1VSTA

Symmetric sulfolobus solfataricus uracil phosphoribosyltransferase with bound prpp and gtp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
215
structure length
215
Chain Sequence
b'PLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uracil phosphoribosyltransferase
publication title Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transferase
total genus 65
structure length 215
sequence length 215
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2009-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14681 UPRTase Uracil phosphoribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1vstA00
4M0KA 1O57A 1WD5A 1QCCA 5IPFA 4QYIA 1UPUA 1Z7GA 1BZYA 4P84A 2JKZA 1G2PA 1QK5A 1J7JA 4LZAA 1A98A 1LH0A 5JSQA 2FXVA 1UFRA 3HVUA 1U9ZA 1XZNA 1HGXA 4P81A 5ESXA 1PZMA 3OHPA 1A4XA 1R3UA 1W30A 1DKRA 4FYMA 2PRYA 1HMPA 3N2LA 4RACA 1A97A 2GEBA 1L1RA 1ZN7A 5IAOA 4Z1OA 1A3CA 4IJQA 2JBHA 4RAOA 4P82A 2E55A 2H08A 1CJBA 2IGBA 5HIAA 1A95A 1Y0BA 2WNSA 3G6WA 1JLSA 4RHUA 4RHTA 4X44A 2AEEA 1ECGA 1I13A 1DKUA 1XTTA 3S5JA 1BD3A 1XZ8A 2JKYA 2VFAA 3DAHA 5K51A 3KB8A 1QK3A 1VCHA 3O7MA 3GGJA 4P3KA 1STOA 1ECFA 2HCRA 3EFHA 3DMPA 1AO0A 1FSGA 1I14A 1YFZA 4KN6A 1ECBA 2DY0A 1P17A 1I0IA 1GPH1 5BQOA 4M0PA 1MZVA 1G9TA 3OZFA 1TC2A 3GGCA 4RANA 3GEPA 2H06A 2PS1A 1G9SA 1P4AA 2XBUA 4MB6A 4RQBA 4RABA 4X45A 4LZNA 1DBRA 4WMLA 1OROA 2C4KA 1P19A 1ECCA 2PRZA 4RHXA 4RV4A 5JV5A 1I5EA 1NONA 1TC1A 4P80A 4RADA 4TWBA 5KAPA 1NULA 3LPNA 1O5OA 1OREA 1ZN9A 4F8EA 3LRTA 1L1QA 1XTVA 2H07A 4OHCA 1DQPA 1UPFA 1A96A 4ZFNA 4M0UA 5BQPA 1BD4A 4S2UA 1D6NA 1IBSA 4P83A 3MBIA 1I0LA 1QCDA 1QB8A 5KAMA 4LYGA 4RAQA 1DQNA 3M3HA 2P1ZA 3OZGA 3QW4B 5HKLA 4JITA 1OPRA 2EHJA 3MJDA 4RHYA 2YZKA 2JI4A 4RQAA 1XTUA 1VSTA 4LZOA 1QB7A 4LYYA 1GRVA 5ESWA 3ACCA 3ACDA 4QYIB 4QRIA 1QK4A 3ACBA 4PAWA 1G2QA 4P86A 1ECJA 5BSKA 1JLRA 4WN3A 1U9YA 3DEZA 1V9SA 1P18A 3NAGA 4JLSA 5BRNA 1ZN8A 3H83A 5E38A 1VDMA 5EUCA 4PFQA
chains in the Genus database with same CATH superfamily
3A8TA 3U40A 1HPLA 2PDAA 5FUBA 5AVSA 1UP7A 5SY4A 4IDPA 3AEYA 1QPZA 4DV1B 4HDKB 4OGKA 1WPXA 4G4SP 4DQUA 4MVJH 3L5OA 2FFJA 1OYOA 5D7BA 1AOXA 4W8OA 3DOCA 5GZ6A 2J9FA 4EI9A 3FRHA 4KWCA 1YDHA 1C0EA 2FLWA 3GRFA 3HVUA 4BEJA 3UGJA 5J2TB 4YBRA 2ODBA 3AETA 5DOVA 3VO2A 4LN1A 5KTPA 3PYXA 1GXSB 1U9CA 1WF6A 3QKWA 2R68A 2GM3A 1E0KA 4L5JA 4E5VA 1RS0A 2NADA 3ZLUA 1SCUA 2UZ0A 4B6SA 3I5XA 1EZ1A 2Q3HA 4JYBA 2YNMD 1X8XA 2PZMA 4HH3C 1V5GA 4NL4H 3VC3A 2QRGA 3CLTC 3QU9A 4YHBA 5FA8A 5CA1B 5I47A 2C97A 2JBHA 4EHJA 4GZ6A 2J0QA 3O1IC 4CLDA 4CLEA 5E6UB 2QT0A 2JGNA 4QUHA 4X44A 2GZMA 4XIYA 4DIMA 4UQOA 2R96A 4KZPA 5KOHB 3LY8A 1QE5A 2VH5R 2WZBA 1Q95A 5ITVA 1ZH8A 3IT2A 5REQB 5AVZA 2WJJA 4Q3KA 1ZZGA 3U44B 3AFGA 3KCNA 4FGLA 1US8A 5AK0A 5IJ9A 1ZWLA 3BRWA 2JJ1D 3G0GA 4RVSA 1JKJA 3OH8A 2J9GA 4Y1RA 1QMGA 3RWMB 2RB5A 4WKCA 1PD1A 3AXSA 2QLLA 2UYCA 2FF7A 3VNUA 2A78A 2BOVA 3P1JA 3QKRA 3LUGA 3GEHA 3AO0B 2Q6LA 1BHSA 3I9KA 2QTFA 3OZVA 4C0QC 4KN5A 4HXEB 3MTQA 4KWTA 4KVGA 2QGNA 4M46A 2VBIA 1H9AA 4ZI7A 4L50A 1DU4A 3KU1A 1KSJA 4JA2A 3CG4A 5H5JA 1T4BA 3ZVRA 1DJNA 2PX8A 2QYHA 4O4JB 2H1VA 4RD4A 1O97D 3N0XA 3OQBA 1G19A 4NE2A 4JUIA 5AP9A 3R77A 4HDCA 4JKIA 5EXTA 3CTPA 4TTRA 1C9YA 5CT5A 5JPIA 3AVWA 3LXMA 2A1UA 3REGA 3AVVA 1H1LB 4O1IA 3S2UA 3MFYA 2Y68A 2CZGA 5T57A 1VLVA 1VPVA 2FP3A 2LKCA 3MLAA 4EJ2A 1KTIA 3LBHA 3LECA 4YV1A 2DQZA 3L6RA 4IEFB 5FFFA 2OFXA 3FUWA 1FTWA 3D0KA 3K1ZA 1XMIA 2BEKA 4N6OA 1YNSA 4ZRMA 4EG7A 4S1NA 2FSSA 4Y2XA 1RJFA 4R2KA 3BXGA 1MX1A 3VPGA 1P2UA 3CVXA 4URYR 8LDHA 3WGZA 4RM2A 5JH7F 4BE7B 1GTG1 5K4HA 4Q1AA 4ZOLF 2H16A 2J30A 4DJAA 1XDBA 2OG1A 2Q5FA 1WOMA 4OB8A 1RRMA 5FUYA 1G5QA 3RT1A 1LSOA 4QIHA 1VB5A 3X43A 4AJ1A 1IMJA 3KKKA 4CWAA 2Q4EA 1MN6A 2QX7A 3CLTD 5DM60 3QLEA 1NVAA 5SZHB 5GQSA 3IB3A 2A9QA 2QTNA 1NVDA 3SSOA 5LWQA 2H4JA 3IELA 1KPHA 4RBNA 5F9FA 1ZG3A 3DDHA 3NKVA 2O7NA 4OQZA 3VBCA 5E7MA 4ZK6A 3ROKA 5D6OA 4F96A 2DCUA 4QU9A 1CB7A 4BNKA 4BRWA 4EPWA 2J4FA 5E0OA 2YX1A 3AL2A 4Q01A 4U02A 3UMGA 2O5EA 1PYDA 1R0KA 1SZPA 1L1EA 4JEHA 2XKJE 4MVXA 1I6MA 1PX0A 1DO2A 3H2KA 4M0DA 2JLYA 3H04A 1V43A 2X19A 3KCQA 1UBGA 3CQ9A 3T6KA 1O6ZA 3B6IA 4AS3A 1JS1X 3WQQA 2CUTA 1A8QA 2R7LA 2HCJB 2QLBA 4CTMA 3U6KA 1OV6A 3QHPA 4L8WB 1GYPA 3OHPA 1MQSA 4OQXA 2GBPA 1BCSB 1TRKA 4X71A 4A6PA 5JECA 4OK6A 2OCPA 5TB5A 3PHCA 4DCTA 2G3YA 2OV6A 1UWKA 4YJ2F 1DCFA 1SHJA 1VE6A 3QNMA 4C0BA 2H1CA 2CFCA 3NHKA 2EWVA 2BBWA 5K1ZA 3AX6A 3M6LA 4GPZA 2I6SA 4PSVA 4UM9D 3KSBC 1T0PA 2ZRLA 4Q9IA 3Q3EA 2VZLA 2JJ2A 2ONZA 3TQTA 3IQDB 4IGEA 2AG8A 2V7VA 3ICEA 1Y1TA 1PLKA 1BYIA 1T5SA 3CXUA 3HFGA 3U31A 4F06A 1EP2B 4E4TA 1Z2DA 5B4UA 2QL6A 5BUZA 3TG8A 3PR2B 2IUFA 1Z0UA 2DR0A 4R84A 3B78A 2E1RA 4CFYA 4H7EA 2Q1SA 2AQIA 2IT1A 2WSSD 3TZKA 3TVYA 3UAWA 3V8VA 2HSEA 1QPBA 3OCXA 5AM1A 3PGXA 4GQBA 3RSFA 3DWGA 1ZWKA 2DULA 3NQ41 2FN7A 4MAMA 4LYHA 4MWTA 4EI8A 1YQUA 3O2NA 1M54A 2QNIA 1XCJA 4Y67A 