1VSHA

Asv integrase core domain with zn(ii) cofactors
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
145
Chain Sequence
GLGPLQIWQTDFTLEPRMAPRSWLAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSFTSKSTREWLARWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKRIPTSKQGELLAKAMYALNHF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects on enzymatic activity.
pubmed doi rcsb
molecule keywords INTEGRASE
molecule tags Endonuclease
source organism Rous sarcoma virus (strain schmidt-ruppin)
total genus 48
structure length 145
sequence length 146
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1vshA00
4HVJA 5HRRA 3NF7A 3E01A 4ZTFA 4FJXA 3KD1E 3WNEA 2A1SA 5FDLA 2KQ2A 3HYFA 2G8HA 1REVA 5EU7A 1ZBUA 3AVGA 3ZT2A 4ELUA 4KHQA 1UAXA 4CCHA 4E0DA 3AVJA 3AVCA 3V1RA 3V4IA 3QO9A 4CFBA 4F3OA 1JXEA 1X1PA 2F8SA 4Q0BA 1A5VA 4CJUA 3S3OA 2ITGA 1RT2A 3ZT0A 1BQNA 1S9GA 3VQ7A 4RW8A 1RBUA 4CFCA 1CXUA 5JS2A 3SUPA 4FJGA 3K5MA 4PY5A 5CYMA 2D0CA 3JSMA 4HHTA 2X78A 3M8QA 4Y1CA 4AILC 1RBRA 3VA3A 3OVNA 5DMRA 1RCHA 1WN7A 2OPPA 4TSXA 3MEEA 4CF1A 1KVCA 1JLBA 4ICLA 3OS1A 1EKEA 3HO1A 1NKBA 1ZBLA 1UWBA 1Z26A 4KRFA 3VA0A 1NK8A 4BWMA 3OYMA 3T19A 3F73A 5C24A 3DLKA 4FK2A 3ZSVA 3CFRA 5FROA 3VN5A 1RDCA 1RTIA 4CEOA 3NFAA 2XO7A 2EX3A 3NH0A 3UIQA 2GV9A 1TL3A 4OLAA 3V9UA 4CF0A 3DI6A 2RN2A 4KTQA 4KPYA 3HJFA 4KHUA 4O5BA 3V6DA 4HCCA 4E1NA 2F8TA 2B4JA 2IOCA 3OYGA 3PUFA 3L2RA 2EHGA 1B9FA 4O55A 4CJSA 4M41A 2RPIA 1QSYA 2IAJA 2XHBA 3LP2A 5HP1A 2PYLA 1KSPA 4CIEA 1RDDA 1Q9XA 3NGYA 3ZSOA 4KI6A 4YNQA 4QCLA 2BGGA 1BISA 5KTQA 1BCOA 4DU3A 2YNHA 3G10A 1GOCA 1I3AA 2DFEA 4I2PA 4OPKA 5J1EA 3DOLA 4DQRA 3OYFA 4IG3A 3NAEA 1KFDA 4FJJA 3VQQA 3QEXA 1JXBA 1NK5A 4N41A 4W5TA 4FM0A 3KLEA 3ALYA 3HPOA 1QTMA 4FLZA 1BIUA 4CESA 4IDKA 1X9MA 2Z1GA 1XWLA 2D0BA 3LWLA 4XIUA 3VQCA 4DTXA 4CEZA 1TK5A 3KD5E 2YKMA 3MECA 4Y1DA 5K14A 4B9UA 4FJNA 2HHQA 4KHWA 5C25A 3THVA 4Z4FA 1TAUA 4DFKA 1EXQA 4AHUA 3SJJA 2G8UA 1XHZA 1RT5A 4B9VA 2Z1JA 4RW9A 2PY5A 1NJYA 3HXMA 2HHSA 4DLGA 3D0PA 4FLTA 1SKSA 3SPZA 3MXIA 5KGXA 4PWDA 3AVIA 3O3HA 4G1QA 4C8KA 1DTTA 3KLGA 3ULDA 3QEPA 1D9DA 3LP1A 4M42A 1S1VA 2AJQA 1WSGA 3OYIA 3LZIA 3CG7A 4LH4A 3IRXA 3TR8A 1RT1A 1BQMA 4C8NA 3FFIA 3LWMA 3AVFA 2VWKA 4LSLA 4NCBA 1S1XA 1HNVA 4F2SA 4I7FA 3QLHA 3L3UA 4NYFA 3PX0A 2BE2A 1QSLA 4HTUA 1XHXA 2HNZA 4E7KA 2IC3A 4F4KA 3AO4A 2FBYA 1ZBHA 1F21A 3EZ5A 3OYJA 4I2QA 4CHPA 1TKXA 1VSHA 3VQ9A 4Z4GA 2QK9A 4FXDA 2IS3A 3OJSA 1RBSA 1YTAA 3OYCA 2KFNA 3DLGA 3NF8A 1FK9A 4CF8A 3TWHA 3T1AA 4CJWA 4DLEA 5J2MA 1TKTA 3RMAA 4ELTA 1C0MA 1UA0A 2PYJA 2OPRA 2XRIA 3V9SA 3QEVA 4FZXC 1L3UA 3D45A 1YTUA 4IKFA 3DLHA 3TANA 4CJVA 1HYZA 4B9MA 3LAKA 4CHYA 1LWCA 4HUGA 2XY7A 4KB1A 3KTQA 2O4GA 2YHAA 3AA4A 1SKWA 4EP4A 5JS1A 3SI6A 3V9XA 1QHTA 3SQ1A 5J2QA 3NBPA 1JLAA 2X6NA 1NKCA 3DLRA 4CEAA 3NF9A 1LWFA 2RF2A 3LALA 3OYAA 3QERA 1C1CA 4F8RA 4M3ZA 1DLOA 1IKYA 2RKIA 3VQBA 4W5NA 4LH5A 4DTMA 4KKOA 4GW6A 4PA1A 3KK2A 1JLFA 4M3WA 1EP4A 4EP5A 3S3NA 1SL0A 3HP9A 3AA2A 3DLEA 4DTOA 1U48A 3VQDA 3DYAA 1VSKA 4DSFA 1ZYQA 1S5JA 4YFUA 1QSSA 1JLEA 4CK1A 1IKVA 3IS9A 4HUEA 4KFBA 3LP0A 4N56A 4FYDA 1EX4A 2XY5A 2FBVA 4M45A 4CJQA 1NK4A 3QETA 2IDOA 3DOKA 1ASWA 3K5NA 4BE1A 4E89A 4FCYA 4B3OA 3LAMA 2VG6A 2X6SA 3DRRA 3ZSXA 1QE1A 4CFDA 4DTSA 1UA1A 2JLEA 4CGJA 3DLBA 4Z4CA 2W42A 2B5JA 3H08A 3OYNA 4N76A 1KVAA 1IG9A 3QEWA 1EETA 3ASMA 3B6PA 4CGHA 3DM2A 3EY1A 4DQSA 4AHRA 4W5QA 1HMVA 4CJRA 3RRHA 1VSFA 3CFOA 1G15A 1RNHA 3SQ4A 1MU2A 1RBVA 4DU1A 4PQUA 4EZ6A 3RMDA 1VSJA 3HVTA 1RTDA 2KZZA 4B8CA 1KLMA 3MEDA 5HLFA 1WSJA 2ATQA 4KHSA 4CJ3A 4M3YA 4NYNA 4CEEA 3HPGA 4IG0A 4CIGA 1RILA 3PX6A 4ZHRA 4FZZA 4DSJA 1L3TA 3V9ZA 2DFFA 2D5RA 3QNNA 4DWIA 4DTRA 4CHZA 4B9NA 4E19A 3SV4A 1VRTA 4CJEA 2YNIA 1DTQA 3RMBA 2ZQBA 1C1AA 4BDZA 4IBNA 3KK3A 1HYSA 2E6LA 4E7IA 3AO3A 2Q3SA 3RWUA 1HNIA 3OYLA 4JS4A 4BDYA 2P5OA 4M3UA 3V1OA 3MXJA 3M8RA 4CK3A 5D3GA 3HM9A 2R7YA 4F3TA 2O4IA 2JGUA 1VRUA 1VSMA 2X74A 3ZSYA 4DMNA 3P1GA 4DS5A 2FBXA 4CIFA 4DFMA 3PV8A 4OJRA 1TK8A 1KLNA 2G8KA 3P83D 1BGXT 1ZBIA 3DRSA 1ASVA 3MXMA 4BE2A 1NOZA 5HBMA 4LD0A 4DFPA 1RT3A 3L2VA 4FLWA 3IAYA 1SL2A 1ASUA 3OYEA 3AA3A 4PUOA 4MQ3A 1C0TA 4CGGA 4CHOA 4J2BA 2KFZA 3AO1A 5CZ2A 1NOYA 2B6AA 1FKOA 5I42A 1C1BA 3AVNA 4AHVA 2YKNA 4LY7A 1LW2A 3OJUA 4CJFA 1VSDA 4DSEA 2HHVA 1HYVA 4KHYA 3MAQA 1C6VA 4FJ9A 3LDSA 1TL1A 2HNDA 1U47A 2YNGA 2P5GA 3C94A 2Y1JA 3AVKA 3TAFA 4FVMA 1JL1A 3NCIA 1X9SA 1X9WA 3AVAA 1BI4B 1ITGA 3ISNC 3SUNA 1HQEA 3L3VA 1D9FA 2KZMA 3SV3A 3DMJA 4C8MA 3LZJA 3RRGA 5SWMA 4O0JA 2VG5A 3HK2A 1VSIA 3K2PA 2DFHA 1K6YA 4DSKA 4HCBA 4CK2A 1W9HA 4M3TA 1HPZA 4OGCA 4CEQA 4ELVA 5C42A 1NK6A 1LWEA 2E6MA 3NHGA 3S9HA 4C8LA 1S1TA 2Z1HA 3AVBA 5FRMA 1WSEA 4FZYA 3BGRA 4W5RA 4E7JA 3QEIA 1L3SA 4AHTA 3NF6A 4CJLA 5T7BA 2G8FA 1WLJA 1JLCA 1Y97A 3VQ6A 4CECA 3NH2A 4FJ5A 1T05A 1NJZA 5KI6A 5CY4A 4LSNA 3OYKA 3QESA 4ZTJA 3SUOA 3ZCMA 4CJ4A 1O1WA 1SUQA 1NJWA 4NCAA 4DQQA 1RTJA 1RT6A 1A5WA 1BCMA 1J54A 4O0IA 3AVMA 1GOBA 4FK0A 1Z25A 2A1RA 3RR8A 3WNGA 4JRPA 4DF8A 3RTVA 4FJ7A 2DY4A 3RMCA 1TK0A 1A5XA 2Y1IA 4CJPA 4JS5A 4BE0A 4CERA 4DS4A 3SQ0A 5CYQA 1VSEA 3ITHA 3VQ8A 3TAPA 4CJTA 2VG7A 5CZ1A 2IGIA 3OS2A 5KGWA 4K8XA 4F2RA 2PZSA 4IFVA 1XC9A 4OGEA 1IKXA 4HUFA 3T3FA 4FLXA 3O3FA 2ZE2A 2HMIA 3KLFA 1TV6A 3V1QA 4DF4A 4CEDA 4BWJA 1HQUA 4RW4A 1KFSA 1C0UA 4CGFA 1VK0A 2FC0A 3RR7A 4RW7A 1BI4A 3M8PA 2HNYA 1IKWA 4DTUA 1S1UA 4QOZB 1RBTA 4DU4A 4B9TA 3O4QA 3LPTA 1BIZA 4FK4A 3JYTA 1I39A 3OS0A 3IG1A 5SZTA 4R5PA 3K58A 3K59A 4KAZA 2OPQA 3CYMA 4B08A 4E7LA 2OZSA 1SV5A 3VQEA 3L8BA 3PX4A 4BDPA 5HROA 1WAFA 1JLQA 3LANA 2D0AA 4CF9A 4E1MA 4N5SA 1TAQA 4KTZA 4Z4HA 3L2QA 4M3RA 3OYBA 3KJVA 2HHTA 4KHNA 2OPSA 4CHNA 1JKHA 1RTHA 3KK1A 4OPJA 1R0AA 5HRPA 4FM2A 3PO5A 4O4GA 3C6TA 3PY8A 1KRPA 1BL3A 2XY8A 3DRPA 1U49A 3O4NA 1ZBFA 2BANA 3WNFA 2HHXA 2YHBA 1WAJA 2G8WA 3U6FA 1KTQA 4QAGA 2YV0X 4CEBA 1D5AA 4H4MA 1UOCA 4OKKA 1T03A 4KI4A 1CLQA 3TAGA 4NCGA 3KKSA 3TAMA 2WONA 3LPUA 3ZSRA 3HL8A 4ID1A 4CGDA 1N5YA 3WNHA 5J2NA 3PO4A 2Z1IA 2P1JA 3C95A 4AH9A 1RT4A 3CM5A 2HHUA 1S6PA 3QIOA 2GUIA 1U04A 2VWJA 2LSNA 3AO2A 3TARA 1HRHA 1S6QA 3ZT3A 4CJKA 3KLHA 4FJHA 4ID5A 1LW0A 4CF2A 1YT3A 3SZ2A 1B9DA 4FJ8A 3TAQA 1T8EA 2KW4A 2FBTA 1WSHA 4AHCA 3SPYA 1CXQA 2OA8A 2QXFA 4MFBA 1CZBA 4IFYA 4O44A 3ZSWA 4FLVA 4E7HA 4OVLA 3I8DA 3SCXA 3SNNA 4FLUA 2HVHA 3AO5A 1N6QA 3BDPA 3A2FA 4CFAA 4AHSA 3NDKA 4OKJA 2NUBA 3NH1A 5HRSA 1NK0A 3KIOA 1J5OA 2BDPA 1FKPA 5KRSA 1RDAA 4KO0A 5I3UA 2HHWA 3LP3A 1U45A 4JRQA 1J53A 1T7PA 2QKBA 2HVIA 4KB0A 3CM6A 4J2AA 1WNSA 3HSTB 3CQ8A 2P51A 3KLIA 1QQCA 3NE6A 2OZMA 1CZ9A 5HRNA 1Q8IA 1HJRA 4KTWA 3TAEA 4J2EA 2WOMA 3EYZA 3P5JA 3K5LA 1LV5A 2I5JA 3F9KA 4DTPA 1NK9A 4B9LA 5KRTA 4I9QA 1VSLA 3M8SA 5DK5A 1IO2A 4N47A 3QNOA 4C8OA 4WE1A 1J9AA 1XI1A 2DTUA 1B92A 1TKZA 1GOAA 3L2UA 3U3YA 2XY6A 3OY9A 4M3XA 2HW3A 3HVRA 4KREA 3K5OA 1L3VA 4CGIA 3K57A 1W0HA 1BHLA 3ZSZA 3C6UA 3QIPA 3VQ4A 4DQPA 3VQPA 4DSLA 4E3SA 4FJLA 4BACA 2G8IA 1TKDA 5J2PA 2YNFA 3B6OA 3NGZA 3V81A 2ZD1A 3I0SA 4FW1A 4FJIA 1LAWA 4CHQA 3HP6A 4Z4IA 4OLBA 3AVHA 4H8KA 3HPHA 1KVBA 3VQ5A 1NKEA 3MEGA 3NGIA 1FXXA 4CJ5A 1KCFA 3TI0A 4FJKA 3OYDA 2KTQA 2GBZA 2OYQA 4JLHA 1TGOA 1U4BA 4DG1A 4UQGA 5FRNA 3ZT4A 2E4LA 4OKEA 4FM1A 1NJXA 2QKKA 1NK7A 3AA5X 3ZT1A 4DSIA 3U3GA 4Z4EA 3TABA 3QINA 4B8AB 4Q5VA 3SUQA 4GVMA 3O3GA 3AVLA 4RW6A 3V9WA 3S3MA 1QS4A 1JL2A 1D8YA 4K8ZA 1JLGA 3I0RA 5E41A 3ZSQA 3L2WA 4RG8A 4KV8A 1SKRA 1L5UA 2G8VA 4Z0UA 2HB5A 3G0ZA 4FJMA 3SQ2A 1YVUA 3AV9A 4DTNA 3CFPA 3HT3A 4DFJA 1S1WA 1WSIA 1RDBA 4J2DA 4GMJB 4L8RB 1S9EA 4I9LA 4H4OA 2ETJA 4FW2A 4CE9A 1SL1A 3VQAA 3SYZA 4DQIA 2F96A 1IH7A 1WSFA 4B9SA 1RT7A 4EZ9A 4FLYA 4W5OA 4CEFA 1LAVA 4DTJA 3OYHA 1TVRA 3KKRA 1Q9YA
chains in the Genus database with same CATH superfamily
