;  3ID6 A;  4FWQ A;  4JI4 K;  3CCL N;  2QWR A;  1XHZ A;  2NUB A;  3PV8 A;  3E9O A;  4DR6 K;  3QEV A;  3HL8 A;  4DFP A;  2V7Z A;  4EHT A;  4RW8 A;  1BOT O;  4CF1 A;  2V52 B;  1XC9 A;  4CZI A;  4CZH A;  1ILY A;  4CGI A;  3A8Y A;  2P9P B;  3CF5 L;  3O1W A;  1A5W A;  2IVO A;  3EE9 A;  5KTQ A;  1QVG M;  2G8W A;  4FJJ A;  4DV4 K;  1GLC G;  2OCE A;  4BC4 A;  1BU6 O;  4BRE A;  3C95 A;  1Q7Y O;  1DEJ A;  3E9P A;  1NOY A;  4C23 A;  3A5L C;  3R9P A;  4DTM A;  2ZD1 A;  3MEC A;  4WQ5 C;  1UA1 A;  3F73 A;  1GLJ O;  4CIF A;  1NKE A;  4ELV A;  1WOQ A;  4KPY A;  3OYH A;  2FBX A;  3MK6 A;  3KVG A;  4FL9 A;  4F8R A;  4H0V B;  1NJI O;  1Z6R A;  3NH1 A;  1K8K A;  5LJV A;  4PY5 A;  1VRU A;  4YOV A;  3MXJ A;  1C0T A;  2UXB K;  4JS4 A;  4CZG A;  3SNN A;  3TTD A;  4KHU A;  1BCM A;  4YY3 K;  4JS5 A;  5AQI A;  1JL1 A;  5GAE P;  3DOK A;  4M42 A;  3M8Q A;  3AO1 A;  2HMP A;  3HM9 A;  2G8F A;  1W2B M;  3AV9 A;  2QWQ A;  4IO9 L;  3CCU N;  3KLE A;  2RE2 A;  2YX6 A;  1T03 A;  3O6W A;  5IWA K;  4KI4 A;  3IS9 A;  1TUU A;  3LDQ A;  3LDP A;  5C10 A;  4AQY K;  1S9E A;  4ELT A;  2RPI A;  3AVG A;  1XI1 A;  4CJK A;  4X62 K;  4KI6 A;  4FSV A;  4DWI A;  4IEE A;  3HJF A;  3C6H A;  1CZB A;  3VQA A;  3EY1 A;  1TAQ A;  4DQI A;  3CC2 N;  4AM6 A;  1J53 A;  1GLE G;  4FWL A;  3DLG A;  3U3Y A;  4GV9 A;  1QS4 A;  3NVM A;  3ZT2 A;  3DLH A;  4DTS A;  1SKS A;  3T1H K;  3AVM A;  1IBM K;  4FWO A;  4PL8 A;  1LWF A;  1ZBH A;  4BE1 A;  3ZSZ A;  3KTQ A;  3VQ4 A;  3MDQ A;  4FOI A;  1Y97 A;  3L0Q A;  4O8K A;  4WQ5 A;  3G0Z A;  1I94 K;  3ATV A;  2ZM6 K;  3CFP A;  3ZEU B;  2HHT A;  5GIP A;  4G1Q A;  4QAG A;  4BRK A;  2YHW A;  1N34 K;  4RW6 A;  2UXD K;  5BRF A;  3J7A P;  1CLQ A;  4CEZ A;  2EWS A;  3DXK B;  5KGW A;  4A2A A;  1HPZ A;  4E1N A;  1LW0 A;  3T1Y K;  4CJF A;  1HKG A;  4DQR A;  5ELZ A;  3S3O A;  3GG4 A;  2RHK A;  3QEP A;  1VQL N;  4LF9 K;  4O0I A;  1YI2 N;  2XO7 A;  3TAE A;  4X66 K;  3THY A;  3UIQ A;  1K6Y A;  4K42 A;  5CR4 A;  3M3Z A;  3OYM A;  1T3V A;  2QW9 A;  5BR9 A;  4WFA L;  4FM2 A;  3FR0 A;  2FSJ A;  5ADX H;  1C1B A;  4UY8 O;  1NOZ A;  3RSE B;  3U3G A;  4BRO A;  3QES A;  4A5A A;  2PYJ A;  1NGH A;  3M8S A;  4KFB A;  3VQB A;  2G8I A;  4BRC A;  1WNS A;  5MLC Q;  2KFN A;  3QIN A;  4GW6 A;  4ELU A;  4CD3 A;  1GLL O;  3V9S A;  1MU2 A;  3SJJ A;  1QHA A;  3FFI A;  1BQM A;  3SAG A;  1QQO A;  3OYK A;  3LWM A;  4JKA A;  3VEZ A;  1Q9X A;  2YI1 A;  4B08 A;  2ZGZ A;  2E6L A;  1BWF O;  1UAX A;  4DCH A;  1HYS A;  1VQK N;  3DI6 A;  3SLC A;  1GOA A;  3MN7 A;  4JI7 K;  3K9K A;  5AQP A;  4IKF A;  1YTU A;  4BG8 A;  3T7Z A;  1VSL A;  1Y64 A;  5KRT A;  4BDP A;  4DFM A;  4B1Y B;  2HND A;  3AY9 A;  4AHS A;  4FYD A;  5AQQ A;  4JI1 K;  2P9S A;  1E4F T;  4RG8 A;  3OY9 A;  1N6Q A;  2W6K A;  1OVQ A;  3AAP A;  