4AG5A 4ND6A 5J5AA 1N1GA 5ADHA 5DCWA 1UOEA 3GVXA 2F43A 2PK3A 2YY5A 4BPRA 4TVKA 1Z7EA 4XJSA 2SKDA 2V74B 2HJWA 1IUNA 2ZKLA 3BDVA 4X3OA 2V6BA 4W1QA 3TFWA 4M1QA 4QEZA 3W8FA 3PUKA 5C8XA 4LPSA 1EPUA 4R1MA 2QN1A 4AXBA 3OPQA 4B9EA 3NBXX 2R8ZA 1T3TA 4EY5A 4NYJR 1AQIA 4WLOA 2EW2A 1Q1EA 4BQNA 2O20A 2R6HA 2XZTA 2H5LA 3QEJA 4ZARA 3TF5A 3EB9A 4IHJA 1K5GA 3VZBA 3OICA 5JCZA 3Q87B 2YMPA 3T3GA 3DKKA 5LIRA 1L9KA 4GE3A 5FNZA 5K2MA 3SAJA 4W5OA 4PLHA 3EZYA 1S7GA 3PUXA 3OIYA 4RTLA 1VJGA 3AFIA 3THWA 1KI2A 2ID8A 3K6SA 1YSCA 1BKDR 1C3OA 1QZ3A 3OE5A 1YBVA 1EXVA 5JASA 4J16C 1GCIA 3IMCA 3U37A 4E30A 4OLBA 5B37A 5JUWA 2NMVA 3A4TA 2R1VA 1FMJA 2HLHA 5KYXB 1X1QA 5LUAA 3FTQA 3OCWA 5JBIA 3PWKA 2I1QA 3PFIA 3ZBUA 2RHBA 4JVSB 3HR7A 3KYCB 1OWMA 3LP8A 3LWNA 3ESXA 3H5IA 4NV1A 1HORA 4YV7A 2AFRA 2C78A 1J97A 1ECJA 2C20A 3LCMA 4KE6A 5BW6B 1DKOA 3S44A 4CN9A 4AY5A 4NOJA 2XDAA 1XO1A 3R6WA 4ZA2A 4Y9DA 3NTRA 3RHSA 1UM8A 4J7UA 4MWCA 1QIFA 4C6TB 3I52A 1YGYA 1VL5A 3A6HA 3I37X 3L0PA 4BO9A 3HGQA 3ASYA 3TMAA 2RGUA 4KN9S 2XTZA 1C1HA 1PT9A 5HFNA 4FFLA 2FEOA 1JAZA 4OHYA 2FEXA 1GLNA 2C2XA 1CDDA 3M2PA 1CRLA 3OZUA 1YFKA 3IVGA 4R2IA 5BNTA 5A5DA 1GU7A 2YRWA 4PZUA 3IEKA 3VPHA 4R2WA 2IC5A 1HL7A 4JLVA 3FZYA 4DA8A 3FPCA 3G17A 3OCZA 1ODJA 4ALKA 4CRWB 2BBTA 4N7JA 5EKDA 2JJ8A 3WRYC 1A3CA 4LDAA 2XCIA 3E4DA 4LSZA 4XJVA 2I22A 1P0FA 1DCTA 1AV6A 1V7CA 4RHUA 3DE0X 2ZRHA 5CB4F 2H7XA 4NF2A 4OXXA 2PL9A 4R6WA 5CW1A 2D0IA 4I50A 3B6KA 1M1ZA 2W58A 4Y6OA 3DO5A 3UUWA 4UPEA 3WMXA 2ZSBA 1E5QA 4NFHA 4PCAA 4YJKA 3V2HA 1KH2A 4EBFA 1JDNA 3C48A 1HR0B 1T5IA 4LXXA 2GJKA 1KE2A 2SCUA 3CW9A 3FPJA 4BQIA 1Q1BA 3HCEA 5MGNA 4MIEA 2WTEA 4DJTA 3RUPA 3FHOA 3IAXA 4OQDA 3TLYA 4YCBA 1E4YA 2MMGA 2HMUA 1B2LA 5EVCA 4TXNA 5MGBA 4AKIA 1XLWA 1Z08A 4PO8A 2FPWA 3EEIA 3G5UA 3LQQA 3KU4A 4BV9A 1W5FA 3CMMA 1E9AA 1UPCA 1Q0RA 1O8CA 2HRBA 3K8QA 3LQYA 4PX2A 1ZKDA 2JCXA 3QE9Y 1S2IA 4URUR 3AOEC 4RJJA 2XH8A 2VYVA 3GFGA 4MKFA 1JE1A 2O1SA 4HADA 4YO7A 3UENA 2FWNA 4BNZA 521PA 2KJQA 3THYA 1BDIA 1LLDA 4RGVA 1WMFA 2PAFA 4CG1A 4WD3A 3IBGA 3ST7A 3F2VA 3FZQA 3ORHA 4L51A 4UKDA 3CC8A 3N1UA 3P32A 5JAQA 3WFZA 2PT6A 3TMYA 4E88A 1JR6A 2EWMA 1SKBA 3SHQA 2WILA 1YRHA 2G9ZA 4F1JA 4OMCA 5EJ7A 3I39X 4DF3A 2EQAA 3DXXA 4K9SA 1UDXA 3PNMA 2H4WA 4L0MA 2GGSA 4HO1X 2C31A 3KKLA 4E2FA 4RMNA 1YMUA 3FFAA 2CDAA 2K87A 2FY8A 5AI0A 4LDQA 1P77A 1YU9A 1HDRA 1O89A 1CS0B 3LUBA 3BILA 2OCAA 3VJKA 4L85A 4ZEVA 1WVMA 4QQNA 1S01A 1XQYA 2DXIA 1E64A 2PUDA 3AHIA 5KUTA 4GP6A 5A0FA 4OK5A 2JIOA 3MCUA 3B1ZA 3G9TA 3GLIA 2IXTA 2CL0X 3OECA 4POOA 1QHYA 2XY4A 5J63A 1X7DA 1AC5A 4CKXA 4UD6A 2A7QA 1M5TA 4ZXFA 1FP2A 5E1BA 2JNWA 5EJ9A 3AI7A 2V7QA 3EUFA 5E2BA 4GOMD 4P6VF 1LZKA 3MEQA 1GPBA 1KNXA 7YASA 4TKUB 1BROA 3HXQA 1HT0A 1X77A 3R23A 4CKZA 5KREA 2FW0A 1Z6ZA 9ATCA 3LVBA 1RABA 1O94A 2P4QA 3IO3A 2UZ3A 1PT7A 3ELDA 2NPIA 3LKZA 3VNQA 4H1TA 4PRKA 2HT1A 1VA5A 1XROA 2FPGA 4X91A 3ABZA 2M1ZA 4TLEA 5AKKA 4DLUA 4Z6KA 4QTZA 5FT9A 1AE1A 2EL9A 1U1DA 1PGJA 1JIIA 1JHDA 3WB2A 5CH5A 1L5FA 1LX6A 1NJ6A 1XKLA 3H1GA 4J3FA 3GRVA 4OL9A 2QMZA 4Z1MA 1OAOC 3VR5H 1EJ0A 5C5EA 4MVYA 4FI3F 1N5DA 1M67A 2H3HA 3GVPA 3KQSA 2I67A 1JSXA 1T3ZA 4GRDA 2B2CA 1TGYA 3UYKA 4ERXA 1PQUA 1I2AA 2O7QA 4CV3A 2ZS8A 4OGLA 4P4SB 2WBLC 1OTXA 1Y0BA 1Q6YA 3H84A 3ESRA 3WMWA 4B7AA 4JN6B 4DA9A 2VNSA 1Y8RA 3OESA 2P5UA 1E0AA 4FN5A 3IS3A 4AF6A 1RVV1 2AR0A 2IPAB 2AMFA 3JYQA 4L2IA 4RSMA 1X2BA 4JJAA 4W6QA 3DPUA 2OXFA 2XIJA 4FPXA 1EB8A 2JF0A 2ZK7A 4ZQBA 5C53B 5EJFA 3VI3B 4NPHA 2DX7A 2YWGA 2YZMA 1MENA 4Q48A 1MC8A 1NOJA 1EFPB 1KEUA 2EIXA 1GZDA 2VLBA 5DH9A 2JFUA 2P9HA 2BELA 4RK7A 1BN6A 4GGPA 1CR4A 1MO6A 3DCYA 5K0NA 2JGEA 1X7YB 1M2GA 1PHRA 3E05A 1NQOA 4OHPA 3C1OA 4GHWA 4JODA 1KC1A 2WVHA 4P54A 2HI0A 1OLXB 3L77A 3TOZA 5AFSA 1MDBA 1CR1A 5BN5A 3CT6A 4C4RA 3A1TA 3OLZA 1SPBS 4QVGA 3BJRA 1T26A 3JWPA 5EIOA 1E6LA 3CLUC 2ZYHA 4FDLA 4NBLA 2XJ4A 4EJSB 2G8NA 3SKYA 3JQ9A 2ZRNA 5LBTA 1SBTA 4KXUA 4QT4A 4X66B 1XPJA 3BF8A 4QO7A 4HAOA 1GNSA 1Z2NX 4RZ2A 3QH4A 4MGIR 4PX3A 4X7RA 4BHTA 1KFEB 2FZCA 3PJRA 5HBGA 4MMZB 3SK0A 1FMTA 3U7GA 4PIVA 3IOMA 3AVXA 1PS9A 2ERYA 1T2NA 2X7XA 1BMDA 1JB9A 4JB8A 4S2UA 1Z5VA 2FQYA 3BFKA 1F2UA 1BHQ1 1G1MA 1QCDA 1TZKA 3EC7A 1VLJA 3QEKA 3ADDA 1JHOA 2EZ8A 3DMRA 3IAS6 1NBME 2HDWA 2XUJA 3Q0EA 1QAQA 1FBTA 2ZBPA 3HUTA 3KG2A 4AZ3A 2WB2A 2I8AA 2GKSA 3FUTA 1XVIA 1XR3A 1ONSA 2VRWA 3CJRA 3FZNA 4R2JA 4FX5A 3T0GA 3ZCUA 4NCKA 1M8JA 4OCZA 4RQAA 1VYHA 4IJWA 4ESOA 3A4IA 4QHTA 3R7SA 1REQA 1XJCA 3V8BA 2A9OA 2B2XA 2IYTA 2XB6A 3HR4A 3ZOKA 5CDSA 1PT8A 5CH3A 4ENQA 3O6VA 2JH8A 4L95C 4PAGA 4QL3A 2X3FA 1GSAA 2XQJA 5BSMA 2XTNA 3FNIA 1ATIA 1XKXA 2HA4A 1UM9B 2DUNA 2G40A 4Q4HB 4X8MA 4CCSA 4ENRA 1Q16A 1KOFA 1QDLB 1SQ5A 2IHYA 4GKAA 4YN3A 5FI1B 3VU9B 2P0AA 2GN8A 2VDLB 4MUMA 2WB4A 1ABEA 3VU0A 4WESB 3EFEA 3NVMB 1FDTA 4YAFA 2CJXA 3GNLA 4JXKA 1WB6A 4Q1DA 1NBMD 3N28A 4I9GA 5FTJA 1MCZA 3T95A 2GILA 5KNDH 2W48A 2O50A 2QPTA 3EY9A 5K0CA 1NXPA 2JHAA 