2NZTA 5HRRA 4ZTFA 3E01A 3WNEA 2KQ2A 3HYFA 5EU7A 3ZT2A 4KH6A 4CCHA 4WF9L 4E0DA 3AVJA 3AVCA 1X1PA 3CPEA 4CZJA 1KAYA 1RT2A 3ZT0A 4CFCA 3SUPA 1Q18A 4PY5A 2D0CA 4AILC 1RBRA 3OVNA 2EWSA 4TSXA 3MEEA 3OS1A 1JLBA 1EKEA 2ZJQL 4WFAL 1WUAA 3QB0A 1Z26A 3VA0A 3CCQN 3OYMA 3CJAA 5C24A 3DLKA 4DV3K 3ZSVA 2HSTA 1Q82O 1RTIA 4CEOA 2AA4A 2GV9A 4EAHD 4KPYA 3HJFA 4G9ZA 4KHUA 3GE1A 3MX2A 2YHYA 4M41A 3O9TA 1XMQK 5HP1A 2PYLA 1Q9XA 4ISGA 2QM1A 4DUYK 1VQ9N 1BCOA 2NRRA 2DFEA 4OPKA 1BUPA 1WB9A 3OYFA 3NAEA 4DR4K 3QEXA 1JXBA 1R59O 4N41A 4FM0A 1BIUA 4IFEA 2P9LB 3THXA 1X9MA 2Z1GA 1TK5A 4XIUA 5AQWA 4CEZA 2YKMA 4B9UA 5C25A 4DFKA 4AHUA 2G8UA 3FZHA 3D7EO 4B1XB 4A57A 4RW9A 3J7ZO 2CGKA 3RSEB 3P31A 4CZGA 4PWDA 1DTTA 3KLGA 2AJQA 1GLCG 3H45C 1S1VA 3LZIA 2FSNA 1ATNA 4LH4A 2NNWA 1MDUB 1BQMA 1Y64A 2HOEA 2VWKA 4F2SA 3PX0A 3QLHA 3L3UA 4JD2A 4HTUA 1WOQA 1XQSC 5AZIA 4BREA 1F21A 4Z4GA 2QK9A 3OJSA 3HM8A 4YOYA 2KFNA 4DLEA 1FK9A 4JKGA 1UA0A 2PYJA 2VWBA 3ULEA 4FZXC 1L3UA 4IKFA 3TANA 4CJVA 4JI5K 4CHYA 2YHAA 4EP4A 1QHTA 1JLAA 1LWFA 2RF2A 1DLOA 1YUWA 2OCEA 3VQBA 4M3WA 4RWTA 3P4IA 3S3NA 4EP5A 3AA2A 1KAXA 4BQLA 3VQDA 1T3VA 1NU0A 3IS9A 3LP0A 1GLLO 4BRQA 5E26A 2FXUA 4M45A 3VEWA 4CJQA 2CGLA 5IWAK 3QETA 1NGDA 1ASWA 3N4PA 5EX5A 3K5NA 4FCYA 1HNZK 3FE1A 2QWOA 3GOIA 2VG6A 5JICA 1QE1A 4CFDA 3CERA 1UA1A 4CGJA 3VGKA 4FWPA 4N76A 1ATRA 3OYNA 1IG9A 3A0IX 4GV9A 1EETA 4DQSA 3B6PA 3DM2A 3F5TA 1GLEG 1H1VA 1HNWK 3VTIA 4DU1A 4PQUA 4EZ6A 1VSJA 3QICA 2KZZA 4GKJK 4Y0WA 3MEDA 4IDHA 4KHSA 4CJ3A 1OVQA 4IOCL 3HPGA 4CIGA 4ZHRA 4FZZA 1V4SA 1L3TA 3E9PA 4DWIA 2D5RA 4DTRA 4E19A 4DR5K 1VRTA 3RMBA 2YNIA 4BDZA 3KK3A 4JS4A 4BDYA 2E2QA 2ZWHA 3V1OA 4DV6K 4DV7K 4CK3A 5D3GA 4F3TA 1TYQA 2CH6A 2X74A 3P1GA 4DS5A 4K42A 3J80O 1U2VB 3P83D 3LDNA 3O9RA 3MXMA 3AGKA 4PUOA 2KFZA 4CHOA 1NOYA 3DAWA 5I42A 1C1BA 3AVNA 2YKNA 1W7AA 3OJUA 4DSEA 2A5XA 3R8EA 1C6VA 2J4RA 4LF8K 5F0XA 2P5GA 5LJVA 3C94A 5CHIA 2Y1JA 3TAFA 3NCIA 5GAEP 3AVAA 1BI4B 5AZJB 2F7TA 3DJCA 3UKUA 3L4QA 3PIOL 1K6YA 4DSKA 4M3TA 4OGCA 4CEQA 4ELVA 4NLBA 1LWEA 2E6MA 3BEXA 4FWRA 4KH4A 1HKCA 1JLCA 3VQ6A 4CECA 4BRGA 1QZ5A 4ZTJA 3SUOA 5BRHA 3U8XA 1NJWA 4DR7K 3CCVN 2ITMA 2A1RA 3WNGA 5AQRA 4JRPA 3RTVA 4DF8A 4FJ7A 3WEEB 4FWMA 4WQ5C 4DS4A 5CYQA 5MLCQ 3ITHA 4CZHA 2IGIA 2P9NB 2PBDA 5ELZA 5CE3A 4GKKK 5M1PA 1XC9A 1IKXA 4R79A 2NRZA 3S41A 3KLFA 1TV6A 4HCBA 3CHWA 4CGFA 3BF3A 1QVGM 4RW7A 1IKWA 4JEPA 2E1YA 2HBMA 3K58A 4LFBK 3K59A 3MCPA 2OPQA 4B08A 4BRHA 3L8BA 3ID6A 3PX4A 5HROA 1JLQA 4FSVA 4KTZA 4M3RA 3KJVA 2HHTA 4ILJA 4H0YB 1JKHA 4BRCA 1VQ4N 5HRPA 2YCHA 4FM2A 5C12A 1KRPA 1XNQK 2E2NA 5AFUA 2XY8A 4JK9A 4JI8K 1ZBFA 2BANA 2HHXA 3U6FA 4CEBA 2GEMA 2YV0X 5ADXA 3GDQA 2V7YA 5E84A 1Q7YO 4OKKA 3THWA 1IBKK 3IMXA 4YDUC 1HKGA 3HL8A 4ID1A 1JCGA 3PO4A 5J2NA 2O8DB 4U67L 2A6AA 3CM5A 2HHUA 1S6PA 2QTDA 1U04A 1U6ZA 4GVEA 3EN9A 3THYB 3OW2M 2UUBK 4FJ8A 2Q0UA 5KQDA 2H3GX 1CXQA 5AQXA 2HMPA 3FR0A 3CJ9A 3NVMA 4PHTX 4FLVA 1YAGA 4E7HA 3I8DA 3SNNA 1M1KO 4C1NI 3AO5A 4MDAA 4F9OA 3HOSA 3BDPA 3UKRB 3H46O 5EXWA 4A62A 4OKJA 2NUBA 5HRSA 3KIOA 4JV5K 2KHOA 5KRSA 2QWNA 5I3UA 3LP3A 2QKBA 2NRWA 2FF6A 3CM6A 2W6KA 3PLAA 1CZ9A 4JK7A 5HRNA 1Q8IA 4KTWA 3BP8A 4LFCK 3M8SA 3AAPA 4RTFD 3IUCA 1VQON 5BR9A 2DTUA 4FOEA 3L2UA 1TKZA 2A40A 3QBWA 1N34K 2HW3A 3HVRA 4BRPA 4CGIA 3K57A 3ZSZA 3VQ4A 4JYAK 5A2QO 2CH5A 3PSIA 3EE9A 3B6OA 2ZD1A 4CHQA 3HP6A 3AVHA 4JKBA 3L6QA 3SK3A 3TI0A 1ZBSA 3VEZA 1YHQN 5HOOA 4OKEA 4FM1A 4DSIA 4Z4EA 3ZX0A 4Q5VA 4GVMA 3O3GA 3V9WA 4RW6A 3S3MA 3QMLA 3I0RA 1KD1O 1CZAN 1SKRA 1L5UA 2HB5A 3G0ZA 3TTCA 4A2AA 1TUYA 1S1WA 4J2DA 3LL3A 1SL1A 1MWMA 2F9TA 1RT7A 4FLYA 4GY2B 5FDLA 1TVRA 2W6LA 4JNEA 4FJXA 3TU5A 3ZETA 4O8KA 1REVA 3AVGA 3KHYA 2A42A 2NRHA 3V1RA 3V4IA 4CFBA 1JXEA 1A5VA 1BQNA 4I6MA 3VQ7A 1RBUA 3VETA 5JS2A 4OPHA 4FJGA 4X64K 5CYMA 4CI6A 3JSMA 4Y1CA 3AARA 1YI2N 1RCHA 4BVPA 3CCUN 1T44A 1UWBA 1ZBLA 4JAXA 4DV0K 2YJEA 2D4WA 4BWMA 1LCUA 3F73A 1NGFA 5FROA 1RDCA 4QS9A 2ZJPL 2EX3A 3NH0A 5AJ3K 3CQXA 4OLAA 1P8ZA 4O5BA 4HCCA 1DT9A 4E1NA 2F8TA 3OYGA 4QS8A 4O55A 3SJHA 4IJNA 4BC4A 4CIEA 1JJ2M 3NGYA 4KI6A 4YNQA 4QCLA 2BGGA 1BISA 4H5VA 4DU3A 3G10A 4I2PA 1I3AA 4IG3A 1NK5A 4W5TA 3KLEA 2YX6A 2OANA 5AQSA 3ULEB 2QWRA 2UUAK 1RDUA 2D0BA 3LWLA 4DTXA 2FF3B 1VQ8N 4XH1A 4FJNA 2HHQA 1EXQA 4AM6A 3F2KA 3CJCA 3H1VX 3SJJA 4YOXA 1XHZA 4PKGA 2PY5A 1NJYA 3VMFB 4FLTA 3MXIA 3CI5A 5KGXA 4G1QA 3P38A 1TUUA 4MLHA 3CG7A 2VCPA 1NGJA 3FFIA 3AVFA 5BR8K 1S1XA 4NYFA 4CZIA 3EZWA 2O8BA 1XHXA 1HJOA 3A5OC 4E7KA 2UXDK 3AO4A 5C15A 1ZBHA 2PFUA 1RFQA 4I2QA 4CHPA 3HBTA 3WXLA 4FXDA 2QEXN 3E9OA 4CJWA 1TKTA 3CC2N 4B1VA 2XRIA 1YTUA 4DR1K 1YITN 4DUZK 1HYZA 4BRFA 4HUGA 2HF3A 2DPNA 5AQFA 3CCJN 2O4GA 2QW9A 3V9XA 4IJAA 5J2QA 3NBPA 3UE5A 2X6NA 3QERA 3NF9A 4JKFA 1IKYA 3ATUA 5M1KA 3ENOA 4KKOA 4PA1A 5AQVA 4MO5A 3HP9A 1E4FT 1VSKA 1N33K 1HUXA 1JLEA 1GLDG 1IKVA 3MN6A 4IO8A 1TYQB 4YOTA 3SAGA 4FYDA 3ID8A 1XMOK 2Q1NA 4IO9L 1NK4A 3ZEUB 2Q2RA 4B3OA 3D6RA 1ESVA 2X6SA 3DRRA 3ZSXA 4BG9A 2JLEA 3DLBA 4Z4CA 1KVAA 4K25A 4NO7A 4NLCA 4W5QA 1HMVA 3RRHA 1VSFA 1G15A 1EO1A 1MU2A 5AQIA 3RMDA 3HVTA 2AP1A 1RTDA 2ATQA 4M3YA 1VQMN 1RILA 1EQYA 4DSJA 3V9ZA 4CHZA 4IBNA 1HYSA 3HI0A 3AO3A 3FLCO 1QQNA 2Q3SA 1HNIA 5AQYA 3WXJA 3OYLA 3J81O 1BU6O 4DV4K 1YJWN 1VRUA 4BRAA 3GBTA 1YIJN 1MA9B 4CIFA 3PV8A 4OJRA 2G8KA 2P9IB 3ATVA 1BG3A 1V4TA 1BGXT 5AQPA 3DRSA 4H0PA 4DFPA 4FLWA 2V7ZA 3IAYA 1SL2A 1ASUA 4LF6K 3EKUA 4CGGA 3M3ZA 4IZ9A 2W40A 2B6AA 3VF6A 4AHVA 4LY7A 2YI1A 5AQQA 2HHVA 4JHDA 3LDSA 2YNGA 2ASOA 4DV1K 2UUCK 2YHXA 1Z05A 1ZXOA 4FVMA 4WQ4A 1HQEA 1IBMK 3MK6A 3DMJA 3R1XA 4O0JA 5SWMA 1WBDA 2Q36A 3K2PA 3KVGA 4HTLA 1W9HA 4CK2A 1HPZA 3NHGA 4OX9K 1WSEA 1HX1A 3DXMA 3H1QA 4E7JA 3QEIA 1NM1A 1L3SA 1N36K 1DGKN 1WLJA 3DXKB 3QESA 5LY3A 4CJ4A 1SUQA 4IOXA 1A5WA 2WBNA 4O0IA 4FK0A 1J6ZA 4FWOA 2DY4A 3RMCA 2Y1IA 4BE0A 3I33A 4NXMK 3H6EA 4CJTA 2VG7A 5CZ1A 3WUHA 4JKCA 4F2RA 1OKJA 3CXCM 3MN9A 4HUFA 4BR2A 3O3FA 4A5AA 4DF4A 4CEDA 4BWJA 3CCMN 3RR7A 4I9QA 3EE8A 2FC0A 2O8EA 3M8PA 1Q81O 2HNYA 1RBTA 4A61A 4H5NA 3E1YA 3JYTA 1I39A 4KAZA 4KBOA 5SZTA 2ZF5O 3TTDA 4NB4A 3CYMA 1SV5A 3VQEA 5C2FA 1K73O 4BDPA 1TAQA 3L2QA 4CHNA 4GNIA 1O13A 3H3NO 4OPJA 1R0AA 3WNFA 1WAJA 3LM9A 3O08A 4H4MA 3WT0A 3C7NB 5LL6Z 3MCAB 2IVPA 3LPUA 2FSKA 1C0GA 2P1JA 4AH9A 4FOIA 3G4SN 2GUIA 1IV0A 1HRHA 1S6QA 4CJKA 1LW0A 3FFKB 3O80A 4CF2A 1QQMA 2O8FB 3KWIA 1T8EA 3D2FB 2FBTA 1BO5O 2OA8A 4MFBA 1CZBA 4O44A 2Q97A 1N6QA 1ZC6A 4CFAA 4LF4K 4AHSA 3VEOA 1J5OA 3FZKA 2WTUA 4RCHA 1U45A 3CC4N 4FVUA 4J2AA 3CQ8A 2P51A 3O9SA 3VGLA 4E1JA 2QWPA 4O8UA 3TAEA 4B1UB 3LM2A 3CJ1A 5KRTA 1VSLA 3KK7A 3QNOA 2E1ZA 2VGNA 4WE1A 1J9AA 3W3DA 4M3XA 1L3VA 3SAFA 3M5RA 1W0HA 1BHLA 3QIPA 4FJLA 3R9PA 3VQPA 4BR7A 2HF4A 5GIOA 5J2PA 1S72N 2YNFA 1KAZA 4BRNA 4Z4IA 4FW1A 1KVBA 1NKEA 3MEGA 1NGHA 4I6MB 4FJKA 4DR6K 1HR0K 4AF1A 2GBZA 4DB3A 1SAZA 1TGOA 2D1KA 1M90O 4DG1A 4UQGA 2E4LA 4BQZA 1NJXA 1NK7A 3AA5X 4WCEL 3U3GA 1NGCA 1QS4A 1D8YA 2ZM6K 1JLGA 2P9LA 1NBWA 3D2EA 5TKWA 3SQ2A 3AV9A 4A5BA 3CFPA 2ASPA 3HT3A 1RDBA 4DHYA 5BN9A 4I9LA 3BZKA 4K41A 4CE9A 4Z94A 3SYZA 4YOUA 3K9KA 1WSFA 4B9SA 5AQJA 1YF5L 4H0TB 4IWVA 2QA4N 4JKDA 3LDOA 3U9ZA 4DCHA 2D0OA 4HVJA 3KD1E 2A1SA 2G8HA 4KHQA 1ZBUA 4ELUA 1UAXA 2RHKA 3U9DA 4F3OA 4Q0BA 3S3OA 2ITGA 4QS7A 2A3ZA 1S9GA 1NNEA 1CXUA 3K5MA 4HHTA 2X78A 4XH4A 2HBJA 1W97L 5DMRA 2OPPA 2P9SB 4CF1A 1KVCA 4ICLA 3L0QA 1NKBA 1GLJO 3A5LC 4KRFA 1NK8A 4LFAK 3T19A 3EO3A 5AQUA 4FK2A 2UXCK 1K8KB 3NFAA 3UIQA 1TL3A 3N4QA 3V9UA 4CF0A 3DI6A 2RN2A 3O9QA 3VGMA 1KQSM 4JN4A 4B1ZA 3I8BA 1HNXK 2EHGA 2QXLA 4CJSA 1KC8O 2RPIA 5AQLA 2IAJA 3LP2A 1OVYA 3M6GA 1KSPA 1T6CA 3CCEN 3VENA 5BN8A 2YNHA 4JI0K 5J1EA 3DOLA 4FJJA 2ZGYA 4FWNA 3ALYA 3P39A 1QTMA 1T6DA 3MECA 4Y1DA 3MDQA 1TAUA 4KH5A 4BC2A 2FSJA 4H0VB 1NWKA 4CZKA 2Z1JA 4B9VA 3HXMA 3CC7N 2HHSA 5I9EB 3OHRA 4CZFA 4CW7B 3VOVA 4JI1K 2KKZA 3Q7CA 2PAVA 4C8KA 3VF4A 3ULDA 5FPMA 3K9JA 3IRXA 4FWKA 2P9UA 5F1XA 2I7PA 3QFUA 1HNVA 1OH8A 4NXNK 2P9KA 3ZX3A 2HNZA 2E88A 2FBYA 2E5LK 4WFNL 4V19S 3J7YP 2IS3A 1RBSA 1YTAA 3DLGA 4C1NK 3TWHA 5J2MA 3T1AA 3RMAA 4XEIA 1VQLN 5EOYA 3LDLA 1C0MA 4ELTA 2OPRA 2VYPA 2UYTA 3D45A 3DLHA 3MN7A 4B9MA 1LWCA 2VQEK 1U2VA 3E66A 4JI3K 3KTQA 3EKSA 2YJFA 3DLRA 4CEAA 4M3ZA 3LALA 3HOTA 4JK8A 4BGBA 4LH5A 3SAHA 3KK2A 5LMNK 1N32K 1SL0A 1ATSA 4U7BA 1KXPA 3QBXA 4ILGB 3DYAA 4ISEA 4PL7A 4DSFA 1S5JA 4YFUA 2E20A 4L3QA 4HUEA 3THXB 4KFBA 2XY5A 2IDOA 3DOKA 4K0KK 1XUPO 4DTSA 4M7XA 2ASMA 4BGAA 4YOVA 3O4WA 3ASMA 3EY1A 4CGHA 3MWTA 1XNRK 1VQKN 4CJRA 3GG4A 3CFOA 3SQ4A 1RNHA 1I94K 1SZ2A 3U4LA 3HTVA 4DQ8A 4GV3A 4JD2B 1YJNN 4JKHA 4NYNA 4CEEA 3DWLA 4IG0A 1EWRA 5TKYA 5AZIB 3C0BA 3QNNA 2DFFA 4B9NA 3SV4A 4LC9B 2ZQBA 1NG9A 2E6LA 4JKGB 3LDQA 3RWUA 2P5OA 3M8RA 1VSMA 4DMNA 1VQ5N 2GX9A 4B9QA 1BA1A 2F4VK 1ZBIA 5AQGA 4BE2A 4LD0A 3OYEA 4EHTA 1C0TA 4J2BA 3AO1A 5CZ2A 3NVKA 4H0OA 5BRFA 3BZCA 4A2BA 4X62K 1LW2A 1VSDA 3JAMO 4KHYA 4FJ9A 1U47A 1HPMA 3CD6N 1JL1A 1X9SA 1X9WA 1ITGA 3ISNC 3SUNA 2KZMA 2O8CA 3SV3A 3O8MA 4ILHA 4C8MA 1NGIA 3LZJA 3HK2A 4HWIA 2VQFK 3RVCA 4FPBA 5C42A 3I55N 1NK6A 3TSQA 2NRTA 3S9HA 1S1TA 2Z1HA 3AVBA 4FZYA 1HKBA 4AHTA 3NF6A 5FLXO 1Y97A 2GWKA 2CGJA 5KI6A 5CY4A 4LSNA 3OYKA 3CJBA 5AFUH 3ZCMA 4BC3A 4FPAA 4DQQA 4O5FA 1RTJA 5ADXH 3B8AX 3UKRA 4XH5A 1BDGA 1Z25A 4CBWA 3RR8A 1TK0A 1RDWX 1A5XA 3SQ0A 3VQ8A 3TAPA 5KGWA 1E3MA 4FWQA 5KPRA 3O6WA 3VERA 2OTJN 4MDBA 4IFVA 5C10A 3OTOK 3O9UA 3WQUA 4FLXA 3VESA 2ZE2A 4RW4A 1KFSA 1C0UA 2HBKA 3PIPL 1S1UA 4QOZB 4B9TA 3LPTA 1BIZA 4FK4A 3IG1A 4R5PA 4B3TK 1WAFA 3LANA 4CF9A 4CZLA 2GELA 4K43A 2GTDA 4KHNA 1RTHA 3QDKA 4FWLA 3VF2A 3PO5A 3C6TA 3DRPA 2YHBA 1KTQA 2VGMA 3QFPA 4BRLA 3GL1A 4KI4A 1T03A 3A5NC 1JCEA 4NCGA 3KKSA 3UKUB 3TAMA 2WONA 3IFRA 3WNHA 3C95A 1RT4A 2VWJA 4J8FA 3AO2A 3TARA 5AQNA 3ZT3A 3CETA 1BOTO 4AQYK 3G6EN 1B9DA 3WXMB 3TAQA 1WSHA 2HVHA 1VQPN 4OVLA 4FLUA 5CR4A 3A2FA 3NH1A 1FKPA 3TSUA 1RDAA 3ZLJA 1NJIO 4JI6K 3HSCA 1J53A 1T7PA 3VPZA 3HSTB 4BRDA 3WXKA 3D2EB 4J2EA 4CZMA 3P5JA 5BPLA 1LV5A 2I5JA 4DTPA 3CJ7A 4B9LA 1NMNA 4AM7A 2QWLA 2NLXA 1B92A 2XY6A 4GV6A 3OY9A 5LJWA 3K5OA 3O1BA 1JCFA 4CD1A 3UB5A 3C6UA 1S22A 4DQPA 4DSLA 4E3SA 4BACA 1TKDA 4YHHK 4WQ5A 3NGZA 5FPDA 3V81A 4OLBA 