3QO9 A;  5JIC A;  3K59 A;  2FF6 A;  2E8A A;  3RTV A;  3NH2 A;  1VAZ A;  4B3T K;  2KKZ A;  3HPH A;  4EP5 A;  1F21 A;  4YOX A;  3SV3 A;  1RT1 A;  1ATR A;  4ILJ A;  4W5R A;  4M3Z A;  4CFC A;  5BPL A;  3C0B A;  3DXM B;  1ZBF A;  3P5J A;  1E4G T;  4B3R K;  2GTD A;  1VQM N;  4YOW A;  3OYL A;  4GNI A;  4WQ4 C;  1XMQ K;  3CI5 A;  1HKC A;  1BI4 A;  3V1O A;  1NGI A;  5AZJ A;  1SV5 A;  1S1X A;  3OYA A;  1L3T A;  4K8Z A;  1R59 O;  3AVI A;  5M1F A;  3F9M A;  2GBZ A;  4DS5 A;  3J80 O;  1QSL A;  1X9M A;  3TAF A;  2W40 A;  5A2Q O;  1I3A A;  3D7E O;  4H0P A;  3WNH A;  4BRP A;  4E7I A;  3E66 A;  1O1W A;  2ZWH A;  4Z4G A;  1LCU A;  3V4I A;  2A6A A;  2P9U A;  4H0X B;  1KD1 O;  5J1E A;  1NK5 A;  3THV A;  3AVH A;  2A1S A;  4BRH A;  3LWL A;  1D8Y A;  1RTD A;  4FVM A;  1BIU A;  4KHP K;  1M1K O;  4A61 A;  3V9Z A;  1CXQ A;  3AVN A;  1RT2 A;  4OPH A;  2Z1G A;  3J81 O;  4C8M A;  1RBS A;  3C6T A;  2O8F A;  4KHY A;  1JLC A;  4CIG A;  2GWJ A;  5F2R A;  4U7B A;  2BTF A;  3KWG A;  1JLA A;  3SUP A;  4JV5 K;  5AQL A;  2IGI A;  4BGB A;  2D4W A;  1JLG A;  2VGN A;  3MX5 A;  3D2E A;  2D5R A;  4DSF A;  3SBG A;  2HF4 A;  4DV3 K;  3HP6 A;  1YVU A;  1YAG A;  2NRV A;  3L2R A;  4CBX A;  3ITH A;  3VGM A;  4FJ8 A;  2HNY A;  3VGL A;  3NDK A;  2OTL N;  2P9K A;  2Z1I A;  4E7J A;  1JXE A;  3O3F A;  3R6M A;  3F9K A;  4M63 C;  4CZJ A;  3KKR A;  1TV6 A;  3EEQ A;  4FJM A;  4DU4 A;  2OTJ N;  2ASO A;  5K14 A;  3LZJ A;  1YJ9 N;  4H8K A;  4FK2 A;  3QLH A;  3B6P A;  1G15 A;  1KVA A;  1RFQ A;  4H5T A;  2IVN A;  3WNG A;  4E0D A;  1S1W A;  3AVC A;  2OPR A;  4FM1 A;  5B8H A;  3JYT A;  3LZI A;  3H1V X;  1KFD A;  4WCE L;  2LSN A;  4CEO A;  3IDH A;  1LV5 A;  2ZJR L;  1T8E A;  2PBD A;  3S41 A;  1Q9Y A;  1GOB A;  1VSH A;  4Y1C A;  4IZ9 A;  4GKJ K;  4ZTF A;  2G8H A;  3UKU B;  1QTM A;  1SKW A;  1WAJ A;  4CFA A;  1LAW A;  1Q8I A;  4DQS A;  3MCP A;  3A5N C;  2P9P A;  5FPD A;  4MO4 A;  3T19 A;  3WEE B;  5FRN A;  3PO4 A;  3CMA N;  4DFJ A;  4CJW A;  4ICL A;  1HNW K;  4AF1 A;  1S1U A;  4BR7 A;  5JLF A;  3SQ2 A;  4KO0 A;  2ZJQ L;  4JNE A;  4FCY A;  3I55 N;  4DQQ A;  3KK2 A;  4DTJ A;  5HRS A;  4DTU A;  1Z25 A;  4JK8 A;  2A5X A;  4LH5 A;  1S1T A;  5HRO A;  3VQE A;  1KAZ A;  3LPT A;  4E3S A;  2QEX N;  3QBX A;  4DTO A;  1NMN A;  2YCH A;  4PKH A;  5KPZ A;  3H46 O;  2O8B B;  2D0A A;  3P4I A;  1ZBS A;  1XMO K;  2O4G A;  3LL3 A;  4IOC L;  3BUZ B;  4CED A;  4M7Y A;  2VG6 A;  3LDN A;  3VTH A;  4DR2 K;  1CZA N;  1VSF A;  2X74 A;  4GKK K;  2VWJ A;  3IAY A;  4JD2 B;  3QEW A;  4JYA K;  3CM5 A;  5GAD P;  4JN4 A;  4FK0 A;  2HW3 A;  4J2B A;  5C2D A;  4PKG A;  5T7B A;  3CXC M;  1S5J A;  4J8F A;  5AJ3 K;  4B8A B;  1R0A A;  4CE9 A;  4KRE A;  2CH6 A;  4RW4 A;  2Q31 A;  1IH7 A;  1V4S A;  3V9W A;  3O3H A;  2YNF A;  3CJ9 A;  4I2Q