1K7YA 1VLZA 1Y8QB 2QT9A 4CHGA 2HZBA 1JI3A 2ZE5A 2G5CA 2QORA 2R79A 3A9RA 5DTEA 5JZVA 4KQ2A 5EP1A 1CZHA 4EA7A 1J0EA 3D4PA 3QXSA 3UK6A 1IOVA 2ZJ5A 3I6ZA 4BX2A 4IUDS 3GAFA 3KZOA 1ZI8A 3OT1B 1I5RA 2LGJA 1HRKA 1RD4A 3IAUA 1H93A 4PPGA 2FG7C 4BVKA 3HRHA 3PRYA 3OX1A 1NR5A 4D9CA 1EHCA 4EW3A 2QPOA 1N25A 3TJMA 1DJQA 1IWBB 2R11A 4RO0A 4YDQA 3FMFA 3TSCA 4C07A 1P1FA 5IDVA 4QOFA 3ZDZB 3UMVA 1GQ2A 3ELYA 1H4TA 4XARA 5K9ZA 1CUGA 1W47A 2G4LA 3DBVO 3WFIA 3A4NA 2ZUVA 1FFHA 1G21A 2YWBA 1QS0B 1RI3A 2EZTA 2P91A 4JBWA 1XZ8A 3DZ8A 4IXNA 1MAWA 1TMYA 3L6OO 5HSGA 2I6GA 3F2IA 1GU0A 3NZEA 4WN9A 3EFHA 4XX0A 2O8EB 4CG3A 1YH3A 3RR2A 4KIWA 4G24A 5LQMA 4LRQA 5J4HA 3OJEA 2CE7A 3AERA 3JAWA 1S1MA 1GPH1 1H23A 3TLBA 3O3OB 4LV5B 4ZVUA 4OGFA 2IYUA 4ZZ2A 1X14A 2Z2ZA 2FPOA 3QG5A 1LV7A 4LNUA 4RPHA 4MUHA 4YDHB 3KZKA 5EWLA 1B2RA 3FNHA 1K6XA 3GFBA 4AJOA 6Q21A 2JB9A 2BR3A 4WOJA 4YA6A 4QQRA 3G7NA 4JUFA 4NU8X 3OSUA 3EDYA 3UMYA 1F06A 4F21A 2PX5A 4N3CA 1ZUHA 2Z5FA 3I2FA 4BVFA 5B30A 1J5PA 2ATIA 3NLLA 4RHXA 5SYNA 3EA5A 1VRCA 2WU4A 3SD7A 1ISGA 2J0VA 2OUIA 2CN1A 4N9QA 4AJKA 4AJHA 3LM8A 5K0SA 4LDNA 5L3VA 3CW2A 1YB5A 4OPMA 5M34A 3P4XA 4HQKA 3HBJA 3ZJUA 1E2QA 3AF1A 3LCCA 1AY0A 2EFYA 3O8DA 3V00A 5LP6B 4MICA 2OQRA 3AIKA 3BZWA 3L7IA 1GADO 4EX7A 1VCIA 1Q7BA 4OU4A 3OFNA 3EASA 3WL8A 3BX1A 3JPWA 2OGUA 4RZSA 2OBBA 2B1IA 3EA0A 1XTZA 4X84A 2MCFA 4CJXA 5IT0A 2FFHA 3WTCA 3RRZA 4N47A 1NP6A 1T9DA 3R2JA 4WAUA 3RJTA 3LF1A 2RGYA 4DEXA 3BICA 5FBLB 4ZDKA 1XRLA 4JWTA 4I55B 1SZJG 3EOZA 5EHQA 3KUXA 5FWYB 1FP6A 3HCWA 3OLQA 3R3JA 5JXHA 1DFGA 4FUQA 3NT5A 1DBIA 1USVA 3QPUA 5LJLA 2A9VA 2V59A 2O5RA 2QUBA 2X0KA 5AW2A 4MYSA 3ZYCA 3U0VA 3SJBA 1PV2A 3PA8A 5I9MA 1CQJA 1MVLA 1AGRA 2IL1A 2QU8A 3EGWA 3KPWA 2LTAA 3MRSA 4Y6PA 5F64A 3NFYA 4HWOA 3R3UA 3U81A 4N6GA 2EX4A 1SUFA 5BRNA 3EFOA 3EXFA 3TTTA 3BWXA 2BFEA 2AKAB 1OVMA 1UJ2A 5AI8A 1CXZA 2ZIXB 4R1PA 3T5MA 1K8YB 1Q1QA 3TO5A 3ECCA 3ZUGA 3A04A 5HHTA 3NALA 4A16A 1K27A 1MIOA 4DMRA 1RZRA 1FS4A 3B3QA 3I9JA 4AYTA 5F3DA 4J07A 1EWKA 3ZJ4A 1DQYA 4K03A 3SIWA 4FZRA 2SKCA 1JMVA 2W6JD 3UF0A 1L5KA 5BYKA 1CW2B 1JQBA 2IYLD 2HUNA 4ODIA 3S1LA 2YWDA 3U0BA 1MAHA 1EJ6A 5GM2A 1ZINA 4DMMA 1I1HA 3GLFE 2XLBA 3FOWA 2VF7A 2C9OA 3DCIA 4CKWA 3N70A 5LWHA 2CHFA 5I5GA 4R2HA 1JJ7A 4LTNA 4I3GA 2GCIA 2HM7A 5B12A 1F8XA 3WBKA 4BNDB 3QYFA 5J47A 5CPBA 2DP4E 3EGXA 4ZCRA 3BMNA 4EKGA 4HQLA 4J2OA 4OJYA 1XQWA 2R6JA 1X42A 2VF5X 2YOHA 3FCAA 4B5LA 2L19A 1TMOA 5DNWA 3S2YA 2P9GA 2VQDA 4PCLA 4H77A 3QP9A 5FTWA 5DBEX 1AH2A 2EGUA 3O93A 2IYXA 4LBWA 3BFVA 2OZLB 2SICE 1UC5B 4QULA 2EJCA 1VG1A 1GDDA 4CTJA 1UQTA 4DQKA 1QYRA 4EB6B 3RAJA 1HLDA 4QUBA 4D5EA 5IULC 1JMYA 1PGPA 1X94A 5BWBA 4JXZA 4IV0A 4ND1A 3EGDA 3FLEA 1K7SN 3G5TA 3M7IA 4TT3A 5FKJA 4IDOA 2CNKA 4CQJA 3IKLA 5BQOA 4XZ3A 1JDJA 4UNNA 4OUKX 2PJUA 1AKYA 4HH1A 4PQGA 2N75A 3O4RA 3PE6A 3PFWO 5BRAA 4LC9A 1PR4A 4D9IA 4L73A 4IIJA 3RTBA 5F2NA 5EWMB 2Q5CA 4LMPA 4O33A 3DM5A 4XLTA 5H82A 1UR5A 3U4IA 5LZ5A 2ZWPA 3UHFA 2QPLA 1GPUA 1XTIA 4YUWA 4Q24A 4JFAA 5BWOA 4I46A 1FP1D 2ZBDA 3JRXA 1L7BA 4U8GA 3AJ9A 5DYNA 3H13A 2IDZA 3CEHA 2ENWA 2ZT7A 4FJ0A 5BW5A 2BP7B 3RS5A 1NDHA 1R0XA 3BG5A 3NVAA 5AHXA 4D0SA 1NMSA 1RPTA 1U5CA 4PVCA 1P9WA 5LJIA 1IHOA 4GI2A 1TK9A 3R9IA 3B3AA 4MR8B 3ZLBA 3ETDA 4QTXA 3TW4A 1X8KA 2PZBA 2QG6A 3GZ4A 4IDFA 3TBFA 3W9UA 1LLUA 5TPWA 3WC4A 4OJTA 3E2PA 1P45A 1AHIA 1UMBB 4CEIA 4KPYA 4PX5A 1CRZA 4JP1A 2YHIA 1M1YA 2PGJA 1PAUA 2W6QA 2BW0A 2G1KA 4G4IA 4C9BA 2XGGA 3ZEIA 1CU1A 4L6IA 5KNLA 4LGVA 2G72A 2X4LA 3BXEA 1LTQA 5KBYA 1MJGA 4BO7A 1V11B 1YJ8A 4QBGB 1D1SA 3LV8A 5HEKA 4D8TA 4LFAB 2A1IA 4HLUC 4KH0A 4O8ZA 4CF3A 1RXEA 1KFKB 2J87A 2VDRB 2ONJA 3RIYA 3GLSA 1GR1A 2CV2A 2ECOA 3WGYA 4H7JA 1E1NA 1N2BA 4EG0A 3QOXA 5C5DA 1E2FA 3AHEA 3BZUA 2CJWB 3KQUA 3WAJA 1HE4A 1NOIA 4TRRA 4CF5A 4QG3A 3DLHA 1ZK1A 3IESA 1NBWB 3NAGA 3TNLA 1Q0HA 3Q10A 4MJXA 3U3XA 1CUCA 1LQTA 2WUWE 3V8MA 4DY4A 1FTQA 1DHRA 1K2WA 1MUUA 2W70A 3IAM6 4EKNB 1I6KA 1N2CA 2JAQA 1KKLA 3O73A 2AFIB 5DO9A 5CBKA 3WK8A 5ER6A 2HIHA 1Z2AA 1SG0A 4O29A 1VIVA 3JYNA 1IVSA 4XFKA 5EJ2A 1AKWA 4CMEC 3UBTA 5A0VA 2DYKA 2ZT8A 1E2HA 3BF7A 3ZWCA 2DWPA 4G65A 2VTBB 3IP5A 3QE4A 3LDGA 1EDEA 4KAFA 3WFJA 2OZPA 5ITZB 3LLVA 3MINA 4BKRA 2L42A 2V4UA 2JARA 1PJ4A 4FEAA 1FEZA 5EQJB 4CV1A 1Z4NA 1G5TA 5EERA 4U63A 1JG7A 1XMSA 2CVQA 3CF6R 4IYJA 2QG4A 4E3ZA 4JS0A 2XZOA 3OKCA 4LXYA 1Y8CA 4CT5A 4FOSA 1U7TA 3U4QB 2BFFA 1TAHA 1QIJA 1F17A 4ZCPA 2JIRA 5FLYA 1YCDA 5I8PA 2I6XA 5DI3A 2C9CA 4FMPA 3E1KA 5HF5A 5JFOA 3TGLA 3KJFA 4NVRA 3D7KA 3GEMA 1UKYA 3WWYA 4D4HA 5K7SA 2FSGA 2JLWA 4YMWA 5DE3A 1EWTA 2R25B 1W0CA 3TLGA 5CGQB 3GGJA 3ZQJA 1H3EA 1VHWA 4DJEC 5A3JA 2HJSA 2PZLA 2AOWA 3HHPA 3PQDA 4B80A 4BMPB 5A9RA 3EXIB 3INYA 3OIWA 4JOQA 5CNJA 5AVOA 2XGMA 2WEKA 5FTMA 2DT8A 1Y5LA 1Y7LA 1LPMA 2GFHA 5EA2A 2P2YA 3C6XA 2BGTA 1E3WB 4H1WA 4FSXA 1C7RA 4KXNA 3GQBB 4JL8A 2VXYA 1Y9AA 1Z3CA 4IGFA 3RS2A 2WJAA 4QELA 4PYKA 1F60A 4GD3Q 1GV1A 