3HPHA 5M1FA 3VQ5A 3NGIA 1FXXA 4B3RK 1KCFA 3OYDA 2KTQA 2OYQA 1YVNA 3EL2A 4BR9A 2NRXA 3BUZB 3THWB 2QKKA 2QWMA 3ZT1A 3ENBA 3TABA 2BUPA 2P9PA 4YOWA 5JVHL 3SUQA 2HHHK 5E41A 3ZSQA 3Q7BA 3ENHA 2G8VA 4Z0UA 2BH1A 3J8AA 2V51B 1YVUA 3A5MC 1K9MO 4WYBA 1WSIA 4L8RB 1S9EA 3JXUA 4H03B 4H4OA 2ETJA 4FW2A 2F96A 4BRMA 4EZ9A 4JI2K 3CIPA 2ZGZA 1LAVA 3VTHA 3T69A 1QQOA 3KKRA 1Q9YA 3SBGA 1SS6A 1DKGD 3NF7A 5EY4A 4DR3K 4YDUA 3QO9A 2F8SA 4CJUA 3WQTA 5B8HA 4IOAL 5BRDA 1BA0A 4RW8A 1QVFM 3TPQA 3M8QA 3VA3A 3KZBA 1WN7A 3HO1A 1QZ6A 1OH6A 1DEJA 3NMUA 3L4IA 3CFRA 3VN5A 4KHPK 2XO7A 2JWLA 3OBYA 2RE2A 5LMUK 4KTQA 2P9UB 3CF5L 4CD3A 4BR4A 5F2RA 2UXBK 3V6DA 2B4JA 2IOCA 3PUFA 2P9KB 3L2RA 1B9FA 1QSYA 2XHBA 4DKWA 1RDDA 4FO0A 4M7YA 3ZSOA 3JS6A 5KTQA 1GOCA 4DQRA 5GADP 1KFDA 4OO1J 3VQQA 3SLCA 2WUSA 3HPOA 4FLZA 4CESA 4IDKA 4B3SK 3KD5E 1XWLA 2BTFA 3VQCA 5K14A 1VHXA 4KHWA 3THVA 4Z4FA 1X3MA 3VEVA 3ZEUA 4B1WB 5AQMA 1LOTB 1RT5A 2WC9A 1NLVA 4DLGA 3D0PA 1SKSA 3SPZA 4JI7K 3AVIA 3ZETB 3O3HA 3QEPA 1D9DA 4M42A 3LP1A 3MX5A 1WSGA 3OYIA 3MMVA 1IBLK 3TR8A 1RT1A 4C8NA 2NRVA 3LWMA 4LSLA 2IIRA 4NCBA 4H5WA 4YORA 4C23A 4I7FA 2BE2A 1QSLA 2WFBA 4F4KA 2IC3A 3EZ5A 3OYJA 1VAZA 3VEYA 1TKXA 1VSHA 3VQ9A 1C0FA 3CCLN 3OYCA 5BPMA 3NF8A 4CF8A 2D0PA 5C2DA 3TSPA 1X9JA 3V9SA 3QEVA 4WQ4C 1YXQA 3FZFA 3VEXA 1GLBG 3LAKA 2XY7A 4KB1A 3CMAN 3AA4A 5JS1A 1SKWA 2P9IA 3SI6A 5GINA 5AQOA 3SQ1A 1NKCA 3OYAA 4F8RA 4CJ7A 1C1CA 2RKIA 5KPTA 1N8RO 4W5NA 4DTMA 4GW6A 5M1OA 3RSEA 1JLFA 5DM7L 5JVGL 1EWQA 4DV2K 1EP4A 3DLEA 4DTOA 1U48A 4IEIA 3MN5A 1ZYQA 3I56N 1QSSA 4CK1A 4BROA 4MLEA 4N56A 1EX4A 4PL8A 2FBVA 3PSFA 4BE1A 4E89A 5IT9O 3LAMA 5FPNA 2W42A 2B5JA 3H08A 1MWKA 3CPWM 3QEWA 3DXKA 5AQTA 4AHRA 2OTLN 4BR0A 1RBVA 2E2OA 3IDHA 4ISFA 3FGUA 4H0XB 4B8CA 1KLMA 5HLFA 1WSJA 2O8CB 5H1SQ 1SQKA 3CMEN 2O8BB 3PX6A 4EHUA 2GWJA 4B1YB 3KWGA 4CJEA 1DTQA 3DLLL 1C1AA 3SBTA 4BC5A 4E7IA 4X66K 5HL7L 2KLAA 4M3UA 3MXJA 4JI4K 3HM9A 2R7YA 2O4IA 2JGUA 3ZSYA 3BF1A 1S3XA 2FBXA 3CCRN 4DFMA 1TK8A 3SMSA 3EEQA 1KLNA 1ASVA 4BR5A 1NOZA 5HBMA 1RT3A 3L2VA 5FPEA 1ILYA 3AA3A 4MQ3A 4H5TA 1FKOA 2IVOA 4X65K 4CJFA 1HYVA 3MAQA 5GAHP 1TL1A 2HNDA 3ZYYX 4PKHA 1IG8A 5BPNA 3AVKA 3F9MA 2W41A 2GUPA 3L3VA 4PKIA 1D9FA 2JWKA 3FZLA 3C7NA 3RRGA 1WBBA 2VG5A 1VSIA 4BRKA 2DFHA 3OBWA 4EIAA 3BY5A 1VQ7N 3IKMA 2QWQA 4H5RA 5FRMA 3BGRA 4W5RA 5M1QA 5KQ8A 4CJLA 5T7BA 2G8FA 4FJ5A 4FL9A 3NH2A 2FLOA 1T05A 5BREA 1NJZA 2UU9K 2O8FA 4BY9C 3AAQA 3D2FA 4LF5K 1O1WA 1NGGA 4NCAA 1RT6A 1BCMA 1BWFO 2F9WA 5GIPA 1J54A 3AVMA 1GOBA 5GAGP 4CJPA 2A41A 4JS5A 4CERA 5AQHA 1VSEA 2QI2A 3OS2A 4K8XA 1NMDA 2PZSA 3MWPA 4OGEA 3T1HK 3T3FA 3O5BA 2HMIA 1GLFO 3CQYA 3LDPA 3V1QA 3G25A 1HQUA 1VK0A 1BI4A 5AZJA 5DM6L 4DTUA 4DU4A 3G71N 4IEEA 3O4QA 3H3OB 3OS0A 3OA9A 2OZSA 3AY9A 4E7LA 1D4XA 2E2PA 3ZX2A 5EVZA 4BVOA 4E1MA 2D0AA 2HBLA 4N5SA 4Z4HA 5KPZA 3OYBA 3CCSN 2OPSA 1OH5A 3R3LA 5JMVA 3KK1A 4JHDB 4O4GA 3HRGA 3PY8A 1GLAG 1IJJA 1BL3A 1RGIA 1U49A 3O4NA 2V52B 4JKEA 4LF7K 2G8WA 1J5EK 4QAGA 1QHAA 2IVNA 4IXCA 4B3MK 1OH7A 1D5AA 1UOCA 3WEEA 1CLQA 3TAGA 4UY8O 5M1NA 1N5YA 3ZSRA 1XC3A 4CGDA 3E9LA 2YHWA 2Z1IA 3WXIA 1FW6A 2P9NA 3QIOA 4JKAA 2LSNA 4BG8A 1NGAA 2E8AA 4FJHA 3KLHA 4LF9K 3DXMB 4ID5A 1YT3A 3SZ2A 2KW4A 4AHCA 3SPYA 2QXFA 4IFYA 4C8LA 3ZSWA 3SCXA 3SMPA 3HZ6A 4A59A 1P90A 4DV5K 4YY3K 4EFHA 1HLUA 3NDKA 2ZJRL 1NK0A 2BDPA 4CBXA 1X3NA 3TTFA 1G99A 4KO0A 2P9PB 2HHWA 3C6HA 4CBUA 4JRQA 2HVIA 4KB0A 1WNSA 5AQZA 3KLIA 1QQCA 4DR2K 3NE6A 2OZMA 4CVNE 4WFBL 1HJRA 2WOMA 3EYZA 3K5LA 3F9KA 1NK9A 3C65A 5AQKA 2I7NA 2Q31A 5JLFA 2O8EB 3J7AP 2P9SA 5DK5A 4CZEA 1IO2A 4N47A 3K0SA 4C8OA 1XI1A 3A8YA 4OPAA 1GOAA 3U3YA 3R6MA 2Q0RA 4KREA 2O8DA 1NGEA 3T1YK 3AGRA 1K8AO 1Q86O 1W2BM 2G8IA 1K8KA 3THYA 4FWSA 1YJ9N 3I0SA 4FJIA 1LAWA 1VQ6N 4H8KA 1FJGK 1VQNN 4CJ5A 5JLHA 4JLHA 1U4BA 5FRNA 3ZT4A 3O1WA 5C0YA 4MO4A 3QINA 4B8AB 3FZMA 1E4GT 3AVLA 1JL2A 4K8ZA 4M63C 3L2WA 4RG8A 4KV8A 3T7ZA 3C6AA 4FJMA 4DTNA 1NGBA 4DFJA 4GMJB 3M1FA 5AR0A 3VQAA 4BRIA 4DQIA 1IH7A 4W5OA 4CEFA 4DTJA 3OYHA 1Z6RA 3W0LA
chains in the Genus database with same CATH topology
4HVJA 5HRRA 3NF7A 3E01A 4ZTFA 4FJXA 3KD1E 3WNEA 2A1SA 5FDLA 2KQ2A 3HYFA 2G8HA 1REVA 5EU7A 1ZBUA 3AVGA 3ZT2A 4ELUA 4KHQA 1UAXA 4CCHA 4E0DA 3AVJA 3AVCA 3V1RA 3V4IA 3QO9A 4CFBA 4F3OA 1JXEA 1X1PA 2F8SA 4Q0BA 1A5VA 4CJUA 3S3OA 2ITGA 1RT2A 3ZT0A 1BQNA 1S9GA 3VQ7A 4RW8A 1RBUA 4CFCA 1CXUA 5JS2A 3SUPA 4FJGA 3K5MA 4PY5A 5CYMA 2D0CA 3JSMA 4HHTA 2X78A 3M8QA 4Y1CA 4AILC 1RBRA 3VA3A 3OVNA 5DMRA 1RCHA 1WN7A 2OPPA 4TSXA 3MEEA 4CF1A 1KVCA 1JLBA 4ICLA 3OS1A 1EKEA 3HO1A 1NKBA 1ZBLA 1UWBA 1Z26A 4KRFA 3VA0A 1NK8A 4BWMA 3OYMA 3T19A 3F73A 5C24A 3DLKA 4FK2A 3ZSVA 3CFRA 5FROA 3VN5A 1RDCA 1RTIA 4CEOA 3NFAA 2XO7A 2EX3A 3NH0A 3UIQA 2GV9A 1TL3A 4OLAA 3V9UA 4CF0A 3DI6A 2RN2A 4KTQA 4KPYA 3HJFA 4KHUA 4O5BA 3V6DA 4HCCA 4E1NA 2F8TA 2B4JA 2IOCA 3OYGA 3PUFA 3L2RA 2EHGA 1B9FA 4O55A 4CJSA 4M41A 2RPIA 1QSYA 2IAJA 2XHBA 3LP2A 5HP1A 2PYLA 1KSPA 4CIEA 1RDDA 1Q9XA 3NGYA 3ZSOA 4KI6A 4YNQA 4QCLA 2BGGA 1BISA 5KTQA 1BCOA 4DU3A 2YNHA 3G10A 1GOCA 1I3AA 2DFEA 4I2PA 4OPKA 5J1EA 3DOLA 4DQRA 3OYFA 4IG3A 3NAEA 1KFDA 4FJJA 3VQQA 3QEXA 1JXBA 1NK5A 4N41A 4W5TA 4FM0A 3KLEA 3ALYA 3HPOA 1QTMA 4FLZA 1BIUA 4CESA 4IDKA 1X9MA 2Z1GA 1XWLA 2D0BA 3LWLA 4XIUA 3VQCA 4DTXA 4CEZA 1TK5A 3KD5E 2YKMA 3MECA 4Y1DA 5K14A 4B9UA 4FJNA 2HHQA 4KHWA 5C25A 3THVA 4Z4FA 1TAUA 4DFKA 1EXQA 4AHUA 3SJJA 2G8UA 1XHZA 1RT5A 4B9VA 2Z1JA 4RW9A 2PY5A 1NJYA 3HXMA 2HHSA 4DLGA 3D0PA 4FLTA 1SKSA 3SPZA 3MXIA 5KGXA 4PWDA 3AVIA 3O3HA 4G1QA 4C8KA 1DTTA 3KLGA 3ULDA 3QEPA 1D9DA 3LP1A 4M42A 1S1VA 2AJQA 1WSGA 3OYIA 3LZIA 3CG7A 4LH4A 3IRXA 3TR8A 1RT1A 1BQMA 4C8NA 3FFIA 3LWMA 3AVFA 2VWKA 4LSLA 4NCBA 1S1XA 1HNVA 4F2SA 4I7FA 3QLHA 3L3UA 4NYFA 3PX0A 2BE2A 1QSLA 4HTUA 1XHXA 2HNZA 4E7KA 2IC3A 4F4KA 3AO4A 2FBYA 1ZBHA 1F21A 3EZ5A 3OYJA 4I2QA 4CHPA 1TKXA 1VSHA 3VQ9A 4Z4GA 2QK9A 4FXDA 2IS3A 3OJSA 1RBSA 1YTAA 3OYCA 2KFNA 3DLGA 3NF8A 1FK9A 4CF8A 3TWHA 3T1AA 4CJWA 4DLEA 5J2MA 1TKTA 3RMAA 4ELTA 1C0MA 1UA0A 2PYJA 2OPRA 2XRIA 3V9SA 3QEVA 4FZXC 1L3UA 3D45A 1YTUA 4IKFA 3DLHA 3TANA 4CJVA 1HYZA 4B9MA 3LAKA 4CHYA 1LWCA 4HUGA 2XY7A 4KB1A 3KTQA 2O4GA 2YHAA 3AA4A 1SKWA 4EP4A 5JS1A 3SI6A 3V9XA 1QHTA 3SQ1A 5J2QA 3NBPA 1JLAA 2X6NA 1NKCA 3DLRA 4CEAA 3NF9A 1LWFA 2RF2A 3LALA 3OYAA 3QERA 1C1CA 4F8RA 4M3ZA 1DLOA 1IKYA 2RKIA 3VQBA 4W5NA 4LH5A 4DTMA 4KKOA 4GW6A 4PA1A 3KK2A 1JLFA 4M3WA 1EP4A 4EP5A 3S3NA 1SL0A 3HP9A 3AA2A 3DLEA 4DTOA 1U48A 3VQDA 3DYAA 1VSKA 4DSFA 1ZYQA 1S5JA 4YFUA 1QSSA 1JLEA 4CK1A 1IKVA 3IS9A 4HUEA 4KFBA 3LP0A 4N56A 4FYDA 1EX4A 2XY5A 2FBVA 4M45A 4CJQA 1NK4A 3QETA 2IDOA 3DOKA 1ASWA 3K5NA 4BE1A 4E89A 4FCYA 4B3OA 3LAMA 2VG6A 2X6SA 3DRRA 3ZSXA 1QE1A 4CFDA 4DTSA 1UA1A 2JLEA 4CGJA 3DLBA 4Z4CA 2W42A 2B5JA 3H08A 3OYNA 4N76A 1KVAA 1IG9A 3QEWA 1EETA 3ASMA 3B6PA 4CGHA 3DM2A 3EY1A 4DQSA 4AHRA 4W5QA 1HMVA 4CJRA 3RRHA 1VSFA 3CFOA 1G15A 1RNHA 3SQ4A 1MU2A 1RBVA 4DU1A 4PQUA 4EZ6A 3RMDA 1VSJA 3HVTA 1RTDA 2KZZA 4B8CA 1KLMA 3MEDA 5HLFA 1WSJA 2ATQA 4KHSA 4CJ3A 4M3YA 4NYNA 4CEEA 3HPGA 4IG0A 4CIGA 1RILA 3PX6A 4ZHRA 4FZZA 4DSJA 1L3TA 3V9ZA 2DFFA 2D5RA 3QNNA 4DWIA 4DTRA 4CHZA 4B9NA 4E19A 3SV4A 1VRTA 4CJEA 2YNIA 1DTQA 3RMBA 2ZQBA 1C1AA 4BDZA 4IBNA 3KK3A 1HYSA 2E6LA 4E7IA 3AO3A 2Q3SA 3RWUA 1HNIA 3OYLA 4JS4A 4BDYA 2P5OA 4M3UA 3V1OA 3MXJA 3M8RA 4CK3A 5D3GA 3HM9A 2R7YA 4F3TA 2O4IA 2JGUA 1VRUA 1VSMA 2X74A 3ZSYA 4DMNA 3P1GA 4DS5A 2FBXA 4CIFA 4DFMA 3PV8A 4OJRA 1TK8A 1KLNA 2G8KA 3P83D 1BGXT 1ZBIA 3DRSA 1ASVA 3MXMA 4BE2A 1NOZA 5HBMA 4LD0A 4DFPA 1RT3A 3L2VA 4FLWA 3IAYA 1SL2A 1ASUA 3OYEA 3AA3A 4PUOA 4MQ3A 1C0TA 4CGGA 4CHOA 4J2BA 2KFZA 3AO1A 5CZ2A 1NOYA 2B6AA 1FKOA 5I42A 1C1BA 3AVNA 4AHVA 2YKNA 4LY7A 1LW2A 3OJUA 4CJFA 1VSDA 4DSEA 2HHVA 1HYVA 4KHYA 3MAQA 1C6VA 4FJ9A 3LDSA 1TL1A 2HNDA 1U47A 2YNGA 2P5GA 3C94A 2Y1JA 3AVKA 3TAFA 4FVMA 1JL1A 3NCIA 1X9SA 1X9WA 3AVAA 1BI4B 1ITGA 3ISNC 3SUNA 1HQEA 3L3VA 1D9FA 2KZMA 3SV3A 3DMJA 4C8MA 3LZJA 3RRGA 5SWMA 4O0JA 2VG5A 3HK2A 1VSIA 3K2PA 2DFHA 1K6YA 4DSKA 4HCBA 4CK2A 1W9HA 4M3TA 1HPZA 4OGCA 4CEQA 4ELVA 5C42A 1NK6A 1LWEA 2E6MA 3NHGA 3S9HA 4C8LA 1S1TA 2Z1HA 3AVBA 5FRMA 1WSEA 4FZYA 3BGRA 4W5RA 4E7JA 3QEIA 1L3SA 4AHTA 3NF6A 4CJLA 5T7BA 2G8FA 1WLJA 1JLCA 1Y97A 3VQ6A 4CECA 3NH2A 4FJ5A 1T05A 1NJZA 5KI6A 5CY4A 4LSNA 3OYKA 3QESA 4ZTJA 3SUOA 3ZCMA 4CJ4A 1O1WA 1SUQA 1NJWA 4NCAA 4DQQA 1RTJA 1RT6A 1A5WA 1BCMA 1J54A 4O0IA 3AVMA 1GOBA 4FK0A 1Z25A 2A1RA 3RR8A 3WNGA 4JRPA 4DF8A 3RTVA 4FJ7A 2DY4A 3RMCA 1TK0A 1A5XA 2Y1IA 4CJPA 4JS5A 4BE0A 4CERA 4DS4A 3SQ0A 5CYQA 1VSEA 3ITHA 3VQ8A 3TAPA 4CJTA 2VG7A 5CZ1A 2IGIA 3OS2A 5KGWA 4K8XA 4F2RA 2PZSA 4IFVA 1XC9A 4OGEA 1IKXA 4HUFA 3T3FA 4FLXA 3O3FA 2ZE2A 2HMIA 3KLFA 1TV6A 3V1QA 4DF4A 4CEDA 4BWJA 1HQUA 4RW4A 1KFSA 1C0UA 4CGFA 1VK0A 2FC0A 3RR7A 4RW7A 1BI4A 3M8PA 2HNYA 1IKWA 4DTUA 1S1UA 4QOZB 1RBTA 4DU4A 4B9TA 3O4QA 3LPTA 1BIZA 4FK4A 3JYTA 1I39A 3OS0A 3IG1A 5SZTA 4R5PA 3K58A 3K59A 4KAZA 2OPQA 3CYMA 4B08A 4E7LA 