A;  5AFU A;  3L2Q A;  2KFZ A;  2YJF A;  4RW7 A;  3FE1 A;  1NGE A;  3KIO A;  1QE1 A;  1NU0 A;  4EIA A;  5E84 A;  5AQX A;  2E4L A;  3U9Z A;  4IFV A;  3V6D A;  3CCS N;  1YIT N;  2HVH A;  3U8X A;  4IDK A;  3UE5 A;  4CGJ A;  4DLG A;  4DTX A;  1VQ7 N;  3P31 A;  1IBK K;  4DV2 K;  4DR5 K;  4R79 A;  3TI0 A;  2OZS A;  3VEY A;  2PAV A;  3KD1 E;  2WUS A;  3PIP L;  3KLG A;  2AA4 A;  4KTZ A;  3ULE B;  3C65 A;  5CE3 A;  3ZLJ A;  2HMI A;  2P9I B;  3O80 A;  4FZX C;  1VSK A;  4M3Y A;  3L4I A;  5HRR A;  4Z94 A;  3OYI A;  4CF0 A;  4BR9 A;  4CJ5 A;  3OS2 A;  2EHG A;  1DGK N;  3RR7 A;  5HLF A;  3HYF A;  5AZI B;  4BVP A;  3E1Y A;  4KH6 A;  4DR3 K;  2I5J A;  2DY4 A;  5TKW A;  3AVA A;  1IG9 A;  4KHN A;  3ZEU A;  2IS3 A;  1B9D A;  3DXK A;  3SAH A;  3OYJ A;  1VSM A;  2I7P A;  5HRP A;  4OJR A;  3EE8 A;  4WF9 L;  3NHG A;  2E1Z A;  4OGE A;  4CER A;  2A3Z A;  2YJE A;  3ZX0 A;  3A5O C;  4W5Q A;  4Z0U A;  1FKP A;  4RTF D;  3MEE A;  3BZK A;  1B9F A;  3MWP A;  3W0L A;  4KV8 A;  4HUG A;  4N47 A;  4FM0 A;  2QM1 A;  3R8E A;  4CHO A;  4BRI A;  1C1C A;  5KPR A;  4B9T A;  3OVN A;  1LWC A;  2HOE A;  3ID8 A;  1BUP A;  1DTT A;  1RNH A;  3RSE A;  1X1P A;  3TTF A;  4CES A;  3AA4 A;  3C7N B;  2FSN A;  1XNR K;  4DSK A;  4I9Q A;  4BRF A;  3VEO A;  3EYZ A;  4FLY A;  1GOC A;  4IFE A;  2FSK A;  1T7P A;  3SQ0 A;  3OYN A;  4FJK A;  3D45 A;  1C1A A;  3C94 A;  4FWM A;  5I3U A;  4YFU A;  3SMP A;  1C0M A;  3TWH A;  1EO1 A;  4Z4E A;  4WYB A;  1LW2 A;  4CEA A;  2PY5 A;  1KCF A;  4JLH A;  1TAU A;  4MQ3 A;  4CBU A;  3HPG A;  4YNQ A;  3K5L A;  2AP1 A;  1U49 A;  4KTQ A;  4FWK A;  3O4Q A;  2FLO A;  2GWK A;  5BR8 K;  4O44 A;  4HUE A;  2QI2 A;  3LDS A;  4O5F A;  3MN5 A;  1ESV A;  3SJH A;  4QS8 A;  3E01 A;  5J2P A;  1NNE A;  1D9D A;  4DF8 A;  4BRG A;  4XEI A;  1MDU B;  5DM7 L;  1HRH A;  2G8K A;  3RMC A;  3KZB A;  3QIC A;  2Q2R A;  3SZ2 A;  3T69 A;  3SV4 A;  1YT3 A;  2HF3 A;  4NLB A;  2O8D A;  1NK8 A;  3VEN A;  4BR4 A;  2ZQB A;  3BF3 A;  3ZT1 A;  3DM2 A;  5C12 A;  3K58 A;  2GEL A;  4U67 L;  3VQ8 A;  4I6M B;  1YVN A;  1S6P A;  5GAG P;  1RT7 A;  4B1W B;  3CM6 A;  3OYF A;  2JWL A;  3KD5 E;  1OVY A;  3VOV A;  2YNI A;  3G10 A;  2FF3 B;  4OGC A;  1RDA A;  3P83 D;  1TK0 A;  3A0I X;  3FFK B;  4DV5 K;  5I42 A;  3FZH A;  1OH6 A;  4XH1 A;  2GV9 A;  4M3W A;  3TAN A;  4DU1 A;  1OH8 A;  5HP1 A;  1J5O A;  2D1K A;  1NG9 A;  3CQX A;  3G71 N;  4DV6 K;  4CJU A;  4K25 A;  3DXM A;  5LL6 Z;  1TUY A;  1RBV A;  2BUP A;  4CJL A;  4DU3 A;  2WC9 A;  4Z4F A;  1WSI A;  2QWN A;  2VG5 A;  2QWO A;  3B6O A;  3CME N;  2QWL A;  3HST B;  1KXP A;  4FXD A;  1WBD A;  1BIS A;  4OKJ A;  2W41 A;  5HL7 L;  1T05 A;  5LMU K;  1C0F A;  4CHN A;  1K9M O;  5AQT A;  1BCO A;  1BQN A;  4LC9 B;  1KSP A;  1DTQ A;  5CHI A;  4LF5 K;  4M3X A;  3ULD A;  