3S8EA 2ZQ5A 5G3YA 1FF9A 4JY7A 4RJKA 4Z53A 1JB1A 2DCMA 5H83A 4RH0A 5AXBA 2GWRA 1FFEA 4L9AA 4OD0A 4Y18A 1N6LA 1ZH0A 3OQVA 4OHBA 2R87A 3H1EA 4QRDA 1TKBA 3F74A 3DZHA 3S1AA 5AVUA 4PWZA 1EDZA 3UCEA 1JQ5A 1Y4DE 2C0PA 2IHZA 4DNQA 3DHEA 1QBGA 4HEQA 3UKDA 1M5RA 4V03A 5JQGA 1JHAA 2GVDC 3TVTA 3W34A 2VP3A 4F0JA 1BHO1 1RVDA 2ABWA 4JJZA 4B3CA 2O3QA 1L8QA 3CEAA 3NG1A 4Y1EA 3SS7X 3LMKA 4XOUA 1T8TA 2B0CA 2QT1A 3N0WA 3AU8A 3OY7A 4RDCA 2IZ6A 5KOIA 4BCBA 1RJGA 2OV2A 1E94E 2Z1MA 1YJAA 4IMPA 1IXRC 4L4XA 3Q7IA 1M6VA 1W87A 3H1BA 3ILSA 4TMKA 2QKYA 3MIZA 4KGZA 4L4RA 1AXEA 1TLLA 2G28A 4ZO8A 3ETNA 3IGFA 2ZW9A 2EX0A 1WOYA 2X13A 3EF0A 3IOEA 4DLXA 2FDCA 3ILHA 4MVJE 1CP3A 3SZRA 1GSOA 2GKGA 2PH5A 3N39C 4JL6A 2XQIA 2XUQA 1JFFB 3Q7QA 1F7VA 2WG0A 1I1OA 4U00A 3TRDA 1T29A 4EJ6A 2KMLA 1Q0PA 3PVSA 1JQLB 5BMVB 1Q0TA 4AULA 3TLEA 4UARA 2HA0A 3FBGA 2EFGA 1LRKA 1IDOA 5JS6A 3KOXA 2V9PA 4BMCA 1YC5A 3OJ0A 4KX5A 3I83A 4TRJA 1ZXLA 4U2CA 5EUCA 4ENTA 1T15A 4MQEA 1B1AA 1ZD2P 5C32A 5HS6A 2A9FA 4IIGA 3JQFA 3MELA 3OSZA 2PL3A 2BJHA 4JENA 4OU5A 3ZY6A 1PZFA 4ND2A 4AKHA 3VZDA 1CUVA 4U9HS 3HSKA 1X74A 4GOJA 5ILQA 3WMRA 2F59A 4F84A 2ZYVX 3NWPA 4MVJD 3QOFA 3CF2A 1TQ6A 4GW3A 1PJ8A 2Y3IA 1XB2A 1HC7A 2J5RA 1R5OA 1U0FA 3CKMA 3OA2A 1T6YA 2GBFA 4DMHA 1CPYA 4RY9A 1RJ9B 1KSGA 1R9MA 2NV0A 2W5UA 3AFMA 3LQ1A 3LSTA 3HBNA 3IILA 4E2WA 3SYLA 2QN8A 4EG8A 4DWVA 4GSYA 3DQPA 4OG2A 2LD4A 3X1YA 1VBNA 2GRUA 3WYFA 2Q5IA 1HZZC 1QGUA 1HEYA 3EMKA 4X24A 2IUEA 2GRAA 1L6RA 4UW9A 4IIJF 1JEQA 3WRWA 1CG6A 5D5PA 3W04A 4B0PA 4WIAA 2JL1A 4E5KA 4XVHA 1AHNA 4DV5B 4A0FA 1FLVA 4E5DA 2Q1YA 2VQ6A 3K09C 3W6OA 2C04A 4ARZA 1M0SA 1L5QA 2P65A 4NI5A 4DZTA 4UHFA 3G1WA 1VYTA 2PWBA 2G07A 1E63A 3RADC 1KDZA 5C0OE 4S1PA 4H59A 4DSNA 4ZZ3A 5AD1A 4M0PA 4KGVA 1SXGA 2WK1A 1YHZA 3HXKA 1A9QA 4OBBA 4US0R 2I3BA 4L4SA 2W6CX 3K2BA 3MSCA 4MVJF 3IMKA 3X1ZA 5L4NA 4KGDA 4M1MA 4DTIA 5GONB 1GWNA 2QN7A 2YN4A 3D5QA 4AU1A 1ZJWA 1CEXA 1T34A 1YJCA 2QI9C 5F2KA 3ID6C 1RE1A 4QREA 2ZATA 5JCOC 1LW7A 1NBIA 2RHJA 1SIWA 2XV1A 1B8NA 5KTSA 1U90A 1Y63A 3HXTA 1KFCB 4D96A 3KHSA 4BMOB 4O2BF 2GEKA 2Q8QA 4NYIR 4OHCA 3ZZUA 2R8XA 1R9GA 1V1MA 3DNPA 3R7DA 2EBWA 2EG9A 2EBHX 2V7EA 2J3LA 2VPWA 1GRNA 3VVMA 2FZGA 1RCTE 1XHEA 2W2PA 3BIFA 4Z9BA 2QM3A 4QPNA 4M21A 4PF1A 4B81A 4U0JA 3ZH2A 3WGVA 3GLHB 3BMXA 3CUVA 4CEJB 1T5TA 2O05A 3GU3A 4QGSA 1T3SA 3RBVA 2VATA 5I9TA 3K30A 3OFJA 4AIRA 5CD9A 1K2VN 1J2TA 1MBZA 1WXIA 3ACCA 2JJMA 1Z25A 1RC1A 1SG6A 4JELA 3I9OA 1FYDA 4TS3A 3PTAA 1KI8A 3KAPA 1RLTA 1GCUA 3CF4G 4A0SA 5A0TA 1U7DA 3HADA 4OYRA 5G02A 3CR3C 2W8BB 3RBAA 1U8UA 2ODWA 3RKSA 1J8YF 1JFLA 2IIPA 4TV8B 1KBOA 1IHDA 4LMAA 2OBXA 2W93A 1B23P 5AWFC 5B1EA 2OUKA 4ACBA 1OASA 4QTUB 2Z8ZA 3UV3A 3ZLTA 1NXVA 3D8RA 3PEWA 1F0YA 2G67A 3QI7A 2BMAA 1DTWB 3H1TA 2H11A 3D31A 3LUAA 4OJQA 2EQ5A 3WGQA 2PKEA 5CFMA 2BC9A 3O03A 3V42A 4Q0MA 3RS8A 4TMTA 4ZANA 2XUPA 2VP2A 4C1NA 3U16A 1QLJA 2TMKA 4MWOA 2ZUCA 1NNLA 4AROA 1D8AA 1QIIA 1Z8NA 2GHRA 4H4EA 3ZVLA 4DBVO 3LQ2A 4ABTA 4U7HA 4A15A 2PZFA 1BQ4A 1XD8A 3E7DA 3UZUA 4KWEA 4QWMA 4O4HF 5DHPA 2WVJA 1K6EA 2C0CA 1XZGA 2RJNA 2YV4A 1P8JA 1RCUA 1TPYA 2FLVA 2E18A 4JLKA 4AW9A 3A7EA 2JA1A 1D2CA 2IEGA 4RIHA 3ZVMA 3DT8A 1PEKE 1Y33E 1MC5A 3G49A 1JG6A 1KOJA 1RQNA 1MOPA 2QMUA 4G9BA 3I92A 4H6VA 1B42A 2CVHA 4LS3A 4JI0B 1JHMA 4NYMQ 3UJDA 3S5JA 4FFDA 1XZJA 5KWEA 2E4YA 1GILA 3COYA 3KB8A 3M4ZA 4ZCTA 2XVYA 5ALVA 5LQDA 1Y7TA 4AVYA 5H02A 2DTEA 2WJIA 4NMLA 4RK6A 5KC9A 2C29D 5T41A 3K5HA 1HURA 4FJ1A 3TDKA 1II8A 3GJYA 4YQZA 3G8AA 3ESZA 1N9GB 3LUHA 2PGOA 4RSGA 4R0MA 2W0MA 3ORQA 4DLKA 4JYMA 3C5VA 1TVMA 2V5AA 3GCGA 4GVPA 5AICA 2OA0A 5JQGF 3FUUA 4FEEA 4FHFA 2PBLA 4Q3NA 4UHCA 1UBHS 3MWGA 5F7OA 5JRJA 2BGKA 3RF6A 3T3PB 1PG5A 4FS3A 4TTJA 3I09A 1XQVA 2P4EA 4CKCA 1P2BA 1YR8A 3WBBA 2O8FA 5JNSA 4M37A 3IHKA 3OKAA 4X7BA 1CJKC 3PVCA 1EYZA 3WLSA 3FJYA 4QBIA 5JLAA 2Z2XA 2C5BA 3HFJA 4OVKA 2NXWA 4UMFA 3WGGA 5ILGA 5ADWA 2PFGA 2DPLA 3C6QA 3QVTA 4JBGA 4UM7A 1N33B 3F47A 4ZT3A 4QATA 1U81A 3ER9A 2VAPA 3TNJA 4AX8A 3JQ7A 1PIWA 3JYOA 2QI9F 4INOA 4BLPA 2J7PA 1UBCA 2AXQA 2PUJA 3G02A 4UEQA 5D86A 1PG2A 1UDWA 2GZ3A 4UBLA 5CM2Z 5FPYA 3OZEA 2WFMA 3Q15C 3U09A 1N78A 2HHJA 5KVCA 1L8AA 2PYDA 4UTOA 4U9IS 2BY4A 2JIZD 4U3JB 3W1VA 4YREA 3G0DA 4DG5A 5HIKA 3AB3A 2D5LA 4A03A 1W52X 4I4IA 1XFDA 1ZIDA 2AK3A 2WUFA 3ADPA 4JCCA 3T38A 1W76A 4EG1A 5HFJA 3OX4A 3W3AH 1ANKA 4ZYXA 2PRJA 1S2GA 4K9KA 1E7WA 2IOYA 1GQRA 1LJUA 5IZCC 2FJPA 3AUYA 3OPYI 2XNSA 3UNXA 2AOUA 4NP6A 1M1NA 3AEKB 4CMBA 1Z6AA 2RMKA 3K2QA 1LBEA 3C3JA 2CV0A 4CG0A 1LC0A 4DR1B 4HJRA 1INLA 2AKYA 3AP3A 3ESQA 2YJNA 4IDGA 4MGZR 3S55A 4G89A 4HWKA 1DJPA 3M82A 3OCCA 4BX9A 4ZVOA 1L5YA 1P7PA 2JAUA 3IBTA 4HDMB 5JAHA 2VUHB 3DWEX 3R7FA 3ZY4A 1DDIA 3PXDA 4IX1A 3ZE7A 1A0OA 4WNAB 2J67A 2C4UA 2BTEA 1G291 5FUMA 1CUFA 4AIIA 3C6KA 3WSTA 1HYHA 1H22A 1O5IA 3BL6A 4WI1A 1AS2A 3S29A 4S05A 1TEZA 2QU7A 3DDOA 4QA9A 3WGIA 2G88A 2ZAMA 2ZS9A 5EE3A 5DTMA 