2OZSA 1SV5A 3VQEA 3L8BA 3PX4A 4BDPA 5HROA 1WAFA 1JLQA 3LANA 2D0AA 4CF9A 4E1MA 4N5SA 1TAQA 4KTZA 4Z4HA 3L2QA 4M3RA 3OYBA 3KJVA 2HHTA 4KHNA 2OPSA 4CHNA 1JKHA 1RTHA 3KK1A 4OPJA 1R0AA 5HRPA 4FM2A 3PO5A 4O4GA 3C6TA 3PY8A 1KRPA 1BL3A 2XY8A 3DRPA 1U49A 3O4NA 1ZBFA 2BANA 3WNFA 2HHXA 2YHBA 1WAJA 2G8WA 3U6FA 1KTQA 4QAGA 2YV0X 4CEBA 1D5AA 4H4MA 1UOCA 4OKKA 1T03A 4KI4A 1CLQA 3TAGA 4NCGA 3KKSA 3TAMA 2WONA 3LPUA 3ZSRA 3HL8A 4ID1A 4CGDA 1N5YA 3WNHA 5J2NA 3PO4A 2Z1IA 2P1JA 3C95A 4AH9A 1RT4A 3CM5A 2HHUA 1S6PA 3QIOA 2GUIA 1U04A 2VWJA 2LSNA 3AO2A 3TARA 1HRHA 1S6QA 3ZT3A 4CJKA 3KLHA 4FJHA 4ID5A 1LW0A 4CF2A 1YT3A 3SZ2A 1B9DA 4FJ8A 3TAQA 1T8EA 2KW4A 2FBTA 1WSHA 4AHCA 3SPYA 1CXQA 2OA8A 2QXFA 4MFBA 1CZBA 4IFYA 4O44A 3ZSWA 4FLVA 4E7HA 4OVLA 3I8DA 3SCXA 3SNNA 4FLUA 2HVHA 3AO5A 1N6QA 3BDPA 3A2FA 4CFAA 4AHSA 3NDKA 4OKJA 2NUBA 3NH1A 5HRSA 1NK0A 3KIOA 1J5OA 2BDPA 1FKPA 5KRSA 1RDAA 4KO0A 5I3UA 2HHWA 3LP3A 1U45A 4JRQA 1J53A 1T7PA 2QKBA 2HVIA 4KB0A 3CM6A 4J2AA 1WNSA 3HSTB 3CQ8A 2P51A 3KLIA 1QQCA 3NE6A 2OZMA 1CZ9A 5HRNA 1Q8IA 1HJRA 4KTWA 3TAEA 4J2EA 2WOMA 3EYZA 3P5JA 3K5LA 1LV5A 2I5JA 3F9KA 4DTPA 1NK9A 4B9LA 5KRTA 4I9QA 1VSLA 3M8SA 5DK5A 1IO2A 4N47A 3QNOA 4C8OA 4WE1A 1J9AA 1XI1A 2DTUA 1B92A 1TKZA 1GOAA 3L2UA 3U3YA 2XY6A 3OY9A 4M3XA 2HW3A 3HVRA 4KREA 3K5OA 1L3VA 4CGIA 3K57A 1W0HA 1BHLA 3ZSZA 3C6UA 3QIPA 3VQ4A 4DQPA 3VQPA 4DSLA 4E3SA 4FJLA 4BACA 2G8IA 1TKDA 5J2PA 2YNFA 3B6OA 3NGZA 3V81A 2ZD1A 3I0SA 4FW1A 4FJIA 1LAWA 4CHQA 3HP6A 4Z4IA 4OLBA 3AVHA 4H8KA 3HPHA 1KVBA 3VQ5A 1NKEA 3MEGA 3NGIA 1FXXA 4CJ5A 1KCFA 3TI0A 4FJKA 3OYDA 2KTQA 2GBZA 2OYQA 4JLHA 1TGOA 1U4BA 4DG1A 4UQGA 5FRNA 3ZT4A 2E4LA 4OKEA 4FM1A 1NJXA 2QKKA 1NK7A 3AA5X 3ZT1A 4DSIA 3U3GA 4Z4EA 3TABA 3QINA 4B8AB 4Q5VA 3SUQA 4GVMA 3O3GA 3AVLA 4RW6A 3V9WA 3S3MA 1QS4A 1JL2A 1D8YA 4K8ZA 1JLGA 3I0RA 5E41A 3ZSQA 3L2WA 4RG8A 4KV8A 1SKRA 1L5UA 2G8VA 4Z0UA 2HB5A 3G0ZA 4FJMA 3SQ2A 1YVUA 3AV9A 4DTNA 3CFPA 3HT3A 4DFJA 1S1WA 1WSIA 1RDBA 4J2DA 4GMJB 4L8RB 1S9EA 4I9LA 4H4OA 2ETJA 4FW2A 4CE9A 1SL1A 3VQAA 3SYZA 4DQIA 2F96A 1IH7A 1WSFA 4B9SA 1RT7A 4EZ9A 4FLYA 4W5OA 4CEFA 1LAVA 4DTJA 3OYHA 1TVRA 3KKRA 1Q9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HVJ A;  5HRR A;  3NF7 A;  3E01 A;  4ZTF A;  4FJX A;  3KD1 E;  3WNE A;  2A1S A;  5FDL A;  2KQ2 A;  3HYF A;  2G8H A;  1REV A;  5EU7 A;  1ZBU A;  3AVG A;  3ZT2 A;  4ELU A;  4KHQ A;  1UAX A;  4CCH A;  4E0D A;  3AVJ A;  3AVC A;  3V1R A;  3V4I A;  3QO9 A;  4CFB A;  4F3O A;  1JXE A;  1X1P A;  2F8S A;  4Q0B A;  1A5V A;  4CJU A;  3S3O A;  2ITG A;  1RT2 A;  3ZT0 A;  1BQN A;  1S9G A;  3VQ7 A;  4RW8 A;  1RBU A;  4CFC A;  1CXU A;  5JS2 A;  3SUP A;  4FJG A;  3K5M A;  4PY5 A;  5CYM A;  2D0C A;  3JSM A;  4HHT A;  2X78 A;  3M8Q A;  4Y1C A;  4AIL C;  1RBR A;  3VA3 A;  3OVN A;  5DMR A;  1RCH A;  1WN7 A;  2OPP A;  4TSX A;  3MEE A;  4CF1 A;  1KVC A;  1JLB A;  4ICL A;  3OS1 A;  1EKE A;  3HO1 A;  1NKB A;  1ZBL A;  1UWB A;  1Z26 A;  4KRF A;  3VA0 A;  1NK8 A;  4BWM A;  3OYM A;  3T19 A;  3F73 A;  5C24 A;  3DLK A;  4FK2 A;  3ZSV A;  3CFR A;  5FRO A;  3VN5 A;  1RDC A;  1RTI A;  4CEO A;  3NFA A;  2XO7 A;  2EX3 A;  3NH0 A;  3UIQ A;  2GV9 A;  1TL3 A;  4OLA A;  3V9U A;  4CF0 A;  3DI6 A;  2RN2 A;  4KTQ A;  4KPY A;  3HJF A;  4KHU A;  4O5B A;  3V6D A;  4HCC A;  4E1N A;  2F8T A;  2B4J A;  2IOC A;  3OYG A;  3PUF A;  3L2R A;  2EHG A;  1B9F A;  4O55 A;  4CJS A;  4M41 A;  2RPI A;  1QSY A;  2IAJ A;  2XHB A;  3LP2 A;  5HP1 A;  2PYL A;  1KSP A;  4CIE A;  1RDD A;  1Q9X A;  3NGY A;  3ZSO A;  4KI6 A;  4YNQ A;  4QCL A;  2BGG A;  1BIS A;  5KTQ A;  1BCO A;  4DU3 A;  2YNH A;  3G10 A;  1GOC A;  1I3A A;  2DFE A;  4I2P A;  4OPK A;  5J1E A;  3DOL A;  4DQR A;  3OYF A;  4IG3 A;  3NAE A;  1KFD A;  4FJJ A;  3VQQ A;  3QEX A;  1JXB A;  1NK5 A;  4N41 A;  4W5T A;  4FM0 A;  3KLE A;  3ALY A;  3HPO A;  1QTM A;  4FLZ A;  1BIU A;  4CES A;  4IDK A;  1X9M A;  2Z1G A;  1XWL A;  2D0B A;  3LWL A;  4XIU A;  3VQC A;  4DTX A;  4CEZ A;  1TK5 A;  3KD5 E;  2YKM A;  3MEC A;  4Y1D A;  5K14 A;  4B9U A;  4FJN A;  2HHQ A;  4KHW A;  5C25 A;  3THV A;  4Z4F A;  1TAU A;  4DFK A;  1EXQ A;  4AHU A;  3SJJ A;  2G8U A;  1XHZ A;  1RT5 A;  4B9V A;  2Z1J A;  4RW9 A;  2PY5 A;  1NJY A;  3HXM A;  2HHS A;  4DLG A;  3D0P A;  4FLT A;  1SKS A;  3SPZ A;  3MXI A;  5KGX A;  4PWD A;  3AVI A;  3O3H A;  4G1Q A;  4C8K A;  1DTT A;  3KLG A;  3ULD A;  3QEP A;  1D9D A;  3LP1 A;  4M42 A;  1S1V A;  2AJQ A;  1WSG A;  3OYI A;  3LZI A;  3CG7 A;  4LH4 A;  3IRX A;  3TR8 A;  1RT1 A;  1BQM A;  4C8N A;  3FFI A;  3LWM A;  3AVF A;  2VWK A;  4LSL A;  4NCB A;  1S1X A;  1HNV A;  4F2S A;  4I7F A;  3QLH A;  3L3U A;  4NYF A;  3PX0 A;  2BE2 A;  1QSL A;  4HTU A;  1XHX A;  2HNZ A;  4E7K A;  2IC3 A;  4F4K A;  3AO4 A;  2FBY A;  1ZBH A;  1F21 A;  3EZ5 A;  3OYJ A;  4I2Q A;  4CHP A;  1TKX A;  1VSH A;  3VQ9 A;  4Z4G A;  2QK9 A;  4FXD A;  2IS3 A;  3OJS A;  1RBS A;  1YTA A;  3OYC A;  2KFN A;  3DLG A;  3NF8 A;  1FK9 A;  4CF8 A;  3TWH A;  3T1A A;  4CJW A;  4DLE A;  5J2M A;  1TKT A;  3RMA A;  4ELT A;  1C0M A;  1UA0 A;  2PYJ A;  2OPR A;  2XRI A;  3V9S A;  3QEV A;  4FZX C;  1L3U A;  3D45 A;  1YTU A;  4IKF A;  3DLH A;  3TAN A;  4CJV A;  1HYZ A;  4B9M A;  3LAK A;  4CHY A;  1LWC A;  4HUG A;  2XY7 A;  4KB1 A;  3KTQ A;  2O4G A;  2YHA A;  3AA4 A;  1SKW A;  4EP4 A;  5JS1 A;  3SI6 A;  3V9X A;  1QHT A;  3SQ1 A;  5J2Q A;  3NBP A;  1JLA A;  2X6N A;  1NKC A;  3DLR A;  4CEA A;  3NF9 A;  1LWF A;  2RF2 A;  3LAL A;  3OYA A;  3QER A;  1C1C A;  4F8R A;  4M3Z A;  1DLO A;  1IKY A;  2RKI A;  3VQB A;  4W5N A;  4LH5 A;  4DTM A;  4KKO A;  4GW6 A;  4PA1 A;  3KK2 A;  1JLF A;  4M3W A;  1EP4 A;  4EP5 A;  3S3N A;  1SL0 A;  3HP9 A;  3AA2 A;  3DLE A;  4DTO A;  1U48 A;  3VQD A;  3DYA A;  1VSK A;  4DSF A;  1ZYQ A;  1S5J A;  4YFU A;  1QSS A;  1JLE A;  4CK1 A;  1IKV A;  3IS9 A;  4HUE A;  4KFB A;  3LP0 A;  4N56 A;  4FYD A;  1EX4 A;  2XY5 A;  2FBV A;  4M45 A;  4CJQ A;  1NK4 A;  3QET A;  2IDO A;  3DOK A;  1ASW A;  3K5N A;  4BE1 A;  4E89 A;  4FCY A;  4B3O A;  3LAM A;  2VG6 A;  2X6S A;  3DRR A;  3ZSX A;  1QE1 A;  4CFD A;  4DTS A;  1UA1 A;  2JLE A;  4CGJ A;  3DLB A;  4Z4C A;  2W42 A;  2B5J A;  3H08 A;  3OYN A;  4N76 A;  1KVA A;  1IG9 A;  3QEW A;  1EET A;  3ASM A;  3B6P A;  4CGH A;  3DM2 A;  3EY1 A;  4DQS A;  4AHR A;  4W5Q A;  1HMV A;  4CJR A;  3RRH A;  1VSF A;  3CFO A;  1G15 A;  1RNH A;  3SQ4 A;  1MU2 A;  1RBV A;  4DU1 A;  4PQU A;  4EZ6 A;  3RMD A;  1VSJ A;  3HVT A;  1RTD A;  2KZZ A;  4B8C A;  1KLM A;  3MED A;  5HLF A;  1WSJ A;  2ATQ A;  4KHS A;  4CJ3 A;  4M3Y A;  4NYN A;  4CEE A;  3HPG A;  4IG0 A;  4CIG A;  1RIL A;  3PX6 A;  4ZHR A;  4FZZ A;  4DSJ A;  1L3T A;  3V9Z A;  2DFF A;  2D5R A;  3QNN A;  4DWI A;  4DTR A;  4CHZ A;  4B9N A;  4E19 A;  3SV4 A;  1VRT A;  4CJE A;  2YNI A;  1DTQ A;  3RMB A;  2ZQB A;  1C1A A;  4BDZ A;  4IBN A;  3KK3 A;  1HYS A;  2E6L A;  4E7I A;  3AO3 A;  2Q3S A;  3RWU A;  1HNI A;  3OYL A;  4JS4 A;  4BDY A;  2P5O A;  4M3U A;  3V1O A;  3MXJ A;  3M8R A;  4CK3 A;  5D3G A;  3HM9 A;  2R7Y A;  4F3T A;  2O4I A;  2JGU A;  1VRU A;  1VSM A;  2X74 A;  3ZSY A;  4DMN A;  3P1G A;  4DS5 A;  2FBX A;  4CIF A;  4DFM A;  3PV8 A;  4OJR A;  1TK8 A;  1KLN A;  2G8K A;  3P83 D;  1BGX T;  1ZBI A;  3DRS A;  1ASV A;  3MXM A;  4BE2 A;  1NOZ A;  5HBM A;  4LD0 A;  4DFP A;  1RT3 A;  3L2V A;  4FLW A;  3IAY A;  1SL2 A;  1ASU A;  3OYE A;  3AA3 A;  4PUO A;  4MQ3 A;  1C0T A;  4CGG A;  4CHO A;  4J2B A;  2KFZ A;  3AO1 A;  5CZ2 A;  1NOY A;  2B6A A;  1FKO A;  5I42 A;  1C1B A;  3AVN A;  4AHV A;  2YKN A;  4LY7 A;  1LW2 A;  3OJU A;  4CJF A;  1VSD A;  4DSE A;  2HHV A;  1HYV A;  4KHY A;  3MAQ A;  1C6V A;  4FJ9 A;  3LDS A;  1TL1 A;  2HND A;  1U47 A;  2YNG A;  2P5G A;  3C94 A;  2Y1J A;  3AVK A;  3TAF A;  4FVM A;  1JL1 A;  3NCI A;  1X9S A;  1X9W A;  3AVA A;  1BI4 B;  1ITG A;  3ISN C;  3SUN A;  1HQE A;  3L3V A;  1D9F A;  2KZM A;  3SV3 A;  3DMJ A;  4C8M A;  3LZJ A;  3RRG A;  5SWM A;  4O0J A;  2VG5 A;  3HK2 A;  1VSI A;  3K2P A;  2DFH A;  1K6Y A;  4DSK A;  4HCB A;  4CK2 A;  1W9H A;  4M3T A;  1HPZ A;  4OGC A;  4CEQ A;  4ELV A;  5C42 A;  1NK6 A;  1LWE A;  2E6M A;  3NHG A;  3S9H A;  4C8L A;  1S1T A;  2Z1H A;  3AVB A;  5FRM A;  1WSE A;  4FZY A;  3BGR A;  4W5R A;  4E7J A;  3QEI A;  1L3S A;  4AHT A;  3NF6 A;  4CJL A;  5T7B A;  2G8F A;  1WLJ A;  1JLC A;  1Y97 A;  3VQ6 A;  4CEC A;  3NH2 A;  4FJ5 A;  1T05 A;  1NJZ A;  5KI6 A;  5CY4 A;  4LSN A;  3OYK A;  3QES A;  4ZTJ A;  3SUO A;  3ZCM A;  4CJ4 A;  1O1W A;  1SUQ A;  1NJW A;  4NCA A;  4DQQ A;  1RTJ A;  1RT6 A;  1A5W A;  1BCM A;  1J54 A;  4O0I A;  3AVM A;  1GOB A;  4FK0 A;  1Z25 A;  2A1R A;  3RR8 A;  3WNG A;  4JRP A;  4DF8 A;  3RTV A;  4FJ7 A;  2DY4 A;  3RMC A;  1TK0 A;  1A5X A;  2Y1I A;  4CJP A;  4JS5 A;  4BE0 A;  4CER A;  4DS4 A;  3SQ0 A;  5CYQ A;  1VSE A;  3ITH A;  3VQ8 A;  3TAP A;  4CJT A;  