2UUA K;  4N56 A;  3VQC A;  5D3G A;  1VQ8 N;  1RDU A;  1WSH A;  5F1X A;  4DV1 K;  3SUO A;  1ZYQ A;  1NGF A;  3OYB A;  1RDW X;  5KQ8 A;  2ITG A;  1O13 A;  4MDA A;  1Z05 A;  2OPQ A;  3I8B A;  2DTU A;  1RDB A;  3QFU A;  3OBW A;  4IEI A;  3N4Q A;  5CYQ A;  3ZSY A;  2HHX A;  3Q7C A;  4OLA A;  3AA5 X;  2FBY A;  1YHQ N;  2E6M A;  1HQU A;  1XQS C;  1WSE A;  1GLD G;  4DKW A;  4CF8 A;  1LOT B;  4CJP A;  1VSI A;  4PA1 A;  3T1A A;  1Q81 O;  3WXJ A;  5KRS A;  2QWP A;  1KAY A;  3PSI A;  1ATN A;  5E26 A;  3WNF A;  3NBP A;  2HBM A;  2OZM A;  2GEM A;  3SYZ A;  2IAJ A;  2GUI A;  4B9V A;  3J7Z O;  3CPW M;  1K73 O;  1NJY A;  1EET A;  1X9J A;  1HNV A;  3H3O B;  3OYC A;  2HHU A;  2HHV A;  4G9Z A;  4AHU A;  2J4R A;  1NK9 A;  3MWT A;  3P1G A;  3F2K A;  1WB9 A;  2ETJ A;  2RF2 A;  3BP8 A;  1REV A;  4B1Z A;  5AQW A;  2G8V A;  1L3S A;  4OPJ A;  4R5P A;  2F8S A;  2E20 A;  1IV0 A;  3CQ8 A;  1N5Y A;  1HLU A;  3LP1 A;  4XH4 A;  4JKH A;  4DFK A;  4BRD A;  3SMS A;  2XY5 A;  3RR8 A;  3IMX A;  2O8E B;  1EWQ A;  4LFB K;  2P5G A;  3IUC A;  5AQY A;  3NGY A;  4DSL A;  1NGD A;  1L3U A;  3BGR A;  3UKU A;  2P9L B;  1VRT A;  1KTQ A;  3MED A;  3H45 C;  1U6Z A;  3QEX A;  4K41 A;  1DT9 A;  1RCH A;  1QSS A;  5LY3 A;  4NXM K;  4IJN A;  4DLE A;  4I9L A;  5ADX A;  4BDY A;  1KQS M;  3WEE A;  3RVC A;  5BRH A;  4BGA A;  1FK9 A;  3RMB A;  4FLZ A;  3CD6 N;  3TSQ A;  3WT0 A;  5BRD A;  1X3M A;  1CXU A;  3WXK A;  3EKS A;  1J5E K;  4DB3 A;  5JMV A;  4KB1 A;  4L8R B;  5HRN A;  1U47 A;  4FLW A;  2O8B A;  5AQJ A;  2D0C A;  3CJ7 A;  4JHD A;  4A62 A;  3IKM A;  2DFF A;  4EFH A;  2RN2 A;  1LWE A;  3DMJ A;  2YKM A;  1JLE A;  4MO5 A;  2OPP A;  3OA9 A;  4Z4H A;  3VA3 A;  4JD2 A;  4H4O A;  2IC3 A;  1C0G A;  3M8R A;  3RRG A;  3VET A;  2CGJ A;  2F96 A;  3OYD A;  4DTN A;  2VYP A;  4CJE A;  2A41 A;  3QFP A;  2D0B A;  3VEW A;  4E7K A;  4HUF A;  2QKB A;  2WFB A;  4E1M A;  3MXM A;  5EXW A;  4M3R A;  2AJQ A;  4DQ8 A;  1U48 A;  3VQ5 A;  3CER A;  3K9J A;  4QS7 A;  1HJR A;  1GLB G;  3DAW A;  4FPB A;  2F9W A;  3PIO L;  4EP4 A;  4EZ6 A;  5FRO A;  2VQE K;  3ASM A;  3IFR A;  4NYF A;  2A40 A;  3AO2 A;  3PY8 A;  2KW4 A;  2P9N B;  5AQG A;  1RBU A;  1EP4 A;  4FZZ A;  2UXC K;  3OHR A;  3ULE A;  1RT5 A;  3NF6 A;  1EX4 A;  1MWK A;  2P9I A;  2YKN A;  4CZK A;  4F3O A;  3TPQ A;  3ZYY X;  3CJA A;  4DR4 K;  2HHQ A;  1W0H A;  3EL2 A;  3QDK A;  4BRA A;  3V9X A;  1HX1 A;  5J2Q A;  2NRH A;  3WUH A;  4W5O A;  3AGR A;  4ISF A;  1KC8 O;  4FLV A;  2HHS A;  5AZI A;  2Q97 A;  3CIP A;  3L2V A;  4BQZ A;  4J2E A;  4IO8 A;  4MLH A;  2Q0U A;  1NMD A;  2O8C B;  3AAR A;  3JSM A;  4FZY A;  4FK4 A;  2QA4 N;  2D0P A;  4C1N K;  4DR1 K;  4EHU A;  1SUQ A;  5EOY A;  1D9F A;  3I33 A;  3HSC A;  4B9L A;  4DV0 K;  2YHY A;  3AVK A;  4JKC A;  3PLA A;  5M1P