3I12A 5AVXA 3MCTA 1OT3A 3O8LA 5JEDA 4P4LA 4MROA 1M2VB 1PLJA 4AK9A 4WBNA 4ZO4A 1MT0A 2QL9A 3ZZNA 5ERGB 5MN5A 3EXHC 3EISA 4CQLA 2YWFA 3FPEA 4DMFA 1Z0KA 1OA0A 2WP0A 3D7RA 5EY5B 4Z51A 3IJRA 5FNVA 2JGJA 1H6BA 2AEEA 2Q7OE 4BZQA 4RVGA 4ZU3A 4IQ0A 3CLHA 4RTRA 4QXRA 4FR0A 2V97A 5EJGA 1KU0A 2RH4A 4G4JA 4XFJA 1G0NA 3EMVA 5IS2A 5F7ZA 3LL7A 3HC7A 3B6EA 3L41A 1KP9A 4NYJQ 1UAGA 3GDGA 3KXPA 5EWJB 3R5XA 4BFTA 5DXAA 3HV0A 5K3DA 3KVOA 1IG3A 1MZVA 2I1VB 1NE7A 2I6UA 2Y93A 3GJQA 5FHQA 3W90A 3P71T 5BNFA 3SQNA 3VYTB 2NLOA 4DKXA 4I4CA 1VPTA 4LI3X 4ZC1A 3TH5A 4HDAA 2JVKA 3W1WA 1GGHA 3IQZA 5DBFA 4BYGA 3BJEA 3P2KA 1EXMA 4EP1A 1AQJA 4C0KA 4AQ7A 3FLMA 2I7TA 5AVJA 2Y0PA 1SBIA 1T1JA 5CBPB 3GUCA 4GOOD 3TM5A 2Q8PA 3OEWA 1SHLA 3CRQA 3E70C 4DQLA 1XCBA 3VVBA 4H18A 3RAFC 2GERA 2Y9MB 2G9VA 2VK8A 3A1DA 4PRLA 4GL2A 4KQIA 2NUAB 3TRKA 4DCGA 3V1TC 1H0SA 3AP1A 1DG9A 4YS6A 2VKTA 4MB0A 1G3MA 1W4LA 1EEHA 2ZWAA 4RK5A 1X7ZB 2XVZA 2XZPA 2YFQA 3LDAA 2ZUUA 5HMMA 5JAIA 4R8RA 3TFQA 2EU8A 3T3OA 2JANA 4RUKA 3KKQA 2OXTA 2DJIA 3TKAA 3Q8MA 4MUEA 3AM3A 3HP4A 4J6FA 3B3FA 1WKBA 1QH1B 4DCUA 3U4HA 3IO5A 5ILOA 1GHTA 2Q5QA 5EUMA 5IKOA 4G8BA 4RNCA 4IY1A 1HNNA 4L9SA 3RSLA 3EIWA 3A2LA 4UVEA 1EVJA 5C31A 5CG1A 4MUIA 3D8TA 4B82A 1XVLA 4CIVA 2HQ1A 4IEIA 2ZQYA 4HBGA 4OA5A 5KU1A 4E15A 1DWUA 2DHQA 1TX4B 4I2NA 3HPRA 3ONNA 4G8CA 5E2AA 2YWHA 5JJ5A 2XYRA 1YK0A 5K05A 1COWD 3IB6A 4I9UA 4P4UA 3W05A 1DBQA 2X0IA 3ZKWB 4S1WA 3FNEA 1FQJA 1X1SA 4H7KA 1YDWA 2H2FA 3E9YA 2BFNA 1YASA 1I1QB 1TGVA 3GA0A 4GQIA 4ZDWA 1E1LA 4RIEA 4MYRA 4IICA 1Z7BA 2RGAA 1U1FA 4O2AB 5T7BA 1KHHA 1AVTA 4GUAA 1J7JA 3AJDA 1NW4A 4CF7A 4XWGA 3OE4A 3M0EA 4YCNA 5AM2A 1RXSA 1X1DA 3PI7A 3G23A 4CQMA 2Q6IA 2OGZA 2CMKA 3SF8B 1NW7A 3A6ZA 3VR5D 2YICA 1JNXX 2N3ZA 4PSDA 2FPIB 3PFCA 1LK0A 4QECA 2IYPA 2XUOA 2YHAA 3K9BA 3V2IA 2QROA 3UUGA 4ZC8A 2OAGA 5I51A 1BWSA 1L7DA 1DE0A 4PEVA 3PPWA 3JQBC 1FMLA 5K09A 1WBDA 2LXNA 1NP7A 2QYSA 3LXXA 4MLDA 5KI6A 5A04A 4E07A 2BPOA 3I58A 5CP8A 3E18A 1LVHA 2DPGA 2Q4TA 3UHPA 5KYNA 1ODTC 1RADA 2C1ZA 3JQ6A 3FWYA 5L4SA 4P92A 3EE6A 3DULA 3KQPA 3USES 1IPFA 3B5EA 1EB9A 1KIMA 1ICIA 2EKBA 2WJGA 3DMPA 3QUQA 2ZJ6A 3RU7A 1XPUA 4H3VA 1GZ5A 4RKEA 2DY0A 2X4IA 3NIWA 1C3VA 1J1ZA 2L2QA 2YOFA 3CLKA 3CY6A 4QDXA 1ZSNA 4C4PA 3GRPA 1OX4B 1FUKA 4NOMA 2ECQA 5T5QA 2J45A 4KTTE 4QPDA 1Z2OX 1I36A 2NNWB 3FNGA 3ICWA 2Q6OA 1CE8B 3ZNNA 5EJEA 3U7QB 2EP5A 4P3XA 4TOIA 3FH0A 1Z4LA 1RYZA 5J2TF 3UIEA 1NUSA 5KX5A 2Q4RA 2SNIE 1PV4A 2PRZA 1HQCA 4L07A 1X7GA 4XB2A 4YR9A 4HDNB 3LWBA 2QXTA 4XYGA 3NUZA 5A05A 1KMHA 3LGXA 5KAPA 5BR7A 3LPNA 2WD7A 1O5OA 5CYPA 4BQPA 1WP4A 3TB6A 3T5PA 2I29A 2C82A 2DQSA 2HN9A 3T9EA 3WNBA 1YQWA 1SM4A 1GNPA 2WUGA 5JMOA 1JDTA 1EE9A 2BSXA 1YS2X 2IA5A 2JH9A 1ST2A 4QDOA 1IBKB 3QSGA 3ZH9B 4Z4HA 1QH0A 1TM5E 4PSCA 1EINA 1CNMA 2X23A 1O9HA 2V58A 4WDQA 3L2OB 2BJVA 4I3FA 1GTL1 2BT4A 4I1UA 5JD4A 3RT7A 4GX0A 2PKWA 2REXB 2GPTA 3DBHA 4GWLA 3ZIAA 1TZ2A 3N2GB 4JBXA 4K6OA 4ER6A 5IT4A 1QHHB 2FVXA 2J32A 3NBKA 3BHNA 4GQAA 4F2WA 3Q3JB 5ALJA 4EPXA 3JD1A 4G5RA 2RIRA 4ENUA 4R9RA 2ZIGA 2IPXA 1T4CB 1GG9A 2QMHA 3E8MA 2EHDA 1DZIA 1RZ3A 4TMWA 3NBQA 3S7ZA 3A6FA 4C2UA 2YVAA 3ZXUB 1GL7A 1MA3A 1FXUA 4L78A 1SXPA 4I81A 5K6AA 4BOYA 3WKBA 2REQB 1T6XA 4EY7A 3KJEA 1QYDA 1F0KA 3R24A 5FB3A 1KO7A 3PQEA 2WR8A 3KX2A 4PIPA 1WDWB 2WOOA 4HQ6A 2CDBA 1UOQA 2UUAB 3R7WB 4D2IA 5KNDD 4ZTBA 1V1RB 5IPFA 4BQEA 1IPEA 1YE3A 4Q4AB 3CFYA 3M4YA 3EPKA 3PD7A 4GSKA 2WM8A 3JARB 1BDJA 4D46A 3F5SA 3FOBA 4RM3A 3OIGA 5I8WA 4HGNA 1OFUA 5TGZA 1PZXA 2FXVA 3A28A 2I7CA 2MOKA 4WGFA 1F2DA 3HXPA 4BBAA 3COZA 3AJAA 3U2QA 4TYYA 3O0TA 3BT7A 2E2WA 1MH1A 3FSRA 4EZIA 2F1IA 3V8NA 1N6NA 3A06A 3JYHA 4F2PA 1B43A 4JSTA 4MV3A 1ZK3A 2DUUA 5JDIA 1HH4A 1MJ5A 2F4VB 3CRMA 3BH7A 4KPUA 4HNTA 3RFFA 1A9TA 4NJMB 1WV1A 1IDN1 4RIIA 5L3ZA 4LRUA 5LMCA 4GKKB 1WCXA 1SU7A 4ER5A 3UAYA 1QHEA 1QM5A 1V95A 2FK8A 2ZCVA 3K8ZA 1Q3KA 4KR9A 4NABA 2H0RA 4UU0A 4WK2B 5GGYA 1IXZA 3RFTA 1UBMS 2ECKA 3SYKA 5EL0A 2HD4A 4C78A 4TL7A 1C3JA 3B7WA 3LX6A 3A27A 3VV3A 5C37A 1JEYA 1DWOA 1SQGA 4ZDIA 1X7WA 1CK4A 3ZZ1A 2ZSIA 4KB5A 1S9DA 2I8LA 3LO5A 1TMGE 1N9KA 3AI1A 3C39A 3BMCA 3MMSA 5HILA 4JMLA 2NO0A 4AO8A 1Y98A 2ZLBA 2H6EA 4Y1GA 3WLNA 4EFNA 1YNOA 1XD9A 1CQWA 2CB0A 2E9SA 3QELA 4TRMA 5JNWA 5KYGA 5DN6A 3R7NA 2WSYB 1SCDA 4KQKA 2WLSA 2R6ZA 3WWZA 4R69A 4YGXB 4B4OA 3ZDAA 4WA7A 3UT0A 5HVNA 4Q1BA 3KYBA 2I2XB 2XUKA 3KLMX 1L4EA 4PGFA 3UJPA 3RANA 5BVGA 5JAPA 5IKXA 4C7BA 2DKNA 2I2BA 1LS1A 4LHYA 3BQMB 3HFRA 5AI9A 1UK7A 1E7YA 3GN2A 5EIAA 5A2QA 4OHZA 3JYPA 1I5EA 4V3BA 5IDXA 1MO4A 2ZYGA 5IF3A 3T4UA 4DE5A 1P3JA 2EYQA 1X2EA 4ZVMA 3EJWA 3RAPR 3QLVA 1NAHA 2CJPA 4BMXA 2WPNA 4KNVA 4ZKEA 4BFWA 4JIGA 1JSZA 4LJ5A 1TU3A 1QRDA 2XKBA 1DLJA 2VDQB 2ZJ7A 1OIVA 1W2HA 4ZREA 3F5MA 2D6FA 1CDOA 3EMDA 4A2QA 3W6NA 1NUUA 1C7QA 1PR9A 1ULBA 4XWYA 4YECA 3RTAA 3T4EA 4CM8A 3JALA 4EEZA 4TYWA 1E1MA 1GZSA 1ZJ4A 1G66A 3JASB 1SBZA 4LY9A 2E49A 1SHTX 3NYRA 