2VG7 A;  5CZ1 A;  2IGI A;  3OS2 A;  5KGW A;  4K8X A;  4F2R A;  2PZS A;  4IFV A;  1XC9 A;  4OGE A;  1IKX A;  4HUF A;  3T3F A;  4FLX A;  3O3F A;  2ZE2 A;  2HMI A;  3KLF A;  1TV6 A;  3V1Q A;  4DF4 A;  4CED A;  4BWJ A;  1HQU A;  4RW4 A;  1KFS A;  1C0U A;  4CGF A;  1VK0 A;  2FC0 A;  3RR7 A;  4RW7 A;  1BI4 A;  3M8P A;  2HNY A;  1IKW A;  4DTU A;  1S1U A;  4QOZ B;  1RBT A;  4DU4 A;  4B9T A;  3O4Q A;  3LPT A;  1BIZ A;  4FK4 A;  3JYT A;  1I39 A;  3OS0 A;  3IG1 A;  5SZT A;  4R5P A;  3K58 A;  3K59 A;  4KAZ A;  2OPQ A;  3CYM A;  4B08 A;  4E7L A;  2OZS A;  1SV5 A;  3VQE A;  3L8B A;  3PX4 A;  4BDP A;  5HRO A;  1WAF A;  1JLQ A;  3LAN A;  2D0A A;  4CF9 A;  4E1M A;  4N5S A;  1TAQ A;  4KTZ A;  4Z4H A;  3L2Q A;  4M3R A;  3OYB A;  3KJV A;  2HHT A;  4KHN A;  2OPS A;  4CHN A;  1JKH A;  1RTH A;  3KK1 A;  4OPJ A;  1R0A A;  5HRP A;  4FM2 A;  3PO5 A;  4O4G A;  3C6T A;  3PY8 A;  1KRP A;  1BL3 A;  2XY8 A;  3DRP A;  1U49 A;  3O4N A;  1ZBF A;  2BAN A;  3WNF A;  2HHX A;  2YHB A;  1WAJ A;  2G8W A;  3U6F A;  1KTQ A;  4QAG A;  2YV0 X;  4CEB A;  1D5A A;  4H4M A;  1UOC A;  4OKK A;  1T03 A;  4KI4 A;  1CLQ A;  3TAG A;  4NCG A;  3KKS A;  3TAM A;  2WON A;  3LPU A;  3ZSR A;  3HL8 A;  4ID1 A;  4CGD A;  1N5Y A;  3WNH A;  5J2N A;  3PO4 A;  2Z1I A;  2P1J A;  3C95 A;  4AH9 A;  1RT4 A;  3CM5 A;  2HHU A;  1S6P A;  3QIO A;  2GUI A;  1U04 A;  2VWJ A;  2LSN A;  3AO2 A;  3TAR A;  1HRH A;  1S6Q A;  3ZT3 A;  4CJK A;  3KLH A;  4FJH A;  4ID5 A;  1LW0 A;  4CF2 A;  1YT3 A;  3SZ2 A;  1B9D A;  4FJ8 A;  3TAQ A;  1T8E A;  2KW4 A;  2FBT A;  1WSH A;  4AHC A;  3SPY A;  1CXQ A;  2OA8 A;  2QXF A;  4MFB A;  1CZB A;  4IFY A;  4O44 A;  3ZSW A;  4FLV A;  4E7H A;  4OVL A;  3I8D A;  3SCX A;  3SNN A;  4FLU A;  2HVH A;  3AO5 A;  1N6Q A;  3BDP A;  3A2F A;  4CFA A;  4AHS A;  3NDK A;  4OKJ A;  2NUB A;  3NH1 A;  5HRS A;  1NK0 A;  3KIO A;  1J5O A;  2BDP A;  1FKP A;  5KRS A;  1RDA A;  4KO0 A;  5I3U A;  2HHW A;  3LP3 A;  1U45 A;  4JRQ A;  1J53 A;  1T7P A;  2QKB A;  2HVI A;  4KB0 A;  3CM6 A;  4J2A A;  1WNS A;  3HST B;  3CQ8 A;  2P51 A;  3KLI A;  1QQC A;  3NE6 A;  2OZM A;  1CZ9 A;  5HRN A;  1Q8I A;  1HJR A;  4KTW A;  3TAE A;  4J2E A;  2WOM A;  3EYZ A;  3P5J A;  3K5L A;  1LV5 A;  2I5J A;  3F9K A;  4DTP A;  1NK9 A;  4B9L A;  5KRT A;  4I9Q A;  1VSL A;  3M8S A;  5DK5 A;  1IO2 A;  4N47 A;  3QNO A;  4C8O A;  4WE1 A;  1J9A A;  1XI1 A;  2DTU A;  1B92 A;  1TKZ A;  1GOA A;  3L2U A;  3U3Y A;  2XY6 A;  3OY9 A;  4M3X A;  2HW3 A;  3HVR A;  4KRE A;  3K5O A;  1L3V A;  4CGI A;  3K57 A;  1W0H A;  1BHL A;  3ZSZ A;  3C6U A;  3QIP A;  3VQ4 A;  4DQP A;  3VQP A;  4DSL A;  4E3S A;  4FJL A;  4BAC A;  2G8I A;  1TKD A;  5J2P A;  2YNF A;  3B6O A;  3NGZ A;  3V81 A;  2ZD1 A;  3I0S A;  4FW1 A;  4FJI A;  1LAW A;  4CHQ A;  3HP6 A;  4Z4I A;  4OLB A;  3AVH A;  4H8K A;  3HPH A;  1KVB A;  3VQ5 A;  1NKE A;  3MEG A;  3NGI A;  1FXX A;  4CJ5 A;  1KCF A;  3TI0 A;  4FJK A;  3OYD A;  2KTQ A;  2GBZ A;  2OYQ A;  4JLH A;  1TGO A;  1U4B A;  4DG1 A;  4UQG A;  5FRN A;  3ZT4 A;  2E4L A;  4OKE A;  4FM1 A;  1NJX A;  2QKK A;  1NK7 A;  3AA5 X;  3ZT1 A;  4DSI A;  3U3G A;  4Z4E A;  3TAB A;  3QIN A;  4B8A B;  4Q5V A;  3SUQ A;  4GVM A;  3O3G A;  3AVL A;  4RW6 A;  3V9W A;  3S3M A;  1QS4 A;  1JL2 A;  1D8Y A;  4K8Z A;  1JLG A;  3I0R A;  5E41 A;  3ZSQ A;  3L2W A;  4RG8 A;  4KV8 A;  1SKR A;  1L5U A;  2G8V A;  4Z0U A;  2HB5 A;  3G0Z A;  4FJM A;  3SQ2 A;  1YVU A;  3AV9 A;  4DTN A;  3CFP A;  3HT3 A;  4DFJ A;  1S1W A;  1WSI A;  1RDB A;  4J2D A;  4GMJ B;  4L8R B;  1S9E A;  4I9L A;  4H4O A;  2ETJ A;  4FW2 A;  4CE9 A;  1SL1 A;  3VQA A;  3SYZ A;  4DQI A;  2F96 A;  1IH7 A;  1WSF A;  4B9S A;  1RT7 A;  4EZ9 A;  4FLY A;  4W5O A;  4CEF A;  1LAV A;  4DTJ A;  3OYH A;  1TVR A;  3KKR A;  1Q9Y A; 
#chains in the Genus database with same CATH topology
 2NZT A;  5HRR A;  4ZTF A;  3E01 A;  3WNE A;  2KQ2 A;  3HYF A;  5EU7 A;  3ZT2 A;  4KH6 A;  4CCH A;  4WF9 L;  4E0D A;  3AVJ A;  3AVC A;  1X1P A;  3CPE A;  4CZJ A;  1KAY A;  1RT2 A;  3ZT0 A;  4CFC A;  3SUP A;  1Q18 A;  4PY5 A;  2D0C A;  4AIL C;  1RBR A;  3OVN A;  2EWS A;  4TSX A;  3MEE A;  3OS1 A;  1JLB A;  1EKE A;  2ZJQ L;  4WFA L;  1WUA A;  3QB0 A;  1Z26 A;  3VA0 A;  3CCQ N;  3OYM A;  3CJA A;  5C24 A;  3DLK A;  4DV3 K;  3ZSV A;  2HST A;  1Q82 O;  1RTI A;  4CEO A;  2AA4 A;  2GV9 A;  4EAH D;  4KPY A;  3HJF A;  4G9Z A;  4KHU A;  3GE1 A;  3MX2 A;  2YHY A;  4M41 A;  3O9T A;  1XMQ K;  5HP1 A;  2PYL A;  1Q9X A;  4ISG A;  2QM1 A;  4DUY K;  1VQ9 N;  1BCO A;  2NRR A;  2DFE A;  4OPK A;  1BUP A;  1WB9 A;  3OYF A;  3NAE A;  4DR4 K;  3QEX A;  1JXB A;  1R59 O;  4N41 A;  4FM0 A;  1BIU A;  4IFE A;  2P9L B;  3THX A;  1X9M A;  2Z1G A;  1TK5 A;  4XIU A;  5AQW A;  4CEZ A;  2YKM A;  4B9U A;  5C25 A;  4DFK A;  4AHU A;  2G8U A;  3FZH A;  3D7E O;  4B1X B;  4A57 A;  4RW9 A;  3J7Z O;  2CGK A;  3RSE B;  3P31 A;  4CZG A;  4PWD A;  1DTT A;  3KLG A;  2AJQ A;  1GLC G;  3H45 C;  1S1V A;  3LZI A;  2FSN A;  1ATN A;  4LH4 A;  2NNW A;  1MDU B;  1BQM A;  1Y64 A;  2HOE A;  2VWK A;  4F2S A;  3PX0 A;  3QLH A;  3L3U A;  4JD2 A;  4HTU A;  1WOQ A;  1XQS C;  5AZI A;  4BRE A;  1F21 A;  4Z4G A;  2QK9 A;  3OJS A;  3HM8 A;  4YOY A;  2KFN A;  4DLE A;  1FK9 A;  4JKG A;  1UA0 A;  2PYJ A;  2VWB A;  3ULE A;  4FZX C;  1L3U A;  4IKF A;  3TAN A;  4CJV A;  4JI5 K;  4CHY A;  2YHA A;  4EP4 A;  1QHT A;  1JLA A;  1LWF A;  2RF2 A;  1DLO A;  1YUW A;  2OCE A;  3VQB A;  4M3W A;  4RWT A;  3P4I A;  3S3N A;  4EP5 A;  3AA2 A;  1KAX A;  4BQL A;  3VQD A;  1T3V A;  1NU0 A;  3IS9 A;  3LP0 A;  1GLL O;  4BRQ A;  5E26 A;  2FXU A;  4M45 A;  3VEW A;  4CJQ A;  2CGL A;  5IWA K;  3QET A;  1NGD A;  1ASW A;  3N4P A;  5EX5 A;  3K5N A;  4FCY A;  1HNZ K;  3FE1 A;  2QWO A;  3GOI A;  2VG6 A;  5JIC A;  1QE1 A;  4CFD A;  3CER A;  1UA1 A;  4CGJ A;  3VGK A;  4FWP A;  4N76 A;  1ATR A;  3OYN A;  1IG9 A;  3A0I X;  4GV9 A;  1EET A;  4DQS A;  3B6P A;  3DM2 A;  3F5T A;  1GLE G;  1H1V A;  1HNW K;  3VTI A;  4DU1 A;  4PQU A;  4EZ6 A;  1VSJ A;  3QIC A;  2KZZ A;  4GKJ K;  4Y0W A;  3MED A;  4IDH A;  4KHS A;  4CJ3 A;  1OVQ A;  4IOC L;  3HPG A;  4CIG A;  4ZHR A;  4FZZ A;  1V4S A;  1L3T A;  3E9P A;  4DWI A;  2D5R A;  4DTR A;  4E19 A;  4DR5 K;  1VRT A;  3RMB A;  2YNI A;  4BDZ A;  3KK3 A;  4JS4 A;  4BDY A;  2E2Q A;  2ZWH A;  3V1O A;  4DV6 K;  4DV7 K;  4CK3 A;  5D3G A;  4F3T A;  1TYQ A;  2CH6 A;  2X74 A;  3P1G A;  4DS5 A;  4K42 A;  3J80 O;  1U2V B;  3P83 D;  3LDN A;  3O9R A;  3MXM A;  3AGK A;  4PUO A;  2KFZ A;  4CHO A;  1NOY A;  3DAW A;  5I42 A;  1C1B A;  3AVN A;  2YKN A;  1W7A A;  3OJU A;  4DSE A;  2A5X A;  3R8E A;  1C6V A;  2J4R A;  4LF8 K;  5F0X A;  2P5G A;  5LJV A;  3C94 A;  5CHI A;  2Y1J A;  3TAF A;  3NCI A;  5GAE P;  3AVA A;  1BI4 B;  5AZJ B;  2F7T A;  3DJC A;  3UKU A;  3L4Q A;  3PIO L;  1K6Y A;  4DSK A;  4M3T A;  4OGC A;  4CEQ A;  4ELV A;  4NLB A;  1LWE A;  2E6M A;  3BEX A;  4FWR A;  4KH4 A;  1HKC A;  1JLC A;  3VQ6 A;  4CEC A;  4BRG A;  1QZ5 A;  4ZTJ A;  3SUO A;  5BRH A;  3U8X A;  1NJW A;  4DR7 K;  3CCV N;  2ITM A;  2A1R A;  3WNG A;  5AQR A;  4JRP A;  3RTV A;  4DF8 A;  4FJ7 A;  3WEE B;  4FWM A;  4WQ5 C;  4DS4 A;  5CYQ A;  5MLC Q;  3ITH A;  4CZH A;  2IGI A;  2P9N B;  2PBD A;  5ELZ A;  5CE3 A;  4GKK K;  5M1P A;  1XC9 A;  1IKX A;  4R79 A;  2NRZ A;  3S41 A;  3KLF A;  1TV6 A;  4HCB A;  3CHW A;  4CGF A;  3BF3 A;  1QVG M;  4RW7 A;  1IKW A;  4JEP A;  2E1Y A;  2HBM A;  3K58 A;  4LFB K;  3K59 A;  3MCP A;  2OPQ A;  4B08 A;  4BRH A;  3L8B A;  3ID6 A;  3PX4 A;  5HRO A;  1JLQ A;  4FSV A;  4KTZ A;  4M3R A;  3KJV A;  2HHT A;  4ILJ A;  4H0Y B;  1JKH A;  4BRC A;  1VQ4 N;  5HRP A;  2YCH A;  4FM2 A;  5C12 A;  1KRP A;  1XNQ K;  2E2N A;  5AFU A;  2XY8 A;  4JK9 A;  4JI8 K;  1ZBF A;  2BAN A;  2HHX A;  3U6F A;  4CEB A;  2GEM A;  2YV0 X;  5ADX A;  3GDQ A;  2V7Y A;  5E84 A;  1Q7Y O;  4OKK A;  3THW A;  1IBK K;  3IMX A;  4YDU C;  1HKG A;  3HL8 A;  4ID1 A;  1JCG A;  3PO4 A;  5J2N A;  2O8D B;  4U67 L;  2A6A A;  3CM5 A;  2HHU A;  1S6P A;  2QTD A;  1U04 A;  1U6Z A;  4GVE A;  3EN9 A;  3THY B;  3OW2 M;  2UUB K;  4FJ8 A;  2Q0U A;  5KQD A;  2H3G X;  1CXQ A;  5AQX A;  2HMP A;  3FR0 A;  3CJ9 A;  3NVM A;  4PHT X;  4FLV A;  1YAG A;  4E7H A;  3I8D A;  3SNN A;  1M1K O;  4C1N I;  3AO5 A;  4MDA A;  4F9O A;  3HOS A;  3BDP A;  3UKR B;  3H46 O;  5EXW A;  4A62 A;  4OKJ A;  2NUB A;  5HRS A;  3KIO A;  4JV5 K;  2KHO A;  5KRS A;  2QWN A;  5I3U A;  3LP3 A;  2QKB A;  2NRW A;  2FF6 A;  3CM6 A;  2W6K A;  3PLA A;  1CZ9 A;  4JK7 A;  5HRN A;  1Q8I A;  4KTW A;  3BP8 A;  4LFC K;  3M8S A;  3AAP A;  4RTF D;  3IUC A;  1VQO N;  5BR9 A;  2DTU A;  4FOE A;  3L2U A;  1TKZ A;  2A40 A;  3QBW A;  1N34 K;  2HW3 A;  3HVR A;  4BRP A;  4CGI A;  3K57 A;  3ZSZ A;  3VQ4 A;  4JYA K;  5A2Q O;  2CH5 A;  3PSI A;  3EE9 A;  3B6O A;  2ZD1 A;  4CHQ A;  3HP6 A;  3AVH A;  4JKB