A;  3VA0 A;  1NKC A;  5EX5 A;  4L3Q A;  4DMN A;  1RT3 A;  4NO7 A;  5AQS A;  3VN5 A;  4RWT A;  2CGL A;  3EZW A;  2BGG A;  3NGI A;  4AHR A;  3C7N A;  3THX B;  3NE6 A;  2QXL A;  4F2S A;  4CF2 A;  4ZTJ A;  2UUC K;  3K5N A;  4IBN A;  4MLE A;  1WSJ A;  2OPS A;  1OH7 A;  3U9D A;  3ZSW A;  3J7Y P;  3CQY A;  1V4T A;  4NB4 A;  4MFB A;  1ZBL A;  5GAH P;  2Z1J A;  4PUO A;  4LH4 A;  1G99 A;  1NGC A;  4A59 A;  1HMV A;  4B1X B;  3MEG A;  3TSP A;  4CEE A;  3THW B;  3VPZ A;  2PZS A;  1Z26 A;  4IJA A;  3AA2 A;  3TAB A;  1OKJ A;  2ASM A;  4B9U A;  1TKX A;  2FC0 A;  3GDQ A;  3CG7 A;  1VQP N;  3VQ6 A;  1FW6 A;  3AO5 A;  3AA3 A;  2E2Q A;  3HK2 A;  5M1N A;  1T6C A;  1J54 A;  3OS1 A; 
#chains in the Genus database with same CATH homology
 3K5O A;  1B9F A;  1TAQ A;  3RRH A;  2XY6 A;  4KV8 A;  4TSX A;  4DQI A;  4HUG A;  4N47 A;  4FM0 A;  3NF7 A;  1J53 A;  4CHO A;  2KZM A;  1C1C A;  3DLG A;  4B9T A;  4DS4 A;  3TR8 A;  3OVN A;  1LWC A;  3U3Y A;  3DRP A;  1QSY A;  3QER A;  1DTT A;  1QS4 A;  1RNH A;  3ZT2 A;  1X1P A;  3DLH A;  4NYN A;  3AA4 A;  3VQQ A;  4CES A;  4FJL A;  4DSK A;  4I9Q A;  4DTS A;  2YV0 X;  1KLM A;  1SKS A;  4CJQ A;  3QIO A;  4XIU A;  3AVM A;  3BDP A;  3VQ9 A;  3EYZ A;  4FLY A;  1GOC A;  1LWF A;  1ZBH A;  4BE1 A;  1T7P A;  1HQE A;  3SQ0 A;  3OYN A;  3ZSZ A;  4M45 A;  4FJK A;  2HNZ A;  3D45 A;  1C1A A;  3C94 A;  3DRR A;  2JGU A;  3VQ4 A;  4YFU A;  1Y97 A;  3EY1 A;  5I3U A;  3L2W A;  3SI6 A;  2OYQ A;  1C0M A;  3TWH A;  3G0Z A;  2HHW A;  2WOM A;  4Z4E A;  4CEA A;  1LW2 A;  3CFP A;  2PY5 A;  1KCF A;  2P5O A;  2JLE A;  4JLH A;  2HHT A;  2O4I A;  1TAU A;  4G1Q A;  4MQ3 A;  4QAG A;  3HPG A;  4CGF A;  4DG1 A;  4YNQ A;  3KLH A;  3K5L A;  4BE0 A;  3MXI A;  1NK6 A;  1U49 A;  4KTQ A;  1UA0 A;  4RW6 A;  3O4Q A;  3LP3 A;  4O44 A;  4HUE A;  3LDS A;  4CEZ A;  5KGW A;  1WLJ A;  2RKI A;  2F8T A;  3ZT3 A;  4C8K A;  4CEC A;  1CLQ A;  1HPZ A;  4E1N A;  3HO1 A;  4DQP A;  1LW0 A;  1VSD A;  3E01 A;  4BE2 A;  4CJF A;  4DQR A;  3S3O A;  2G8U A;  2VWK A;  2P1J A;  4CK3 A;  5J2P A;  1A5X A;  1D9D A;  4KKO A;  1YTA A;  5CY4 A;  4DF8 A;  3QEP A;  4O0I A;  2XO7 A;  3QEI A;  4J2D A;  1HRH A;  1HNI A;  1BGX T;  5DMR A;  3TAE A;  3RMC A;  2G8K A;  4M41 A;  3UIQ A;  1K6Y A;  1C0U A;  3A2F A;  3HVT A;  1NJW A;  4KB0 A;  4CHZ A;  3SZ2 A;  3DLE A;  3SV4 A;  3OYM A;  3DOL A;  1TK5 A;  3LPU A;  1YT3 A;  1D5A A;  4FM2 A;  3AVB A;  1NK8 A;  3HPO A;  3L3U A;  2BDP A;  3IG1 A;  1SL1 A;  2ZQB A;  3ZT1 A;  3DM2 A;  3K58 A;  4PWD A;  1C1B A;  3TAR A;  3VQ8 A;  1NOZ A;  3U3G A;  4O5B A;  3QES A;  1S6P A;  3C6U A;  4I7F A;  1RT7 A;  1VSE A;  1QHT A;  2PYJ A;  1IKW A;  3M8S A;  4KFB A;  3CM6 A;  4CHY A;  3OYF A;  4DF4 A;  3VQB A;  1KLN A;  3KD5 E;  2G8I A;  4CEF A;  2YNI A;  3G10 A;  4OGC A;  