4I0WB 2YWRA 4MAAA 3WE7A 5HZGA 1U2TA 5JSKA 3ZWKA 5LZ4A 4CKYA 3SXUB 4X65B 2AK2A 3VV2A 1CETA 3FF1A 1GRVA 3W4IA 3SSMA 3EQZA 1IXKA 3FPBA 2AGVA 3P94A 1JU4A 3O8NA 3CYFA 4WXPA 2BF7A 1BH2A 3OUUA 1PD0A 4CMIB 3HKCA 2PT9A 4AWBA 1R10A 1U2DC 4PAOA 4BUZA 1QIKA 5KVQA 4MS1A 5AW3A 2YXEA 1M7GA 1XRQA 1GKYA 3I6BA 4R1QA 2W42A 2ZAOA 1E3MA 3OUZA 4QICA 3V1UA 2WT8A 3OZTA 1J1UA 4DQVA 4RKQA 1BE6A 3I04M 1E6EA 2C7BA 1D6SA 2HJRA 3D6AA 1AN0A 3QTLA 5DV9A 5JVDB 4X1YA 1L7QA 1CUXA 2ZE8A 4BNJA 1V1JA 4DLAA 3W5HA 2G0NA 4NULA 3ZIAD 3A6EA 1HGXA 3K15A 5E6RB 3PXUA 2QD3A 5A71A 3EIEA 3P96A 4M8NE 4PQYA 4KO2S 4XD7D 1BVHA 3PQ7A 4ARSA 3Q7SA 3DTTA 4OHXA 4S3MA 4YRZA 3MQFA 5IZ4A 3B13B 4ZT4A 3ZIUA 4QU8A 3GQVA 3OX3A 5DM4A 2XWSA 1OWOA 3KTFA 2DFLA 3G5LA 2UVDA 4LJ9A 4UOEA 2FI1A 2CK3A 5DGIA 5FBZA 3MHPA 4DLZA 4LF5B 2UAGA 3ED5A 3QK7A 3QXGA 4FFWA 4LJ8A 1NDUA 3TNYA 4DLSA 2QRVA 1IC6A 3B7PA 5C8YA 3ZNOA 2WZQA 3K0SA 3GNQA 3M9WA 1RIIA 4RNDB 4KITB 5JQWA 4K46A 2GJ8A 1LTKA 1PNOA 1SULA 2A6PA 2J9XB 1AXGA 2QSYA 1TQHA 1X1BA 4LKRA 4MV0A 5K3CA 1YJXA 4CKEA 1I3NA 5CAEB 3RS4A 3UC5A 1YE8A 4D9HA 5P21A 1Z4PX 2W2XA 3VTFA 3QY0A 1RXVA 5JY6A 2AJLI 4KJXA 1C0LA 1UJ5A 2D54A 2Q6VA 3EPPA 3LLMA 4C14A 5JY1A 4JBNA 1KI4A 1SO8A 4FZ3A 2ZUTA 4ENSA 3F90A 3RWBA 4BVJA 2EG5A 2J3MA 2ZJ0A 4L3WA 1OJ7A 2R5NA 3MT0A 4QUAA 3KQYA 5BWNA 1CUUA 1FU8A 1XLUA 5ICMA 3IP6A 2LWIA 1CLEA 5BW4A 1P6XA 1L4HA 1YZUA 3KZVA 1NBOA 2XXJA 1EGAA 3HPQA 3PC3A 1N8NA 1NRJB 1QAOA 2D1SA 2JBAA 4ONEA 3BGSA 3EWAA 4OOFA 5D7NA 5DLDA 3WKCA 2DFTA 2WJZB 3AYXB 4P80A 4JR2A 1ZD3A 2NW6A 1QJ4A 4U1RA 1B6RA 5LXTB 1T4DA 2ZSDA 4YASA 3D2AA 2YJ4A 3MJRA 2CD9A 4RFSA 4RPKA 4F56A 3DKVA 4KXXA 4LVNA 3VKFA 4LEIA 2H2IA 2X8JB 1QTNA 3FYUC 3F1KA 4KXMA 5H3HA 1JMKC 1R64A 4XUCA 4O0LA 4ZVNA 1GDHA 2AF4C 3VHXB 4OK3A 1XMVA 3KLNA 4GNRA 3UO8B 1LBHA 1NLMA 1I3OA 2Y1KA 2J4DA 2ZVQX 4X0EA 3QI2A 1CDEA 1ZBQA 3BORA 1AGYA 1OH6A 4DDVA 1W46A 2XQFA 2I9PA 4R3UC 3WQRA 4DRXB 1R5NA 3AILA 1ZY2A 1BN7A 5BN4A 3LC7O 4EJSC 1OA1A 5ALOA 4KWIA 4YO8A 1AG9A 2HXGA 2XRMA 4KK4A 1A8IA 4I5IA 1C7ZA 5HYVA 1Z06A 1XRPA 1NC3A 3CURA 1P73A 1NATA 2FNAA 1R6BX 1ZRMA 5KTNA 5JDCC 4NZYA 1DAHA 1RWXA 4ND8A 3L0YA 3W8DA 3IXLA 1ZI9A 4CM9D 4ASUD 3KQKA 3RUDA 1P75A 5BNZA 4MWGA 1KZ7B 1WD5A 2NAPA 2WKQA 4UE3S 4ZALA 3E22B 4TXLA 4D3SA 1UCFA 1T2CA 3ULKA 1CF9A 4RTJA 3QIVA 4G0YA 1ZONA 2KB0A 4EMSA 4K6CA 4MZXA 5DM2A 2JVJA 3C8UA 5T4EA 1BXKA 1T8YA 2RC5A 4ZOQI 3DKRA 5TPZA 3BGOS 3QA9A 5C1DA 1N7JA 3ZR4B 2O8VA 2LVBA 2W0SA 2ZPAA 4DJDC 1SXJB 4YP1A 1RBQA 4KHPB 1TECE 1GCGA 2VC2B 2J0UB 2MSDB 3N53A 5KWIA 1GNTA 1Z8HA 2E4UA 2O2IA 5DP2A 4ZV9A 5E1DA 3TDNA 1NASA 1IJEA 5BQXA 4ALNA 2PV0A 4DEYA 3G0HA 4PBRA 2V7TA 3U4CA 3QJYA 1C9MA 4US2R 4F5WA 3VKHA 1H2HA 5EIFA 3HV2A 5U1PA 1A9ZA 2CNDA 2P2SA 1VJDA 1N5MA 1W93A 1FU4A 2GK4A 4KR0A 4U5XA 1XVUA 3A1FA 4UCFA 3KVVA 1GLVA 2YV2A 2PMEA 3I8SA 4RS3A 4N65A 4PO9A 1Y34E 2PGNA 1O95C 3HCNA 1SKYE 4P7JA 1Q1ZA 1T1RA 3CH6A 1Z26A 1MB3A 1DMRA 4DSZA 4EMUA 3FPLA 4BFVA 2JG3A 1DBVO 1VFPA 4N3AA 2RGXA 2OOSA 1QF7A 1IHUA 1J90A 2ONCA 2QB5A 3C97A 3VHRA 4DT1A 1NLFA 1PYGA 4HJXA 4YDSA 3W2TA 1RWBA 1KY2A 2WZCA 1G6KA 4TQAA 4E1BA 1U2QA 4I66A 5C3MA 1MRSA 3HWRA 3JRWA 4AS2A 5KHAA 4GP9A 5JALA 5GZ1A 3DWIA 1ZGCA 4MB6A 3CF0A 1WXHA 2VBGA 3LS2A 3UMSA 3C2QA 4LRSB 4OQEA 3PNVA 5DLQC 5TX7A 1TCUA 4GU5A 4IJMA 3D4BA 5AK4A 1O54A 2FOXA 3C3MA 4FGJA 5SYAA 1NJ8A 2OOKA 3C3XA 2CDNA 1NBHA 4ID3A 5K99A 1W1UA 5JNTA 4QD3A 2CK3D 3BERA 3LAWA 2E89A 4RL4A 1SCIA 2VDOB 4D8UA 1DWPA 4Q39A 2YHUA 2Z3ZA 2ZWVA 1GITA 3T0FA 4CW7A 1JEJA 2IEBA 1TYCA 3DZGA 5DBOA 2XJ9A 2Z2JA 5CTAA 4RAQA 5FJJA 1RIFA 4NXMB 3M3HA 3HU2A 3THOA 2MSCB 5C35A 2AZ4A 3AR7A 1B3BA 4B8ZA 3GFQA 3HY3A 1ZX1A 3QU7A 2YV5A 1ODKA 1KGSA 3QF4B 4RHYA 2BUBA 2NPOA 2C57A 3IPAA 3TQSA 5A4MS 3K9LA 4FFBB 3RVPA 3RRFA 2WYHA 1JXMA 1SC4A 1CNFA 1LDYA 3GI1A 2V7UA 3ESYA 5DGHA 4NFYA 3HMQA 1NBAA 1YUNA 2XOXA 2GD0A 3O92A 2AN5A 2O0MA 2P0EA 3PT5A 3BAZA 1FJXA 2O2HA 3BWMA 3MWFA 4DIKA 1HG0A 1PFWA 1WCIB 5LP6C 3B1VA 2MYNA 4RDXA 2UU9B 2WAOA 1UEXC 1JYEA 1BQ3A 2IHTA 7MDHA 3PD0A 3SHFA 1DO0A 3C3DA 4JI3B 2ZCUA 1QZXA 3II6X 4KAJA 4EOGA 1WWKA 4K6FA 4L5BA 3UB2A 2VA8A 4QHYA 1PCXA 2FN3A 5LB4A 3T35A 1E1CB 1ODLA 4CU5A 1O95D 4DZZA 1N32B 2VNKA 2OCBA 2OAEA 4C06A 3AF4A 3JAKA 4BYMA 1H0KA 3R3ZA 1QYCA 2GO1A 4WVFA 5GJCA 2Q49A 3HZRA 1I3MA 1VSUA 4NV0A 4D9FA 2QRKA 5AOAA 3OQIB 4FEYA 1NUQA 5GTDA 1GZ4A 1EBUA 4K81B 5GIOE 2O2DA 3K20A 1M2FA 1Z68A 3NNSA 4GT1A 4MNTA 4LFCB 3ZY2A 4EO4A 1D5WA 3RC2A 3MTGA 2JCVA 4KKVA 4UCQA 2P40A 2ILVA 3QQ5A 1Y1LA 4PSKA 1YZ3A 4MRPA 4B3BA 1DNPA 1AS3A 3JQGA 4ZQEA 1KDTA 4TQ9A 3TLCA 2RGWA 3BD7A 1X86B 3RIGA 2XXAA 2NYRA 4DSTA 2AN1A 3CX6A 4OFXA 1TJ4A 3W3ZB 1U0JA 4MVJI 1YTLA 2C8JA 4TXHA 3H2IA 3FCXA 4U7TB 5JEEA 2WIFA 2A1TS 2C7GA 2WJ6A 4U9UA 5EAIA 2XVMA 3N6XA 5DWVA 5JC1A 1VJTA 1UMCB 1IQUA 3CX7A 3L0CA 2OFWA 4HH0A 4Z9XA 2EJUA 3RVNA 1YDMA 1FVXA 4NBKA 5THKA 4EF5A 4HRVA 1E60A 3OAAA 1VFNA 4YWJA 2ZIVB 4UCWA 1T2FA 1VGVA 2M2IA 3BHIA 