A;  3L6Q A;  3SK3 A;  3TI0 A;  1ZBS A;  3VEZ A;  1YHQ N;  5HOO A;  4OKE A;  4FM1 A;  4DSI A;  4Z4E A;  3ZX0 A;  4Q5V A;  4GVM A;  3O3G A;  3V9W A;  4RW6 A;  3S3M A;  3QML A;  3I0R A;  1KD1 O;  1CZA N;  1SKR A;  1L5U A;  2HB5 A;  3G0Z A;  3TTC A;  4A2A A;  1TUY A;  1S1W A;  4J2D A;  3LL3 A;  1SL1 A;  1MWM A;  2F9T A;  1RT7 A;  4FLY A;  4GY2 B;  5FDL A;  1TVR A;  2W6L A;  4JNE A;  4FJX A;  3TU5 A;  3ZET A;  4O8K A;  1REV A;  3AVG A;  3KHY A;  2A42 A;  2NRH A;  3V1R A;  3V4I A;  4CFB A;  1JXE A;  1A5V A;  1BQN A;  4I6M A;  3VQ7 A;  1RBU A;  3VET A;  5JS2 A;  4OPH A;  4FJG A;  4X64 K;  5CYM A;  4CI6 A;  3JSM A;  4Y1C A;  3AAR A;  1YI2 N;  1RCH A;  4BVP A;  3CCU N;  1T44 A;  1UWB A;  1ZBL A;  4JAX A;  4DV0 K;  2YJE A;  2D4W A;  4BWM A;  1LCU A;  3F73 A;  1NGF A;  5FRO A;  1RDC A;  4QS9 A;  2ZJP L;  2EX3 A;  3NH0 A;  5AJ3 K;  3CQX A;  4OLA A;  1P8Z A;  4O5B A;  4HCC A;  1DT9 A;  4E1N A;  2F8T A;  3OYG A;  4QS8 A;  4O55 A;  3SJH A;  4IJN A;  4BC4 A;  4CIE A;  1JJ2 M;  3NGY A;  4KI6 A;  4YNQ A;  4QCL A;  2BGG A;  1BIS A;  4H5V A;  4DU3 A;  3G10 A;  4I2P A;  1I3A A;  4IG3 A;  1NK5 A;  4W5T A;  3KLE A;  2YX6 A;  2OAN A;  5AQS A;  3ULE B;  2QWR A;  2UUA K;  1RDU A;  2D0B A;  3LWL A;  4DTX A;  2FF3 B;  1VQ8 N;  4XH1 A;  4FJN A;  2HHQ A;  1EXQ A;  4AM6 A;  3F2K A;  3CJC A;  3H1V X;  3SJJ A;  4YOX A;  1XHZ A;  4PKG A;  2PY5 A;  1NJY A;  3VMF B;  4FLT A;  3MXI A;  3CI5 A;  5KGX A;  4G1Q A;  3P38 A;  1TUU A;  4MLH A;  3CG7 A;  2VCP A;  1NGJ A;  3FFI A;  3AVF A;  5BR8 K;  1S1X A;  4NYF A;  4CZI A;  3EZW A;  2O8B A;  1XHX A;  1HJO A;  3A5O C;  4E7K A;  2UXD K;  3AO4 A;  5C15 A;  1ZBH A;  2PFU A;  1RFQ A;  4I2Q A;  4CHP A;  3HBT A;  3WXL A;  4FXD A;  2QEX N;  3E9O A;  4CJW A;  1TKT A;  3CC2 N;  4B1V A;  2XRI A;  1YTU A;  4DR1 K;  1YIT N;  4DUZ K;  1HYZ A;  4BRF A;  4HUG A;  2HF3 A;  2DPN A;  5AQF A;  3CCJ N;  2O4G A;  2QW9 A;  3V9X A;  4IJA A;  5J2Q A;  3NBP A;  3UE5 A;  2X6N A;  3QER A;  3NF9 A;  4JKF A;  1IKY A;  3ATU A;  5M1K A;  3ENO A;  4KKO A;  4PA1 A;  5AQV A;  4MO5 A;  3HP9 A;  1E4F T;  1VSK A;  1N33 K;  1HUX A;  1JLE A;  1GLD G;  1IKV A;  3MN6 A;  4IO8 A;  1TYQ B;  4YOT A;  3SAG A;  4FYD A;  3ID8 A;  1XMO K;  2Q1N A;  4IO9 L;  1NK4 A;  3ZEU B;  2Q2R A;  4B3O A;  3D6R A;  1ESV A;  2X6S A;  3DRR A;  3ZSX A;  4BG9 A;  2JLE A;  3DLB A;  4Z4C A;  1KVA A;  4K25 A;  4NO7 A;  4NLC A;  4W5Q A;  1HMV A;  3RRH A;  1VSF A;  1G15 A;  1EO1 A;  1MU2 A;  5AQI A;  3RMD A;  3HVT A;  2AP1 A;  1RTD A;  2ATQ A;  4M3Y A;  1VQM N;  1RIL A;  1EQY A;  4DSJ A;  3V9Z A;  4CHZ A;  4IBN A;  1HYS A;  3HI0 A;  3AO3 A;  3FLC O;  1QQN A;  2Q3S A;  1HNI A;  5AQY A;  3WXJ A;  3OYL A;  3J81 O;  1BU6 O;  4DV4 K;  1YJW N;  1VRU A;  4BRA A;  3GBT A;  1YIJ N;  1MA9 B;  4CIF A;  3PV8 A;  4OJR A;  2G8K A;  2P9I B;  3ATV A;  1BG3 A;  1V4T A;  1BGX T;  5AQP A;  3DRS A;  4H0P A;  4DFP A;  4FLW A;  2V7Z A;  3IAY A;  1SL2 A;  1ASU A;  4LF6 K;  3EKU A;  4CGG A;  3M3Z A;  4IZ9 A;  2W40 A;  2B6A A;  3VF6 A;  4AHV A;  4LY7 A;  2YI1 A;  5AQQ A;  2HHV A;  4JHD A;  3LDS A;  2YNG A;  2ASO A;  4DV1 K;  2UUC K;  2YHX A;  1Z05 A;  1ZXO A;  4FVM A;  4WQ4 A;  1HQE A;  1IBM K;  3MK6 A;  3DMJ A;  3R1X A;  4O0J A;  5SWM A;  1WBD A;  2Q36 A;  3K2P A;  3KVG A;  4HTL A;  1W9H A;  4CK2 A;  1HPZ A;  3NHG A;  4OX9 K;  1WSE A;  1HX1 A;  3DXM A;  3H1Q A;  4E7J A;  3QEI A;  1NM1 A;  1L3S A;  1N36 K;  1DGK N;  1WLJ A;  3DXK B;  3QES A;  5LY3 A;  4CJ4 A;  1SUQ A;  4IOX A;  1A5W A;  2WBN A;  4O0I A;  4FK0 A;  1J6Z A;  4FWO A;  2DY4 A;  3RMC A;  2Y1I A;  4BE0 A;  3I33 A;  4NXM K;  3H6E A;  4CJT A;  2VG7 A;  5CZ1 A;  3WUH A;  4JKC A;  4F2R A;  1OKJ A;  3CXC M;  3MN9 A;  4HUF A;  4BR2 A;  3O3F A;  4A5A A;  4DF4 A;  4CED A;  4BWJ A;  3CCM N;  3RR7 A;  4I9Q A;  3EE8 A;  2FC0 A;  2O8E A;  3M8P A;  1Q81 O;  2HNY A;  1RBT A;  4A61 A;  4H5N A;  3E1Y A;  3JYT A;  1I39 A;  4KAZ A;  4KBO A;  5SZT A;  2ZF5 O;  3TTD A;  4NB4 A;  3CYM A;  1SV5 A;  3VQE A;  5C2F A;  1K73 O;  4BDP A;  1TAQ A;  3L2Q A;  4CHN A;  4GNI A;  1O13 A;  3H3N O;  4OPJ A;  1R0A A;  3WNF A;  1WAJ A;  3LM9 A;  3O08 A;  4H4M A;  3WT0 A;  3C7N B;  5LL6 Z;  3MCA B;  2IVP A;  3LPU A;  2FSK A;  1C0G A;  2P1J A;  4AH9 A;  4FOI A;  3G4S N;  2GUI A;  1IV0 A;  1HRH A;  1S6Q A;  4CJK A;  1LW0 A;  3FFK B;  3O80 A;  4CF2 A;  1QQM A;  2O8F B;  3KWI A;  1T8E A;  3D2F B;  2FBT A;  1BO5 O;  2OA8 A;  4MFB A;  1CZB A;  4O44 A;  2Q97 A;  1N6Q A;  1ZC6 A;  4CFA A;  4LF4 K;  4AHS A;  3VEO A;  1J5O A;  3FZK A;  2WTU A;  4RCH A;  1U45 A;  3CC4 N;  4FVU A;  4J2A A;  3CQ8 A;  2P51 A;  3O9S A;  3VGL A;  4E1J A;  2QWP A;  4O8U A;  3TAE A;  4B1U B;  3LM2 A;  3CJ1 A;  5KRT A;  1VSL A;  3KK7 A;  3QNO A;  2E1Z A;  2VGN A;  4WE1 A;  1J9A A;  3W3D A;  4M3X A;  1L3V A;  3SAF A;  3M5R A;  1W0H A;  1BHL A;  3QIP A;  4FJL A;  3R9P A;  3VQP A;  4BR7 A;  2HF4 A;  5GIO A;  5J2P A;  1S72 N;  2YNF A;  1KAZ A;  4BRN A;  4Z4I A;  4FW1 A;  1KVB A;  1NKE A;  3MEG A;  1NGH A;  4I6M B;  4FJK A;  4DR6 K;  1HR0 K;  4AF1 A;  2GBZ A;  4DB3 A;  1SAZ A;  1TGO A;  2D1K A;  1M90 O;  4DG1 A;  4UQG A;  2E4L A;  4BQZ A;  1NJX A;  1NK7 A;  3AA5 X;  4WCE L;  3U3G A;  1NGC A;  1QS4 A;  1D8Y A;  2ZM6 K;  1JLG A;  2P9L A;  1NBW A;  3D2E A;  5TKW A;  3SQ2 A;  3AV9 A;  4A5B A;  3CFP A;  2ASP A;  3HT3 A;  1RDB A;  4DHY A;  5BN9 A;  4I9L A;  3BZK A;  4K41 A;  4CE9 A;  4Z94 A;  3SYZ A;  4YOU A;  3K9K A;  1WSF A;  4B9S A;  5AQJ A;  1YF5 L;  4H0T B;  4IWV A;  2QA4 N;  4JKD A;  3LDO A;  3U9Z A;  4DCH A;  2D0O A;  4HVJ A;  3KD1 E;  2A1S A;  2G8H A;  4KHQ A;  1ZBU A;  4ELU A;  1UAX A;  2RHK A;  3U9D A;  4F3O A;  4Q0B A;  3S3O A;  2ITG A;  4QS7 A;  2A3Z A;  1S9G A;  1NNE A;  1CXU A;  3K5M A;  4HHT A;  2X78 A;  4XH4 A;  2HBJ A;  1W97 L;  5DMR A;  2OPP A;  2P9S B;  4CF1 A;  1KVC A;  4ICL A;  3L0Q A;  1NKB A;  1GLJ O;  3A5L C;  4KRF A;  1NK8 A;  4LFA K;  3T19 A;  3EO3 A;  5AQU A;  4FK2 A;  2UXC K;  1K8K B;  3NFA A;  3UIQ A;  1TL3 A;  3N4Q A;  3V9U A;  4CF0 A;  3DI6 A;  2RN2 A;  3O9Q A;  3VGM A;  1KQS M;  4JN4 A;  4B1Z A;  3I8B A;  1HNX K;  2EHG A;  2QXL A;  4CJS A;  1KC8 O;  2RPI A;  5AQL A;  2IAJ A;  3LP2 A;  1OVY A;  3M6G A;  1KSP A;  1T6C A;  3CCE N;  3VEN A;  5BN8 A;  2YNH A;  4JI0 K;  5J1E A;  3DOL A;  4FJJ A;  2ZGY A;  4FWN A;  3ALY A;  3P39 A;  1QTM A;  1T6D A;  3MEC A;  4Y1D A;  3MDQ A;  1TAU A;  4KH5 A;  4BC2 A;  2FSJ A;  4H0V B;  1NWK A;  4CZK A;  2Z1J A;  4B9V A;  3HXM A;  3CC7 N;  2HHS A;  5I9E B;  3OHR A;  4CZF A;  4CW7 B;  3VOV A;  4JI1 K;  2KKZ A;  3Q7C A;  2PAV A;  4C8K A;  3VF4 A;  3ULD A;  5FPM A;  3K9J A;  3IRX A;  4FWK A;  2P9U A;  5F1X A;  2I7P A;  3QFU A;  1HNV A;  1OH8 A;  4NXN K;  2P9K A;  3ZX3 A;  2HNZ A;  2E88 A;  2FBY A;  2E5L K;  4WFN L;  4V19 S;  3J7Y P;  2IS3 A;  1RBS A;  1YTA A;  3DLG A;  4C1N K;  3TWH A;  5J2M A;  3T1A A;  3RMA A;  4XEI A;  1VQL N;  5EOY A;  3LDL A;  1C0M A;  4ELT A;  2OPR A;  2VYP A;  2UYT A;  3D45 A;  3DLH A;  3MN7 A;  4B9M A;  1LWC A;  2VQE K;  1U2V A;  3E66 A;  4JI3 K;  3KTQ A;  3EKS A;  2YJF A;  3DLR A;  4CEA A;  4M3Z A;  3LAL A;  3HOT A;  4JK8 A;  4BGB A;  4LH5 A;  3SAH A;  3KK2 A;  5LMN K;  1N32 K;  1SL0 A;  1ATS A;  4U7B A;  1KXP A;  3QBX A;  4ILG B;  3DYA A;  4ISE A;  4PL7 A;  4DSF A;  1S5J A;  4YFU A;  2E20 A;  4L3Q A;  4HUE A;  3THX B;  4KFB A;  2XY5 A;  2IDO A;  3DOK A;  4K0K K;  1XUP O;  4DTS A;  4M7X A;  2ASM A;  4BGA A;  4YOV A;  3O4W A;  3ASM A;  3EY1 A;  4CGH A;  3MWT A;  1XNR K;  1VQK N;  4CJR A;  3GG4 A;  3CFO A;  3SQ4 A;  1RNH A;  1I94 K;  1SZ2 A;  3U4L A;  3HTV A;  4DQ8 A;  4GV3 A;  4JD2 B;  1YJN N;  4JKH A;  4NYN A;  4CEE A;  3DWL A;  4IG0 A;  1EWR A;  5TKY A;  5AZI B;  3C0B A;  3QNN A;  2DFF A;  4B9N A;  3SV4 A;  4LC9 B;  2ZQB A;  1NG9 A;  2E6L A;  4JKG B;  3LDQ A;  3RWU A;  2P5O A;  3M8R A;  1VSM A;  4DMN A;  1VQ5 N;  2GX9 A;  4B9Q A;  1BA1 A;  2F4V K;  1ZBI A;  5AQG A;  4BE2 A;  4LD0 A;  3OYE A;  4EHT A;  1C0T A;  4J2B A;  3AO1 A;  5CZ2 A;  3NVK A;  4H0O A;  5BRF A;  3BZC A;  4A2B A;  4X62 K;  1LW2 A;  1VSD A;  3JAM O;  4KHY A;  4FJ9 A;  1U47 A;  1HPM A;  3CD6 N;  1JL1 A;  1X9S A;  1X9W A;  1ITG A;  3ISN C;  3SUN A;  2KZM A;  2O8C A;  3SV3 A;  3O8M A;  4ILH A;  4C8M A;  1NGI A;  3LZJ A;  3HK2 A;  4HWI A;  2VQF K;  3RVC A;  4FPB A;  5C42 A;  3I55 N;  1NK6 A;  3TSQ A;  2NRT A;  3S9H A;  1S1T A;  2Z1H A;  3AVB A;  4FZY A;  1HKB A;  4AHT A;  3NF6 A;  5FLX O;  1Y97 A;  2GWK A;  2CGJ A;  5KI6 A;  5CY4 A;  4LSN A;  3OYK A;  3CJB A;  5AFU H;  3ZCM A;  4BC3 A;  4FPA A;  4DQQ A;  4O5F A;  1RTJ A;  5ADX H;  3B8A X;  3UKR A;  4XH5 A;  1BDG A;  1Z25 A;  4CBW A;  3RR8 A;  1TK0 A;  1RDW X;  1A5X A;  3SQ0 A;  3VQ8 A;  3TAP A;  5KGW A;  1E3M A;  4FWQ A;  5KPR A;  3O6W A;  3VER A;  2OTJ N;  4MDB A;  4IFV A;  5C10 A;  