1WNS A;  1ASV A;  1RT4 A;  4O0J A;  1RDA A;  2FBV A;  2DFH A;  3P83 D;  3QIN A;  4GW6 A;  2KFN A;  1EXQ A;  4ELU A;  1TK0 A;  4B9S A;  4ZHR A;  3LAL A;  4B9M A;  4Z4C A;  5I42 A;  3LP0 A;  3V9S A;  4CF9 A;  4AHV A;  1MU2 A;  4W5T A;  2GV9 A;  1C6V A;  4M3W A;  3SJJ A;  3QNN A;  3TAN A;  1DLO A;  1XWL A;  3FFI A;  1BQM A;  3AVJ A;  4LSN A;  3OJS A;  4DU1 A;  2X78 A;  4HCC A;  5HP1 A;  1J5O A;  2YHB A;  3VQD A;  1ZBI A;  3OYK A;  3SCX A;  3U6F A;  3LWM A;  3ZT0 A;  4CJU A;  2IDO A;  1Q9X A;  1A5V A;  4FLU A;  5J2N A;  3CYM A;  1RBV A;  3HXM A;  4B08 A;  1L5U A;  4CJL A;  4DU3 A;  2Z1H A;  3O4N A;  3K57 A;  2QK9 A;  2E6L A;  4Z4F A;  1CZ9 A;  1WSI A;  2VG5 A;  3B6O A;  1JLB A;  1UAX A;  4ID1 A;  4KHQ A;  1HYS A;  3HST B;  4E19 A;  4FXD A;  1BIS A;  3DI6 A;  3LAN A;  4FW2 A;  4OKJ A;  3HP9 A;  4Y1D A;  3TAM A;  1T05 A;  4KRF A;  1S9G A;  4CHN A;  4QCL A;  1GOA A;  3ZSR A;  1BCO A;  1BQN A;  4IKF A;  1KSP A;  1DTQ A;  1YTU A;  1NJZ A;  1JL2 A;  4CIE A;  3DLB A;  1VSL A;  4M3X A;  5KGX A;  3ULD A;  4CGG A;  5KRT A;  4N56 A;  3VQC A;  1RT6 A;  3QNO A;  4BDP A;  5D3G A;  1WSF A;  4DFM A;  5CZ1 A;  1JKH A;  1WSH A;  2HND A;  4AHS A;  2PYL A;  4FYD A;  2YNH A;  3SUO A;  1ZYQ A;  1RDD A;  4RG8 A;  2KQ2 A;  3OY9 A;  2ITG A;  5DK5 A;  3OYB A;  4DTR A;  1N6Q A;  4IFY A;  4QOZ B;  4DTP A;  3NGZ A;  3QO9 A;  3CFR A;  2OPQ A;  3K59 A;  4OLB A;  4CJ3 A;  2DTU A;  3V1Q A;  3RTV A;  1KVC A;  1RDB A;  4OKK A;  3NH2 A;  2P51 A;  3HPH A;  4CGD A;  2YNG A;  1F21 A;  4EP5 A;  3SV3 A;  1UOC A;  3S3M A;  4CJT A;  4KAZ A;  1IKV A;  1RT1 A;  3ZT4 A;  4W5R A;  5JS2 A;  3SPZ A;  4M3Z A;  5CYQ A;  3ZSY A;  4F2R A;  2HHX A;  5HBM A;  4OKE A;  1SL0 A;  2XHB A;  4CFC A;  4OLA A;  3AA5 X;  4LSL A;  2BE2 A;  1XHX A;  1ZBF A;  3P5J A;  2FBY A;  2E6M A;  3NF8 A;  4KHW A;  1HQU A;  4FLT A;  1WSE A;  3O3G A;  3OYL A;  4CF8 A;  3ALY A;  4CJP A;  1BI4 A;  1VSI A;  3V1O A;  4PA1 A;  1SV5 A;  1S1X A;  3T1A A;  3OYA A;  1ASW A;  1L3T A;  5KRS A;  2Y1J A;  4K8Z A;  3AVI A;  1LAV A;  2GBZ A;  3WNF A;  4HVJ A;  3NBP A;  4DS5 A;  2WON A;  1VSJ A;  4B8C A;  1QSL A;  3NF9 A;  1X9M A;  4AHT A;  3I8D A;  3TAF A;  2OZM A;  3SPY A;  4W5N A;  1RDC A;  3KLF A;  1I3A A;  3SYZ A;  4E7I A;  3WNH A;  1RBT A;  2X6N A;  2IAJ A;  3ZSQ A;  1O1W A;  1NJX A;  2GUI A;  4H4M A;  3DLK A;  4B9V A;  4C8N A;  4NCA A;  4Z4G A;  2B6A A;  3RMD A;  1EET A;  1NJY A;  1HNV A;  2FBT A;  5C25 A;  3V4I A;  3OYC A;  2HHU A;  2HHV A;  1KRP A;  3I0S A;  5KI6 A;  4AHU A;  1ASU A;  3KK3 A;  1NK9 A;  2HVI A;  5J1E A;  1NK5 A;  2A1R A;  3P1G A;  3THV A;  2ETJ A;  3AVH A;  2A1S A;  1REV A;  2RF2 A;  4O4G A;  3LWL A;  1UWB A;  2XY7 A;  2G8V A;  3TAG A;  3DLR A;  1D8Y A;  4HTU A;  1RTD A;  5CZ2 A;  4OPJ A;  4CEB A;  4FVM