1QQBA 1N3BA 4BPBA 1TTQB 1YONA 2JFFA 3C5EA 2IV3A 2C54A 4YIKA 1UXKA 2GD2A 1D0IA 3LX5A 1E3LA 5L45A 4INPA 1EUCA 2FV8A 1RHUA 2BL4A 3HDHA 2AQ8A 3Q9LA 4HL6A 1G9SA 3HXMA 2PNFA 1AZTA 3H5VA 3W3AA 1XZHA 3BWDD 1N5JA 3PUZA 4EJMA 4ITUA 3B70A 2Z1DA 2P9YA 3DL7A 1Q21A 1GUZA 1ZJ5A 3A3NA 2FW8A 2DBVO 2IE8A 2IY7A 3TR6A 1G20B 3CZQA 5A3SA 1Z5OA 3ZHBA 1GFWA 2C8LA 1P61B 2FWIA 5KWVA 4KUEA 1BQEA 2AOTA 4D4IA 2ZI4A 4ETIA 1EFKA 1JTVA 1XTVA 4QPCA 4B7CA 1ODSA 3C3WA 4D81A 2UDPA 4JAVC 4Q18A 4YCJA 5TMEA 2IXEA 2ON6A 2WT9A 3JVIA 3LGAA 2ZAIA 1B16A 2IYAA 7MHTA 1YZFA 1CTQA 3CJQA 3B3GA 4HB4A 1D6NA 4AKSA 3U4MA 2VRCA 2P67A 4FNMA 3W2FA 2P77A 3BH6A 3CN9A 4P4NA 4ZD6A 4RF2A 1TM1E 1L5ZA 1QE3A 2BGIA 2RAUA 3R1IA 3TDMA 4WBXC 1RM3A 1Z38A 4PM4A 2WPDA 3G9UA 3QBVA 4BBJA 3G2LA 5BMOA 2DQ4A 2H5IA 5SZKB 1LI7A 2FTKE 4CM5A 4FW9A 1EVKA 2BZGA 1FSZA 2HRRA 3MBOA 4GG1A 4PYIA 3OZIA 4UUQA 4LIPD 3J7AC 4FBGA 4N12A 1N8KA 1PS0A 3GMDA 3BWYA 4G1VA 1LEHA 2LBPA 4LHXA 2IS6A 4M0CA 1PL7A 3R75A 5I3CA 4LUCA 3K1JA 1E5LA 2BISA 4UDNA 1ZIPA 4HN2A 3RH0A 2DPHA 1ZM7A 1SBQA 5ALGA 1IIRA 5AW5A 3K9WA 2CJFA 1PW7A 1Q0QA 3GH1A 4YROA 4EIWA 1KC3A 4FDVA 3MUFA 2R0QC 1M0WA 1UKCA 2QW0X 5I8ZA 3U49A 1K08A 4YXFA 3BE8A 3DE6X 4NPCA 4JQYA 4P84A 1EG7A 1WMAA 2XX3A 1XU4A 5KU7A 4KYTA 1PGOA 2WHYA 2PUGA 5DU2A 4TTTS 3W5IA 5IWCA 2O2XA 4N8SA 1NXQA 4TZKA 3OTQA 1DO8A 3OD5A 2QTRA 4OFBA 4X61A 3T9DA 3U39A 5CA0F 1QORA 4MR9A 2EOAA 4P58A 1PZMA 1TZBA 3WISA 4BO2A 3F8WA 5LQSA 3TBKA 2WIAA 4P32A 4KN8A 1HT1E 1I3KA 3OPVA 2PGDA 3D6HA 3DV0A 3K0FB 1H1DA 3LUDA 4Q3AA 3RRNA 1QAMA 1VPEA 4RF5A 2B98A 1ULSA 1XTSA 1NMQA 3C87A 1RFGE 3FKQA 4KO3S 3D54D 5ALXA 4FEGA 3WLTA 5JSFA 2JIBA 2GPYA 2H08A 5HIAA 1C1DA 3EPJA 3GGDA 2JCBA 2O8NA 1MA0A 2WE8A 4P1ZA 1NI4B 2XNDD 1ZUD1 2WF6A 3I1IA 1LX7A 5DB4A 4FHEA 4PNHA 4J1TA 4PHTA 3GGOA 4ZO7A 1W9HA 1P7YA 3TECE 1KFJB 4MVWA 5HQ3B 1BMFA 5BSWA 4FM9A 2PR2A 5F7JA 1JPVA 3VTAA 4L6CA 2ZRIA 5L3RA 3ZVKA 4LI0A 3MTDA 2HSGA 1ZNQO 1P6UA 3GBPA 4OIMA 3UW1A 4KW7A 2OILA 4MKZA 4B3HA 2XCLA 3QMPA 3OMWA 4R8MA 4Y9UA 1L5VA 2P9CA 2YQZA 3O84A 2ODQA 3AM5A 4TZTA 3V8RA 2FZLA 2I33A 3L6DA 1P2SA 2BCEA 3LT0A 3QLJA 3HVKA 4Q12A 4NYIQ 1SZCA 3TXAA 3NNDA 2OTCA 4BUJA 1XA3A 3EXG1 4CKBA 3E35A 1SCNE 4TKVA 3L8MA 1WUIS 2PS9A 3TE6A 4ZAVA 3AP2A 3I6YA 3NWJA 4X45A 1NQUA 2Y99A 4BGUA 3E84A 2R62A 4J3JA 4IZIA 1P19A 4NQZA 4F8YA 4HZUA 3TGPA 3KEFA 3ROZA 4ERNA 4BN4A 4JQCA 5K6TA 1A2QA 1EXWA 2FSFA 3OOWA 4FKMA 3AYZB 2AE2A 3ZDXB 2ZZNA 3NOQA 2QYTA 4NOLA 4IWXA 2PSFA 4A8HA 3PXBA 1FDSA 4F4IA 4QYXA 1SWWA 1DQZA 5EZQA 2GZSA 4ZU6X 3AR6A 5LOVB 1KZ4A 4N41A 3VTKA 3BCSA 1IRIA 3PCTA 4NICA 1YIAA 3CPJB 2DH6A 5L3SB 3SNKA 3OAAD 1TYDE 2ZT5A 2D74A 2ZIEA 2AFIE 4YCCA 3ZJ5A 2FEMA 2ZE6A 3UJCA 2JFOA 1L8OA 2CL7X 1NQWA 2RG1A 4BU0A 4EKIA 1D9XA 4UHEA 4EW1A 1HM5A 3M2TA 4GI5A 3T34A 3W9BA 4DFDA 1QZTA 5FBRB 4DNXA 3W3AD 4AS1A 3IC5A 4D74A 2NVUB 4C4YA 2Q1WA 1CWUA 1UXHA 4YPOA 3OBIA 4FFPA 5B1IA 1QO0A 2J0EA 3K2IA 3PNPA 3SX4A 3I30X 1JHVA 1YAJA 4YAJA 1E2PA 2PH3A 1YRQA 5BQ3A 4AZ0B 4ITVA 4XCQA 4FYVA 1POXA 1Z28A 1IEWA 1AU9A 2JGRA 5A5VA 1C30A 2Q6TA 4XEUA 4R1SA 4YH1A 3RHTA 4CUKA 2Q2QA 3D4NA 2W2KB 1TVKB 4WZAA 4HFJA 1RBMA 2A9PA 3PIDA 1L4NA 4U7JA 5F2OA 4MS4B 4EY6A 2DUJA 1YZHA 5T4BA 5E8JA 2RHTA 2WWTA 1ML3A 3KWFA 1RJDA 3QFCA 1SVNA 2JAHA 1RWKA 3PDIA 2ZJZA 2RHRA 4WOBA 4B74A 1JJIA 1OAAA 2UYOA 1AKMA 3FIUA 1XQ6A 5H70A 2AFHB 5FTLA 3OQMA 3BWEA 6AT1A 2GEBA 3FUCA 4CDNA 5IP5A 5A9TA 1NMYA 2DHRA 3IUYA 2Q9UA 4W5TA 4JLOA 5FR1A 4LZJA 3AKYA 3ZHVA 1IN1A 3SC6A 1U0HC 5JG7A 4HTFB 3WGNA 3ZPXA 3CZ9A 4B3IA 4DOMA 3Q1KA 5J9FA 3GFPA 2I3AA 5JTTA 5HIJA 4RTKA 1XTTA 1SUAA 3N8HA 1VCMA 4B3DA 4LOHA 4YJ3F 3MJEA 1B41A 1M34A 3KJXA 4LOLA 1V0JA 2ZJ1A 3T1YB 4IRXA 1FK8A 2EDCA 1NQXA 1OLUB 2OQ2A 4J7CA 1ZOIA 1E3QA 3QBEA 4X20B 4EUSA 4F4UA 4ZIRA 3QE2A 5KOJB 3R4VA 1KYWA 1H5NA 2IUYA 3NRJA 4US1R 1X9IA 4BLOA 2QR3A 1UJBA 1IN8A 1RSZA 1UBKS 2IDKA 1WP9A 2FETA 4L8LA 1L5HA 3W5BA 3KR2A 4GM4A 2JI6A 4RZIA 3F8TA 5CNKA 5AQ1A 5AVQA 3G0IA 1UJ6A 1XDZA 3GA5A 1PTJA 4P53A 5LUBA 1MB9A 2FQWA 2I1WA 1PG0A 1I7PA 2PVSA 3N6VA 1Y3DE 5G0TA 1DIAA 2Q3LA 4XWKA 4A3SA 3B1WA 1BXGA 13PKA 2F7SA 2FX3A 3KQVA 1LLCA 1N0UA 1C3LA 1ZS9A 2VHXA 4KAXA 4EG5A 4Z3KA 4C0JA 4LAFA 3S8YA 2O8DB 4AY2A 4PZDA 2CDRA 4DPKA 2V9CA 4GGOA 1ZI6A 4NE7A 3HVHA 3NEJA 4JQSA 1W85A 1HE8B 4XVUA 4ZGGA 3AGQA 2F48A 4ZYZA 1ORRA 2H52A 1Z45A 1T6BY 1DUVG 2CXPA 2YCBA 1D1PA 2GEFA 3CR7A 3VSAA 2ZZMA 4M0UA 3SS8A 2VAXA 1CUDA 1P62B 3WDLA 3K9NA 1H2FA 5KMGB 3R76A 1QDEA 1KK0A 4MA0A 1YJQA 4N0PA 1RHMA 1C1YA 3WZ2A 1HEUA 4K9LA 1D9ZA 1TXGA 5KAMA 2ZUBA 3WGOA 2YV1A 3E8SA 4JB0A 4QYTA 1JLLA 4IQGA 3AESA 3BXHA 4XASA 2VHCA 5CX1B 4KO1S 4U2BA 4PR0A 2YBDA 1KWKA 5I7SA 5L3QB 1BGXT 2CLCX 3GRZA 2J85A 4QAJA 1PFYA 2WY2D 3RS0A 3UK2A 4P4GA 1GPJA 3K73O 2FQQA 1P1CA 3O2QB 4K3UA 3JCZA 4M89A 1CD5A 1KJWA 1U0SY 1ZOPA 1QIHA 1SUWA 3U17A 4YJHA 3SQLA 1C4KA 1YWGO 3B8HA 4PWYA 3T0IA 4M7PA 3UMRA 2X5JO 1GAQA 4I5DA 4MKIA 4WVLA 2HXYA 2G0TA 