3OTO K;  3O9U A;  3WQU A;  4FLX A;  3VES A;  2ZE2 A;  4RW4 A;  1KFS A;  1C0U A;  2HBK A;  3PIP L;  1S1U A;  4QOZ B;  4B9T A;  3LPT A;  1BIZ A;  4FK4 A;  3IG1 A;  4R5P A;  4B3T K;  1WAF A;  3LAN A;  4CF9 A;  4CZL A;  2GEL A;  4K43 A;  2GTD A;  4KHN A;  1RTH A;  3QDK A;  4FWL A;  3VF2 A;  3PO5 A;  3C6T A;  3DRP A;  2YHB A;  1KTQ A;  2VGM A;  3QFP A;  4BRL A;  3GL1 A;  4KI4 A;  1T03 A;  3A5N C;  1JCE A;  4NCG A;  3KKS A;  3UKU B;  3TAM A;  2WON A;  3IFR A;  3WNH A;  3C95 A;  1RT4 A;  2VWJ A;  4J8F A;  3AO2 A;  3TAR A;  5AQN A;  3ZT3 A;  3CET A;  1BOT O;  4AQY K;  3G6E N;  1B9D A;  3WXM B;  3TAQ A;  1WSH A;  2HVH A;  1VQP N;  4OVL A;  4FLU A;  5CR4 A;  3A2F A;  3NH1 A;  1FKP A;  3TSU A;  1RDA A;  3ZLJ A;  1NJI O;  4JI6 K;  3HSC A;  1J53 A;  1T7P A;  3VPZ A;  3HST B;  4BRD A;  3WXK A;  3D2E B;  4J2E A;  4CZM A;  3P5J A;  5BPL A;  1LV5 A;  2I5J A;  4DTP A;  3CJ7 A;  4B9L A;  1NMN A;  4AM7 A;  2QWL A;  2NLX A;  1B92 A;  2XY6 A;  4GV6 A;  3OY9 A;  5LJW A;  3K5O A;  3O1B A;  1JCF A;  4CD1 A;  3UB5 A;  3C6U A;  1S22 A;  4DQP A;  4DSL A;  4E3S A;  4BAC A;  1TKD A;  4YHH K;  4WQ5 A;  3NGZ A;  5FPD A;  3V81 A;  4OLB A;  3HPH A;  5M1F A;  3VQ5 A;  3NGI A;  1FXX A;  4B3R K;  1KCF A;  3OYD A;  2KTQ A;  2OYQ A;  1YVN A;  3EL2 A;  4BR9 A;  2NRX A;  3BUZ B;  3THW B;  2QKK A;  2QWM A;  3ZT1 A;  3ENB A;  3TAB A;  2BUP A;  2P9P A;  4YOW A;  5JVH L;  3SUQ A;  2HHH K;  5E41 A;  3ZSQ A;  3Q7B A;  3ENH A;  2G8V A;  4Z0U A;  2BH1 A;  3J8A A;  2V51 B;  1YVU A;  3A5M C;  1K9M O;  4WYB A;  1WSI A;  4L8R B;  1S9E A;  3JXU A;  4H03 B;  4H4O A;  2ETJ A;  4FW2 A;  2F96 A;  4BRM A;  4EZ9 A;  4JI2 K;  3CIP A;  2ZGZ A;  1LAV A;  3VTH A;  3T69 A;  1QQO A;  3KKR A;  1Q9Y A;  3SBG A;  1SS6 A;  1DKG D;  3NF7 A;  5EY4 A;  4DR3 K;  4YDU A;  3QO9 A;  2F8S A;  4CJU A;  3WQT A;  5B8H A;  4IOA L;  5BRD A;  1BA0 A;  4RW8 A;  1QVF M;  3TPQ A;  3M8Q A;  3VA3 A;  3KZB A;  1WN7 A;  3HO1 A;  1QZ6 A;  1OH6 A;  1DEJ A;  3NMU A;  3L4I A;  3CFR A;  3VN5 A;  4KHP K;  2XO7 A;  2JWL A;  3OBY A;  2RE2 A;  5LMU K;  4KTQ A;  2P9U B;  3CF5 L;  4CD3 A;  4BR4 A;  5F2R A;  2UXB K;  3V6D A;  2B4J A;  2IOC A;  3PUF A;  2P9K B;  3L2R A;  1B9F A;  1QSY A;  2XHB A;  4DKW A;  1RDD A;  4FO0 A;  4M7Y A;  3ZSO A;  3JS6 A;  5KTQ A;  1GOC A;  4DQR A;  5GAD P;  1KFD A;  4OO1 J;  3VQQ A;  3SLC A;  2WUS A;  3HPO A;  4FLZ A;  4CES A;  4IDK A;  4B3S K;  3KD5 E;  1XWL A;  2BTF A;  3VQC A;  5K14 A;  1VHX A;  4KHW A;  3THV A;  4Z4F A;  1X3M A;  3VEV A;  3ZEU A;  4B1W B;  5AQM A;  1LOT B;  1RT5 A;  2WC9 A;  1NLV A;  4DLG A;  3D0P A;  1SKS A;  3SPZ A;  4JI7 K;  3AVI A;  3ZET B;  3O3H A;  3QEP A;  1D9D A;  4M42 A;  3LP1 A;  3MX5 A;  1WSG A;  3OYI A;  3MMV A;  1IBL K;  3TR8 A;  1RT1 A;  4C8N A;  2NRV A;  3LWM A;  4LSL A;  2IIR A;  4NCB A;  4H5W A;  4YOR A;  4C23 A;  4I7F A;  2BE2 A;  1QSL A;  2WFB A;  4F4K A;  2IC3 A;  3EZ5 A;  3OYJ A;  1VAZ A;  3VEY A;  1TKX A;  1VSH A;  3VQ9 A;  1C0F A;  3CCL N;  3OYC A;  5BPM A;  3NF8 A;  4CF8 A;  2D0P A;  5C2D A;  3TSP A;  1X9J A;  3V9S A;  3QEV A;  4WQ4 C;  1YXQ A;  3FZF A;  3VEX A;  1GLB G;  3LAK A;  2XY7 A;  4KB1 A;  3CMA N;  3AA4 A;  5JS1 A;  1SKW A;  2P9I A;  3SI6 A;  5GIN A;  5AQO A;  3SQ1 A;  1NKC A;  3OYA A;  4F8R A;  4CJ7 A;  1C1C A;  2RKI A;  5KPT A;  1N8R O;  4W5N A;  4DTM A;  4GW6 A;  5M1O A;  3RSE A;  1JLF A;  5DM7 L;  5JVG L;  1EWQ A;  4DV2 K;  1EP4 A;  3DLE A;  4DTO A;  1U48 A;  4IEI A;  3MN5 A;  1ZYQ A;  3I56 N;  1QSS A;  4CK1 A;  4BRO A;  4MLE A;  4N56 A;  1EX4 A;  4PL8 A;  2FBV A;  3PSF A;  4BE1 A;  4E89 A;  5IT9 O;  3LAM A;  5FPN A;  2W42 A;  2B5J A;  3H08 A;  1MWK A;  3CPW M;  3QEW A;  3DXK A;  5AQT A;  4AHR A;  2OTL N;  4BR0 A;  1RBV A;  2E2O A;  3IDH A;  4ISF A;  3FGU A;  4H0X B;  4B8C A;  1KLM A;  5HLF A;  1WSJ A;  2O8C B;  5H1S Q;  1SQK A;  3CME N;  2O8B B;  3PX6 A;  4EHU A;  2GWJ A;  4B1Y B;  3KWG A;  4CJE A;  1DTQ A;  3DLL L;  1C1A A;  3SBT A;  4BC5 A;  4E7I A;  4X66 K;  5HL7 L;  2KLA A;  4M3U A;  3MXJ A;  4JI4 K;  3HM9 A;  2R7Y A;  2O4I A;  2JGU A;  3ZSY A;  3BF1 A;  1S3X A;  2FBX A;  3CCR N;  4DFM A;  1TK8 A;  3SMS A;  3EEQ A;  1KLN A;  1ASV A;  4BR5 A;  1NOZ A;  5HBM A;  1RT3 A;  3L2V A;  5FPE A;  1ILY A;  3AA3 A;  4MQ3 A;  4H5T A;  1FKO A;  2IVO A;  4X65 K;  4CJF A;  1HYV A;  3MAQ A;  5GAH P;  1TL1 A;  2HND A;  3ZYY X;  4PKH A;  1IG8 A;  5BPN A;  3AVK A;  3F9M A;  2W41 A;  2GUP A;  3L3V A;  4PKI A;  1D9F A;  2JWK A;  3FZL A;  3C7N A;  3RRG A;  1WBB A;  2VG5 A;  1VSI A;  4BRK A;  2DFH A;  3OBW A;  4EIA A;  3BY5 A;  1VQ7 N;  3IKM A;  2QWQ A;  4H5R A;  5FRM A;  3BGR A;  4W5R A;  5M1Q A;  5KQ8 A;  4CJL A;  5T7B A;  2G8F A;  4FJ5 A;  4FL9 A;  3NH2 A;  2FLO A;  1T05 A;  5BRE A;  1NJZ A;  2UU9 K;  2O8F A;  4BY9 C;  3AAQ A;  3D2F A;  4LF5 K;  1O1W A;  1NGG A;  4NCA A;  1RT6 A;  1BCM A;  1BWF O;  2F9W A;  5GIP A;  1J54 A;  3AVM A;  1GOB A;  5GAG P;  4CJP A;  2A41 A;  4JS5 A;  4CER A;  5AQH A;  1VSE A;  2QI2 A;  3OS2 A;  4K8X A;  1NMD A;  2PZS A;  3MWP A;  4OGE A;  3T1H K;  3T3F A;  3O5B A;  2HMI A;  1GLF O;  3CQY A;  3LDP A;  3V1Q A;  3G25 A;  1HQU A;  1VK0 A;  1BI4 A;  5AZJ A;  5DM6 L;  4DTU A;  4DU4 A;  3G71 N;  4IEE A;  3O4Q A;  3H3O B;  3OS0 A;  3OA9 A;  2OZS A;  3AY9 A;  4E7L A;  1D4X A;  2E2P A;  3ZX2 A;  5EVZ A;  4BVO A;  4E1M A;  2D0A A;  2HBL A;  4N5S A;  4Z4H A;  5KPZ A;  3OYB A;  3CCS N;  2OPS A;  1OH5 A;  3R3L A;  5JMV A;  3KK1 A;  4JHD B;  4O4G A;  3HRG A;  3PY8 A;  1GLA G;  1IJJ A;  1BL3 A;  1RGI A;  1U49 A;  3O4N A;  2V52 B;  4JKE A;  4LF7 K;  2G8W A;  1J5E K;  4QAG A;  1QHA A;  2IVN A;  4IXC A;  4B3M K;  1OH7 A;  1D5A A;  1UOC A;  3WEE A;  1CLQ A;  3TAG A;  4UY8 O;  5M1N A;  1N5Y A;  3ZSR A;  1XC3 A;  4CGD A;  3E9L A;  2YHW A;  2Z1I A;  3WXI A;  1FW6 A;  2P9N A;  3QIO A;  4JKA A;  2LSN A;  4BG8 A;  1NGA A;  2E8A A;  4FJH A;  3KLH A;  4LF9 K;  3DXM B;  4ID5 A;  1YT3 A;  3SZ2 A;  2KW4 A;  4AHC A;  3SPY A;  2QXF A;  4IFY A;  4C8L A;  3ZSW A;  3SCX A;  3SMP A;  3HZ6 A;  4A59 A;  1P90 A;  4DV5 K;  4YY3 K;  4EFH A;  1HLU A;  3NDK A;  2ZJR L;  1NK0 A;  2BDP A;  4CBX A;  1X3N A;  3TTF A;  1G99 A;  4KO0 A;  2P9P B;  2HHW A;  3C6H A;  4CBU A;  4JRQ A;  2HVI A;  4KB0 A;  1WNS A;  5AQZ A;  3KLI A;  1QQC A;  4DR2 K;  3NE6 A;  2OZM A;  4CVN E;  4WFB L;  1HJR A;  2WOM A;  3EYZ A;  3K5L A;  3F9K A;  1NK9 A;  3C65 A;  5AQK A;  2I7N A;  2Q31 A;  5JLF A;  2O8E B;  3J7A P;  2P9S A;  5DK5 A;  4CZE A;  1IO2 A;  4N47 A;  3K0S A;  4C8O A;  1XI1 A;  3A8Y A;  4OPA A;  1GOA A;  3U3Y A;  3R6M A;  2Q0R A;  4KRE A;  2O8D A;  1NGE A;  3T1Y K;  3AGR A;  1K8A O;  1Q86 O;  1W2B M;  2G8I A;  1K8K A;  3THY A;  4FWS A;  1YJ9 N;  3I0S A;  4FJI A;  1LAW A;  1VQ6 N;  4H8K A;  1FJG K;  1VQN N;  4CJ5 A;  5JLH A;  4JLH A;  1U4B A;  5FRN A;  3ZT4 A;  3O1W A;  5C0Y A;  4MO4 A;  3QIN A;  4B8A B;  3FZM A;  1E4G T;  3AVL A;  1JL2 A;  4K8Z A;  4M63 C;  3L2W A;  4RG8 A;  4KV8 A;  3T7Z A;  3C6A A;  4FJM A;  4DTN A;  1NGB A;  4DFJ A;  4GMJ B;  3M1F A;  5AR0 A;  3VQA A;  4BRI A;  4DQI A;  1IH7 A;  4W5O A;  4CEF A;  4DTJ A;  3OYH A;  1Z6R A;  3W0L A; 
#chains in the Genus database with same CATH homology
 4HVJ A;  5HRR A;  3NF7 A;  3E01 A;  4ZTF A;  4FJX A;  3KD1 E;  3WNE A;  2A1S A;  5FDL A;  2KQ2 A;  3HYF A;  2G8H A;  1REV A;  5EU7 A;  1ZBU A;  3AVG A;  3ZT2 A;  4ELU A;  4KHQ A;  1UAX A;  4CCH A;  4E0D A;  3AVJ A;  3AVC A;  3V1R A;  3V4I A;  3QO9 A;  4CFB A;  4F3O A;  1JXE A;  1X1P A;  2F8S A;  4Q0B A;  1A5V A;  4CJU A;  3S3O A;  2ITG A;  1RT2 A;  3ZT0 A;  1BQN A;  1S9G A;  3VQ7 A;  4RW8 A;  1RBU A;  4CFC A;  1CXU A;  5JS2 A;  3SUP A;  4FJG A;  3K5M A;  4PY5 A;  5CYM A;  2D0C A;  3JSM A;  4HHT A;  2X78 A;  3M8Q A;  4Y1C A;  4AIL C;  1RBR A;  3VA3 A;  3OVN A;  5DMR A;  1RCH A;  1WN7 A;  2OPP A;  4TSX A;  3MEE A;  4CF1 A;  1KVC A;  1JLB A;  4ICL A;  3OS1 A;  1EKE A;  3HO1 A;  1NKB A;  1ZBL A;  1UWB A;  1Z26 A;  4KRF A;  3VA0 A;  1NK8 A;  4BWM A;  3OYM A;  3T19 A;  3F73 A;  5C24 A;  3DLK A;  4FK2 A;  3ZSV A;  3CFR A;  5FRO A;  3VN5 A;  1RDC A;  1RTI A;  4CEO A;  3NFA A;  2XO7 A;  2EX3 A;  3NH0 A;  3UIQ A;  2GV9 A;  1TL3 A;  4OLA A;  3V9U A;  4CF0 A;  3DI6 A;  2RN2 A;  4KTQ A;  4KPY A;  3HJF A;  4KHU A;  4O5B A;  3V6D A;  4HCC A;  4E1N A;  2F8T A;  2B4J A;  2IOC A;  3OYG A;  3PUF A;  3L2R A;  2EHG A;  1B9F A;  4O55 A;  4CJS A;  4M41 A;  2RPI A;  1QSY A;  2IAJ A;  2XHB A;  3LP2 A;  5HP1 A;  2PYL A;  1KSP A;  4CIE A;  1RDD A;  1Q9X A;  3NGY A;  3ZSO A;  4KI6 A;  4YNQ A;  4QCL A;  2BGG A;  1BIS A;  5KTQ A;  1BCO A;  4DU3 A;  2YNH A;  3G10 A;  1GOC A;  1I3A A;  2DFE A;  4I2P A;  4OPK A;  5J1E A;  3DOL A;  4DQR A;  3OYF A;  4IG3 A;  3NAE A;  1KFD A;  4FJJ A;  3VQQ A;  3QEX A;  1JXB A;  1NK5 A;  4N41 A;  4W5T A;  4FM0 A;  3KLE A;  3ALY A;  