A;  4R5P A;  2W42 A;  3SQ4 A;  1L3S A;  4FJX A;  2F8S A;  4Z4I A;  1BIU A;  3CQ8 A;  1TK8 A;  4IG3 A;  1N5Y A;  3LP1 A;  4FLX A;  4BWM A;  3V9Z A;  2QXF A;  1CXQ A;  3AVN A;  1WAF A;  4GMJ B;  3K2P A;  1RT2 A;  3ZSV A;  4DFK A;  2Z1G A;  3QET A;  2XY8 A;  2XY5 A;  4C8M A;  1RBS A;  3WNE A;  3RR8 A;  3C6T A;  4FJ5 A;  2KTQ A;  4KHY A;  4ID5 A;  1JLC A;  2P5G A;  4B3O A;  4CIG A;  3NGY A;  5J2M A;  2XRI A;  3DYA A;  4DSL A;  4N76 A;  2DFE A;  1L3U A;  4M3U A;  1JLA A;  3SUP A;  3BGR A;  2ZE2 A;  4HHT A;  1VRT A;  2IGI A;  1RBR A;  1JLG A;  3I0R A;  1BI4 B;  1TKT A;  3KJV A;  4F4K A;  1KTQ A;  2VG7 A;  3MED A;  4PQU A;  4FJI A;  2D5R A;  3AVF A;  3OJU A;  4E7H A;  4DSF A;  3QEX A;  3QIP A;  4C8L A;  3HP6 A;  1RCH A;  1QSS A;  1YVU A;  3L2R A;  4OVL A;  3S3N A;  4BWJ A;  3ITH A;  3IRX A;  1S6Q A;  4I9L A;  4BDY A;  4DLE A;  4FJ8 A;  4F3T A;  4AHC A;  2HNY A;  1NKB A;  3NDK A;  4N5S A;  3T3F A;  2X6S A;  2Z1I A;  4LY7 A;  2YHA A;  1FK9 A;  3LP2 A;  4RW9 A;  4E7J A;  3H08 A;  4DSE A;  1IO2 A;  1JXE A;  4K8X A;  3O3F A;  3RMB A;  3F9K A;  4J2A A;  1IKY A;  1QQC A;  3KKR A;  4FLZ A;  1U45 A;  5C24 A;  4I2P A;  1TV6 A;  4FJM A;  3OYE A;  4DU4 A;  1RTI A;  5K14 A;  3LZJ A;  4FK2 A;  4H8K A;  4CK2 A;  3QLH A;  4CK1 A;  4FJ7 A;  1CXU A;  4KB1 A;  3B6P A;  1G15 A;  1KVA A;  2B5J A;  3CFO A;  5HRN A;  4L8R B;  4NCB A;  3WNG A;  4CJV A;  1BHL A;  1U47 A;  5C42 A;  4FLW A;  3K5M A;  4E0D A;  3TAQ A;  4Q0B A;  3LAK A;  1S1W A;  2D0C A;  3AVC A;  2OPR A;  3RWU A;  4FM1 A;  3JYT A;  3LZI A;  1KFD A;  1BL3 A;  2DFF A;  2LSN A;  2RN2 A;  2ATQ A;  1LWE A;  4CEO A;  1LV5 A;  1VK0 A;  3DMJ A;  4BAC A;  4BDZ A;  2YKM A;  4FW1 A;  3OYG A;  1TKD A;  4CHQ A;  1T8E A;  3KKS A;  1JLE A;  5EU7 A;  1J9A A;  3AVL A;  2OPP A;  3PUF A;  4O55 A;  1Q9Y A;  4Z4H A;  1GOB A;  4KTW A;  1VSH A;  4Y1C A;  3VA3 A;  3V9U A;  4CGH A;  4H4O A;  3PX4 A;  2IC3 A;  4ZTF A;  2G8H A;  1TKZ A;  1QTM A;  4CCH A;  1SKW A;  2OA8 A;  4CJ4 A;  1WAJ A;  3M8R A;  4CJS A;  1IKX A;  3RRG A;  2IOC A;  4IG0 A;  4FJN A;  3NFA A;  2F96 A;  4CFA A;  1LAW A;  1FKO A;  3OYD A;  4DTN A;  4CJE A;  3ZSO A;  2D0B A;  4UQG A;  4HCB A;  4E7K A;  1Q8I A;  4HUF A;  3S9H A;  4M3T A;  4DQS A;  2QKB A;  3VQP A;  1U4B A;  1FXX A;  1L3V A;  2B4J A;  3T19 A;  4E1M A;  3MXM A;  4C8O A;  5FRN A;  3PO4 A;  3DRS A;  4DFJ A;  4M3R A;  3LAM A;  4ICL A;  4CJW A;  3ZCM A;  5SWM A;  3HVR A;  2AJQ A;  1U48 A;  1TL1 A;  1S1U A;  3SQ2 A;  4KO0 A;  2BAN A;  1NK4 A;  3VQ5 A;  1RTJ A;  4FCY A;  4DQQ A;  3VQ7 A;  3AO3 A;  1HJR A;  1HYZ A;  1JLQ A;  3KK2 A;  4DTJ A;  5HRS A;  4AIL C;  3ISN C;  5FDL A;  4EP4 A;  4DTU A;  1Z25 A;  3D0P A;  4EZ6 A;  5FRO A;  4LH5 A;  3KTQ A;  4E7L A;  2KZZ A;  1S1T A;  3ASM A;  5HRO A;  3VQE A;  