3HPO A;  1QTM A;  4FLZ A;  1BIU A;  4CES A;  4IDK A;  1X9M A;  2Z1G A;  1XWL A;  2D0B A;  3LWL A;  4XIU A;  3VQC A;  4DTX A;  4CEZ A;  1TK5 A;  3KD5 E;  2YKM A;  3MEC A;  4Y1D A;  5K14 A;  4B9U A;  4FJN A;  2HHQ A;  4KHW A;  5C25 A;  3THV A;  4Z4F A;  1TAU A;  4DFK A;  1EXQ A;  4AHU A;  3SJJ A;  2G8U A;  1XHZ A;  1RT5 A;  4B9V A;  2Z1J A;  4RW9 A;  2PY5 A;  1NJY A;  3HXM A;  2HHS A;  4DLG A;  3D0P A;  4FLT A;  1SKS A;  3SPZ A;  3MXI A;  5KGX A;  4PWD A;  3AVI A;  3O3H A;  4G1Q A;  4C8K A;  1DTT A;  3KLG A;  3ULD A;  3QEP A;  1D9D A;  3LP1 A;  4M42 A;  1S1V A;  2AJQ A;  1WSG A;  3OYI A;  3LZI A;  3CG7 A;  4LH4 A;  3IRX A;  3TR8 A;  1RT1 A;  1BQM A;  4C8N A;  3FFI A;  3LWM A;  3AVF A;  2VWK A;  4LSL A;  4NCB A;  1S1X A;  1HNV A;  4F2S A;  4I7F A;  3QLH A;  3L3U A;  4NYF A;  3PX0 A;  2BE2 A;  1QSL A;  4HTU A;  1XHX A;  2HNZ A;  4E7K A;  2IC3 A;  4F4K A;  3AO4 A;  2FBY A;  1ZBH A;  1F21 A;  3EZ5 A;  3OYJ A;  4I2Q A;  4CHP A;  1TKX A;  1VSH A;  3VQ9 A;  4Z4G A;  2QK9 A;  4FXD A;  2IS3 A;  3OJS A;  1RBS A;  1YTA A;  3OYC A;  2KFN A;  3DLG A;  3NF8 A;  1FK9 A;  4CF8 A;  3TWH A;  3T1A A;  4CJW A;  4DLE A;  5J2M A;  1TKT A;  3RMA A;  4ELT A;  1C0M A;  1UA0 A;  2PYJ A;  2OPR A;  2XRI A;  3V9S A;  3QEV A;  4FZX C;  1L3U A;  3D45 A;  1YTU A;  4IKF A;  3DLH A;  3TAN A;  4CJV A;  1HYZ A;  4B9M A;  3LAK A;  4CHY A;  1LWC A;  4HUG A;  2XY7 A;  4KB1 A;  3KTQ A;  2O4G A;  2YHA A;  3AA4 A;  1SKW A;  4EP4 A;  5JS1 A;  3SI6 A;  3V9X A;  1QHT A;  3SQ1 A;  5J2Q A;  3NBP A;  1JLA A;  2X6N A;  1NKC A;  3DLR A;  4CEA A;  3NF9 A;  1LWF A;  2RF2 A;  3LAL A;  3OYA A;  3QER A;  1C1C A;  4F8R A;  4M3Z A;  1DLO A;  1IKY A;  2RKI A;  3VQB A;  4W5N A;  4LH5 A;  4DTM A;  4KKO A;  4GW6 A;  4PA1 A;  3KK2 A;  1JLF A;  4M3W A;  1EP4 A;  4EP5 A;  3S3N A;  1SL0 A;  3HP9 A;  3AA2 A;  3DLE A;  4DTO A;  1U48 A;  3VQD A;  3DYA A;  1VSK A;  4DSF A;  1ZYQ A;  1S5J A;  4YFU A;  1QSS A;  1JLE A;  4CK1 A;  1IKV A;  3IS9 A;  4HUE A;  4KFB A;  3LP0 A;  4N56 A;  4FYD A;  1EX4 A;  2XY5 A;  2FBV A;  4M45 A;  4CJQ A;  1NK4 A;  3QET A;  2IDO A;  3DOK A;  1ASW A;  3K5N A;  4BE1 A;  4E89 A;  4FCY A;  4B3O A;  3LAM A;  2VG6 A;  2X6S A;  3DRR A;  3ZSX A;  1QE1 A;  4CFD A;  4DTS A;  1UA1 A;  2JLE A;  4CGJ A;  3DLB A;  4Z4C A;  2W42 A;  2B5J A;  3H08 A;  3OYN A;  4N76 A;  1KVA A;  1IG9 A;  3QEW A;  1EET A;  3ASM A;  3B6P A;  4CGH A;  3DM2 A;  3EY1 A;  4DQS A;  4AHR A;  4W5Q A;  1HMV A;  4CJR A;  3RRH A;  1VSF A;  3CFO A;  1G15 A;  1RNH A;  3SQ4 A;  1MU2 A;  1RBV A;  4DU1 A;  4PQU A;  4EZ6 A;  3RMD A;  1VSJ A;  3HVT A;  1RTD A;  2KZZ A;  4B8C A;  1KLM A;  3MED A;  5HLF A;  1WSJ A;  2ATQ A;  4KHS A;  4CJ3 A;  4M3Y A;  4NYN A;  4CEE A;  3HPG A;  4IG0 A;  4CIG A;  1RIL A;  3PX6 A;  4ZHR A;  4FZZ A;  4DSJ A;  1L3T A;  3V9Z A;  2DFF A;  2D5R A;  3QNN A;  4DWI A;  4DTR A;  4CHZ A;  4B9N A;  4E19 A;  3SV4 A;  1VRT A;  4CJE A;  2YNI A;  1DTQ A;  3RMB A;  2ZQB A;  1C1A A;  4BDZ A;  4IBN A;  3KK3 A;  1HYS A;  2E6L A;  4E7I A;  3AO3 A;  2Q3S A;  3RWU A;  1HNI A;  3OYL A;  4JS4 A;  4BDY A;  2P5O A;  4M3U A;  3V1O A;  3MXJ A;  3M8R A;  4CK3 A;  5D3G A;  3HM9 A;  2R7Y A;  4F3T A;  2O4I A;  2JGU A;  1VRU A;  1VSM A;  2X74 A;  3ZSY A;  4DMN A;  3P1G A;  4DS5 A;  2FBX A;  4CIF A;  4DFM A;  3PV8 A;  4OJR A;  1TK8 A;  1KLN A;  2G8K A;  3P83 D;  1BGX T;  1ZBI A;  3DRS A;  1ASV A;  3MXM A;  4BE2 A;  1NOZ A;  5HBM A;  4LD0 A;  4DFP A;  1RT3 A;  3L2V A;  4FLW A;  3IAY A;  1SL2 A;  1ASU A;  3OYE A;  3AA3 A;  4PUO A;  4MQ3 A;  1C0T A;  4CGG A;  4CHO A;  4J2B A;  2KFZ A;  3AO1 A;  5CZ2 A;  1NOY A;  2B6A A;  1FKO A;  5I42 A;  1C1B A;  3AVN A;  4AHV A;  2YKN A;  4LY7 A;  1LW2 A;  3OJU A;  4CJF A;  1VSD A;  4DSE A;  2HHV A;  1HYV A;  4KHY A;  3MAQ A;  1C6V A;  4FJ9 A;  3LDS A;  1TL1 A;  2HND A;  1U47 A;  2YNG A;  2P5G A;  3C94 A;  2Y1J A;  3AVK A;  3TAF A;  4FVM A;  1JL1 A;  3NCI A;  1X9S A;  1X9W A;  3AVA A;  1BI4 B;  1ITG A;  3ISN C;  3SUN A;  1HQE A;  3L3V A;  1D9F A;  2KZM A;  3SV3 A;  3DMJ A;  4C8M A;  3LZJ A;  3RRG A;  5SWM A;  4O0J A;  2VG5 A;  3HK2 A;  1VSI A;  3K2P A;  2DFH A;  1K6Y A;  4DSK A;  4HCB A;  4CK2 A;  1W9H A;  4M3T A;  1HPZ A;  4OGC A;  4CEQ A;  4ELV A;  5C42 A;  1NK6 A;  1LWE A;  2E6M A;  3NHG A;  3S9H A;  4C8L A;  1S1T A;  2Z1H A;  3AVB A;  5FRM A;  1WSE A;  4FZY A;  3BGR A;  4W5R A;  4E7J A;  3QEI A;  1L3S A;  4AHT A;  3NF6 A;  4CJL A;  5T7B A;  2G8F A;  1WLJ A;  1JLC A;  1Y97 A;  3VQ6 A;  4CEC A;  3NH2 A;  4FJ5 A;  1T05 A;  1NJZ A;  5KI6 A;  5CY4 A;  4LSN A;  3OYK A;  3QES A;  4ZTJ A;  3SUO A;  3ZCM A;  4CJ4 A;  1O1W A;  1SUQ A;  1NJW A;  4NCA A;  4DQQ A;  1RTJ A;  1RT6 A;  1A5W A;  1BCM A;  1J54 A;  4O0I A;  3AVM A;  1GOB A;  4FK0 A;  1Z25 A;  2A1R A;  3RR8 A;  3WNG A;  4JRP A;  4DF8 A;  3RTV A;  4FJ7 A;  2DY4 A;  3RMC A;  1TK0 A;  1A5X A;  2Y1I A;  4CJP A;  4JS5 A;  4BE0 A;  4CER A;  4DS4 A;  3SQ0 A;  5CYQ A;  1VSE A;  3ITH A;  3VQ8 A;  3TAP A;  4CJT A;  2VG7 A;  5CZ1 A;  2IGI A;  3OS2 A;  5KGW A;  4K8X A;  4F2R A;  2PZS A;  4IFV A;  1XC9 A;  4OGE A;  1IKX A;  4HUF A;  3T3F A;  4FLX A;  3O3F A;  2ZE2 A;  2HMI A;  3KLF A;  1TV6 A;  3V1Q A;  4DF4 A;  4CED A;  4BWJ A;  1HQU A;  4RW4 A;  1KFS A;  1C0U A;  4CGF A;  1VK0 A;  2FC0 A;  3RR7 A;  4RW7 A;  1BI4 A;  3M8P A;  2HNY A;  1IKW A;  4DTU A;  1S1U A;  4QOZ B;  1RBT A;  4DU4 A;  4B9T A;  3O4Q A;  3LPT A;  1BIZ A;  4FK4 A;  3JYT A;  1I39 A;  3OS0 A;  3IG1 A;  5SZT A;  4R5P A;  3K58 A;  3K59 A;  4KAZ A;  2OPQ A;  3CYM A;  4B08 A;  4E7L A;  2OZS A;  1SV5 A;  3VQE A;  3L8B A;  3PX4 A;  4BDP A;  5HRO A;  1WAF A;  1JLQ A;  3LAN A;  2D0A A;  4CF9 A;  4E1M A;  4N5S A;  1TAQ A;  4KTZ A;  4Z4H A;  3L2Q A;  4M3R A;  3OYB A;  3KJV A;  2HHT A;  4KHN A;  2OPS A;  4CHN A;  1JKH A;  1RTH A;  3KK1 A;  4OPJ A;  1R0A A;  5HRP A;  4FM2 A;  3PO5 A;  4O4G A;  3C6T A;  3PY8 A;  1KRP A;  1BL3 A;  2XY8 A;  3DRP A;  1U49 A;  3O4N A;  1ZBF A;  2BAN A;  3WNF A;  2HHX A;  2YHB A;  1WAJ A;  2G8W A;  3U6F A;  1KTQ A;  4QAG A;  2YV0 X;  4CEB A;  1D5A A;  4H4M A;  1UOC A;  4OKK A;  1T03 A;  4KI4 A;  1CLQ A;  3TAG A;  4NCG A;  3KKS A;  3TAM A;  2WON A;  3LPU A;  3ZSR A;  3HL8 A;  4ID1 A;  4CGD A;  1N5Y A;  3WNH A;  5J2N A;  3PO4 A;  2Z1I A;  2P1J A;  3C95 A;  4AH9 A;  1RT4 A;  3CM5 A;  2HHU A;  1S6P A;  3QIO A;  2GUI A;  1U04 A;  2VWJ A;  2LSN A;  3AO2 A;  3TAR A;  1HRH A;  1S6Q A;  3ZT3 A;  4CJK A;  3KLH A;  4FJH A;  4ID5 A;  1LW0 A;  4CF2 A;  1YT3 A;  3SZ2 A;  1B9D A;  4FJ8 A;  3TAQ A;  1T8E A;  2KW4 A;  2FBT A;  1WSH A;  4AHC A;  3SPY A;  1CXQ A;  2OA8 A;  2QXF A;  4MFB A;  1CZB A;  4IFY A;  4O44 A;  3ZSW A;  4FLV A;  4E7H A;  4OVL A;  3I8D A;  3SCX A;  3SNN A;  4FLU A;  2HVH A;  3AO5 A;  1N6Q A;  3BDP A;  3A2F A;  4CFA A;  4AHS A;  3NDK A;  4OKJ A;  2NUB A;  3NH1 A;  5HRS A;  1NK0 A;  3KIO A;  1J5O A;  2BDP A;  1FKP A;  5KRS A;  1RDA A;  4KO0 A;  5I3U A;  2HHW A;  3LP3 A;  1U45 A;  4JRQ A;  1J53 A;  1T7P A;  2QKB A;  2HVI A;  4KB0 A;  3CM6 A;  4J2A A;  1WNS A;  3HST B;  3CQ8 A;  2P51 A;  3KLI A;  1QQC A;  3NE6 A;  2OZM A;  1CZ9 A;  5HRN A;  1Q8I A;  1HJR A;  4KTW A;  3TAE A;  4J2E A;  2WOM A;  3EYZ A;  3P5J A;  3K5L A;  1LV5 A;  2I5J A;  3F9K A;  4DTP A;  1NK9 A;  4B9L A;  5KRT A;  4I9Q A;  1VSL A;  3M8S A;  5DK5 A;  1IO2 A;  4N47 A;  3QNO A;  4C8O A;  4WE1 A;  1J9A A;  1XI1 A;  2DTU A;  1B92 A;  1TKZ A;  1GOA A;  3L2U A;  3U3Y A;  2XY6 A;  3OY9 A;  4M3X A;  2HW3 A;  3HVR A;  4KRE A;  3K5O A;  1L3V A;  4CGI A;  3K57 A;  1W0H A;  1BHL A;  3ZSZ A;  3C6U A;  3QIP A;  3VQ4 A;  4DQP A;  3VQP A;  4DSL A;  4E3S A;  4FJL A;  4BAC A;  2G8I A;  1TKD A;  5J2P A;  2YNF A;  3B6O A;  3NGZ A;  3V81 A;  2ZD1 A;  3I0S A;  4FW1 A;  4FJI A;  1LAW A;  4CHQ A;  3HP6 A;  4Z4I A;  4OLB A;  3AVH A;  4H8K A;  3HPH A;  1KVB A;  3VQ5 A;  1NKE A;  3MEG A;  3NGI A;  1FXX A;  4CJ5 A;  1KCF A;  3TI0 A;  4FJK A;  3OYD A;  2KTQ A;  2GBZ A;  2OYQ A;  4JLH A;  1TGO A;  1U4B A;  4DG1 A;  4UQG A;  5FRN A;  3ZT4 A;  2E4L A;  4OKE A;  4FM1 A;  1NJX A;  2QKK A;  1NK7 A;  3AA5 X;  3ZT1 A;  4DSI A;  3U3G A;  4Z4E A;  3TAB A;  3QIN A;  4B8A B;  4Q5V A;  3SUQ A;  4GVM A;  3O3G A;  3AVL A;  4RW6 A;  3V9W A;  3S3M A;  1QS4 A;  1JL2 A;  1D8Y A;  4K8Z A;  1JLG A;  3I0R A;  5E41 A;  3ZSQ A;  3L2W A;  4RG8 A;  4KV8 A;  1SKR A;  1L5U A;  2G8V A;  4Z0U A;  2HB5 A;  3G0Z A;  4FJM A;  3SQ2 A;  1YVU A;  3AV9 A;  4DTN A;  3CFP A;  3HT3 A;  4DFJ A;  1S1W A;  1WSI A;  1RDB A;  4J2D A;  4GMJ B;  4L8R B;  1S9E A;  4I9L A;  4H4O A;  2ETJ A;  4FW2 A;  4CE9 A;  1SL1 A;  3VQA A;  3SYZ A;  4DQI A;  2F96 A;  1IH7 A;  1WSF A;  4B9S A;  1RT7 A;  4EZ9 A;  4FLY A;  4W5O A;  4CEF A;  1LAV A;  4DTJ A;  3OYH A;  1TVR A;  3KKR A;  1Q9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...