3LPT A;  4E3S A;  4NYF A;  3AO2 A;  3OS0 A;  4DTO A;  3PY8 A;  3V81 A;  2KW4 A;  4JRQ A;  1RBU A;  3ZSX A;  1W9H A;  1EP4 A;  4FZZ A;  1TVR A;  2D0A A;  3HT3 A;  1WN7 A;  3SUQ A;  3L2U A;  1RT5 A;  3NCI A;  1ITG A;  3NAE A;  3NF6 A;  2O4G A;  3AO4 A;  1EX4 A;  1NK0 A;  2YKN A;  4CED A;  2VG6 A;  3L8B A;  4F3O A;  1XHZ A;  1VSF A;  2NUB A;  1WSG A;  4Q5V A;  1JXB A;  3PV8 A;  2HHQ A;  4E89 A;  2X74 A;  1W0H A;  3EZ5 A;  3V9X A;  2VWJ A;  5J2Q A;  3IAY A;  3QEV A;  3HL8 A;  3KLI A;  4W5O A;  3PX0 A;  3MAQ A;  4FLV A;  3QEW A;  3CM5 A;  4DFP A;  4AH9 A;  4FK0 A;  2HW3 A;  2HHS A;  1I39 A;  1KFS A;  4J2B A;  4RW8 A;  3L2V A;  4CF1 A;  5T7B A;  4J2E A;  1S5J A;  1XC9 A;  1SKR A;  4B8A B;  1R0A A;  4CE9 A;  4KRE A;  4RW4 A;  4FJG A;  4CGI A;  4FJH A;  1IH7 A;  1RTH A;  3V9W A;  3O3H A;  1NK7 A;  2YNF A;  3JSM A;  4FZY A;  4I2Q A;  3L2Q A;  4FK4 A;  1A5W A;  2KFZ A;  4RW7 A;  3PX6 A;  5KTQ A;  3KIO A;  3NH0 A;  2G8W A;  3V1R A;  4FJJ A;  1QE1 A;  4FJ9 A;  4JRP A;  1SUQ A;  4WE1 A;  4DSJ A;  1KVB A;  2E4L A;  1D9F A;  4IFV A;  3V6D A;  4OPK A;  1JLF A;  2HVH A;  4B9L A;  3C95 A;  2QKK A;  4IDK A;  3AVK A;  4CGJ A;  1NOY A;  1EKE A;  4DLG A;  4B9N A;  4DTM A;  2ZD1 A;  3MEC A;  1UA1 A;  4DTX A;  2EX3 A;  3F73 A;  1RIL A;  4CIF A;  3VA0 A;  1NKE A;  1NKC A;  4ELV A;  4DMN A;  4KPY A;  1X9W A;  3TI0 A;  3OYH A;  5FRM A;  1RT3 A;  2FBX A;  2Q3S A;  3L3V A;  2OZS A;  4F8R A;  4NCG A;  3PO5 A;  3KD1 E;  4EZ9 A;  3KLG A;  4CFD A;  3VN5 A;  3NH1 A;  4KTZ A;  3KK1 A;  2Y1I A;  4CHP A;  2HMI A;  1TL3 A;  3M8P A;  2BGG A;  4FZX C;  5JS1 A;  4PY5 A;  3NGI A;  1VRU A;  1VSK A;  4M3Y A;  4AHR A;  4F2S A;  3RMA A;  3NE6 A;  3MXJ A;  4GVM A;  1C0T A;  5HRR A;  3OYI A;  1SL2 A;  4CF2 A;  1X9S A;  4CF0 A;  4JS4 A;  4ZTJ A;  4CJ5 A;  3OS2 A;  3K5N A;  3SNN A;  2EHG A;  4CEQ A;  4IBN A;  1TGO A;  1WSJ A;  2OPS A;  5HLF A;  3RR7 A;  1BCM A;  1U04 A;  1ZBU A;  4KHU A;  4JS5 A;  3ZSW A;  4CJR A;  1JL1 A;  4N41 A;  3HYF A;  4MFB A;  1ZBL A;  4PUO A;  2Z1J A;  3DOK A;  4LH4 A;  4M42 A;  2I5J A;  3M8Q A;  1IG9 A;  3AVA A;  2DY4 A;  4KHN A;  1HMV A;  3AO1 A;  3HM9 A;  3TAP A;  2G8F A;  3AV9 A;  3MEG A;  1BIZ A;  5SZT A;  2HB5 A;  4CEE A;  1S1V A;  2IS3 A;  3SUN A;  1HYV A;  1B9D A;  4CFB A;  5E41 A;  3OYJ A;  2PZS A;  3KLE A;  1Z26 A;  1VSM A;  1B92 A;  3AA2 A;  5HRP A;  3TAB A;  1T03 A;  4OJR A;  4B9U A;  1TKX A;  2FC0 A;  3NHG A;  4KI4 A;  3IS9 A;  4OGE A;  4CER A;  4ELT A;  1S9E A;  2RPI A;  3AVG A;  3CG7 A;  4LD0 A;  1XI1 A;  3VQ6 A;  4CJK A;  4W5Q A;  3AO5 A;  4KI6 A;  4KHS A;  3AA3 A;  5CYM A;  4Z0U A;  4DWI A;  3HJF A;  1FKP A;  3SQ1 A;  1CZB A;  3VQA A;  3MEE A;  2R7Y A;  3HK2 A;  4DSI A;  1J54 A;  3OS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...