1OI2A 2NSJA 2P3SA 4GFDA 4OKNA 3C5WP 4XQEA 5DF1A 1VL8A 3FFWA 1XU7A 2Q8NA 1YVRA 2YFYA 3DVAB 1E69A 4I1YA 1DV2A 4I9NA 4LWZA 4WKPA 3DW3X 4DCPA 1OD6A 2FEKA 5B36A 1JZQA 2B92A 2MSEB 3L46A 1VBKA 2BTQA 2Q27A 3LH5A 3KJNA 2PX3A 3O38A 4BFZA 4CMAA 4GIBA 3WLHA 1QK5A 3VR2D 1SXQA 2GFIA 4IG9A 4LQCA 5AHRA 3UH1A 4P31A 4PNEA 5JXGA 3OVMA 2HSJA 3AIOA 3DBIA 2REBA 1FDWA 3B9BA 4XM0A 3THXB 3H11B 1J39A 4NEQA 4JGIA 5JH7B 2GM9A 3QE3A 3RPEA 4HLQB 3JQQA 1H2XA 1ZH4A 1KWGA 1Q2UA 5I9IA 2PUEA 2WFLA 3EIQA 4IINA 621PA 5U4QA 1POWA 2V0CA 4UAJA 1LWOA 4B6PA 4INZA 4IVPA 1QXSA 3G2NA 1AKUA 3K0CC 1SUSA 1XDUA 3IA2A 2AF3C 1Y42X 1CJBA 2YIDA 3GCWA 3L5KA 4IIEA 3WLKX 1CUZA 4EMBA 5CCXA 3AKDA 1Z75A 4OI1A 1C14A 4PLWA 3FW1A 4V1CI 1FFXA 4MGHA 5BMVF 3DVSX 5AJHA 4BGIA 3OO1A 4ZOAA 1VL6A 2O7VA 1QK3A 1EUYA 4TQGA 5EJ8A 3GJTA 3SBXA 4DHWA 1JVBA 4DWOA 4NU6A 5J58A 3AEQB 3FKSD 1YT5A 3LQKA 3VJMA 5IKMA 3G3EA 2Y1WA 1VGQA 3SSAA 2V5UA 5B3JA 3GAZA 2AZDA 3EGCA 4NDNE 3LBYA 4DTCA 2XT9A 1ZJJA 3QFFA 2O8FB 4Y2QA 1XEXB 1MO5A 5T3UA 5EMMA 1E8MA 4YJ2B 1I94B 5G0SA 2WWFA 3NHRA 3LRXA 3GLHE 5M5BA 3AEZA 1XRJA 2Z5LA 2BEJA 2C0QA 3L7NA 3O4HA 4BWGA 3WL4A 1W7AA 2WSMA 4NXNB 5JCJA 3I0ZA 1CZOA 4BO3A 5G1PA 2XT0A 1IRXA 1ESZA 3WK7A 5D5HA 1Z18A 4AMGA 1ZOOA 2CBGA 3ES9A 3ZWBA 2ZTHA 3C41J 4XXHA 1X7HA 2CXRA 5KQRA 3RVBA 5DSTA 1CY0A 1JHYA 1UPFA 3HCAA 3EVEA 1TTHA 4X90A 4WUTA 1E9CA 3BREA 3ZU6A 4B2YA 5B2EA 1ENPA 3RVRA 4WCDA 5H3LA 1MEEA 3GDHA 4CLOA 4D0LB 221PA 1R0ZA 3EUWA 3FVVA 1Q44A 5IAJA 4IJKA 1Y89A 1N0HA 1PR3A 3ITNA 3KHUA 1XAGA 3OZGA 4PGAA 4BBPA 4JITA 1OXTA 1NRIA 2YC2C 2DQYA 3INTA 4Q82A 1MOQA 3WRXA 4BX3A 1LJLA 1HLFA 1DKMA 3RBXA 1XTUA 2HK7A 2PYIA 4C7OB 1JUDA 1SPXA 5TQJA 1G8MA 2PKYX 3RJ9A 4LECA 1QGOA 2GNOA 2FRDA 1DP4A 2X14A 3C43A 1QVAA 3I61A 1QH9A 2FUG1 2HJ9A 2QENA 1L3IA 4J0DA 3WL7A 5H68A 1EP9A 2WSLA 3HYNA 1F20A 1H3FA 1ZOLA 2BF4A 3I32A 3L6CA 3LNCA 3TL3A 2HEGA 4E0BA 3WYCA 1EX6A 5DSZA 1JDPA 1KAQA 2J5XA 4M53A 4TWAA 2GT1A 1RAAA 2D1RA 3JWHA 3DUWA 4YP0A 5LIPA 4X8OA 1XE3A 4HWGA 4MTLA 3U1VA 4ZU1X 3S4YA 4UM9B 1P0MA 2I0FA 3F4BA 3WIOA 4GPEA 1I10A 4G1BA 5JJLA 3RVMA 3KZXA 3EOBI 1RRFA 2GVZC 1LZLA 2LE0A 2YBEA 3FROA 3HL0A 3OEHD 5FI5A 4DDKA 4UXHA 1OLSB 5CH8A 1PDVA 2R5FA 1R4MA 3NJRA 4FE3A 4G5XA 5EE9A 4M9UA 4PHFA 2OT3B 5JADA 1FYVA 1ENZA 2KLBA 1I4LD 2F2TA 2JIDA 1Q7CA 1QHXA 3QFTA 4KOAA 2NU7A 1N0VC 1YA8A 2I3DA 4LHSA 1JN0A 3SMQA 2PA0A 3IIKA 4G97A 4QWWA 1U2PA 2O7RA 2QD1A 1ZUNA 2Q3JA 1U5AA 2YW2A 3AETB 1KO8A 3R5JA 1SOWA 1JILA 2GBLC 1BAPA 2XUFA 3IHLA 2GZRA 4P22A 4Z9FA 2FRXA 4QPPA 5AUQA 1SCUB 2GPJA 4BZZA 1QONA 1RYEA 1OZHA 1CQIB 4A73A 1SC9A 3ZHZA 3R8FA 4DR4B 3SHTA 2R751 2KM1A 1FL9A 1N5KA 3IIMA 1SEPA 4YGYA 2OFPA 3OOHA 4TZ6A 5EJ4A 2VSYA 4JVLA 3MXTA 4DIOA 3BRSA 4LYEA 1J9ZA 4WCFA 4GO1A 1A5BB 3SX0A 1GNRA 2PX0A 4YLYA 7GPBA 2DERA 4NH0A 1M8FA 3RRYA 4X54A 3F3KA 3V4VB 2UYHA 2MTBA 2QUJA 3BBPA 3ZDBA 2JEYA 5IJ9B 5ELLA 4BQOA 2XCTB 2IQIA 1ZHHA 5HKAA 1Q19A 3BGVA 3LA6A 5K3FA 1ZR4A 5HUJA 3V3KA 4GXTA 4N82A 2AMLA 2Y4NA 1J7KA 4W63A 2JEZA 2Z9CA 1EFVA 2QTGA 4N6NA 4EMTA 3L4BA 3RLFA 1RJWA 5CB4B 3L79A 3PXGA 1JWBB 4XCXA 1T5BA 2AG0A 4KE7A 3EGOA 4BLSA 1DKPA 3KV3O 5L8VA 4ZVVA 4HNVA 1O5TA 3LLUA 1DEOA 5L7TA 4IOLA 4G07A 2AVNA 3GRYA 3RU9A 1AK9A 2G9QA 2PYZA 3EY4A 3Q9NA 1IXSB 1QYXA 2DPMA 4M7WA 3TTWA 2PFSA 3QENA 4HZGA 4QBTA 1YRBA 3ZHCA 2GCNA 4X3PA 4E09A 7REQB 5KTKA 1DX4A 4GBED 2FMHA 2G17A 3KXKA 1TNDA 3OM8A 1E8DA 5DWQA 3Q7RA 1DDGA 5EJAA 3WWCA 4LXQA 3BMQA 3MWDA 4DVJA 3C7CB 4KFCA 1QHSA 3FGOA 1MAAA 3SC2A 1YR6A 1ZD1A 4KBYA 4N03A 3A4VA 3CONA 5T8KA 1AN9A 4DHEA 3NHBA 1MGOA 1Y9JA 4YMIA 3HYRA 4KOEC 5IMSA 2JK1A 4NAHA 3U9TA 3RV4A 1QK4A 1YJBA 1YB6A 3CZ4A 3RDPA 2OAP1 3AUAA 2A0KA 3MT9A 5EIHA 3VZQA 2ETVA 2A9JA 1EMDA 3BN3A 3NP9A 2HPAA 3QVGB 1SQSA 4M9RA 4UU7A 3L7OA 3T7RA 1V9SA 5TQ2B 1ISIA 5JS8A 4K2AA 2EJTA 4WK4B 3EWIA 4OSPA 4BC0A 1EE1A 2GFQA 2BH2A 4REQA 4E08A 4QPZA 4B6RA 2J08A 1HDEA 2PWPA 3I9LA 3R0XA 4CEHA 3FSGD 3N8GA 4MITA 3RROA 3OCJA 3RSCA 2HMYB 4N40A 3GXOA 4TLAA 4PX9A 4QO8A 1TAGA 3HMKA 3GDFA 3ZV3A 3BD9A 4C0HA 4V0QA 4ZJUA 3BQ9A 4NNJA 1E92A 4FK8A 1KMNA 4K40A 1W1IA 3RCBA 4P3YA 3MHTA 4YUYA 3KEQA 3BIOA 4MW1A 4QUJA 3QBDA 5F73A 4YRAA 1PKEA 4ZOEA 3DEYX 1RAGA 1S3IA 1L7XA 2VJKA 1DRVA 4MDHA 4WX2B 5EPOA 4J1QA 1HDIA 3HH8A 3OF5A 1PQYA 3B3JA 5CDGA 1C9DB 4UBNA 2W2LD 2ZRQA 3S7TA 3FI9A 3EVAA 2PV7A 2VDPB 3RIXA 3HEMA 1KQ3A 3ICCA 3L6BA 3SEQA 4QGBA 5G53C 2VLIA 2W2NA 3OO0A 3HNOA 1G8HA 5CB0A 4Y2RA 2V98A 3QMVA 2QXUA 5J2UA 1FIUA 3W2EA 3AH8A 4PVDA 2W98A 10MHA 1P44A 1MR3F 3RS7A 4S24A 4Q3LA 1DXYA 5SY6A 4MV8A 4DNFA 1M6WA 1JQAA 3L07A 4BFUA 4F97A 4MPRA 3UB3A 3WO1A 4EATA 5CA1A 2WG2A 1X80B 1DADA 2OG2A 3Q2IA 1V7ZA 2WU3A 4OXKA 3DL0A 1T8UA 1KI1A 1Q15A 2H2AA 2E3JA 3FHTA 4GXRA 3PZBA 4EHKA 1YFJA 4V02A 4Y6GB 2EF0A 3W7AA 2GCOA 4Q7EA 2BFCA 3GRRA 3W8NA 4J4HA 2PY6A 1QUEA 4O4LF 1PGQA 3DP9A 3V8QA 4EW2A 3DLBA 4XGQA 5CJJA 4ZOCA 2RH8A 2A5GA 3D3JA 2BFWA 1L2TA 4RKWA 2H1FA 3ED1A 1FMFA 3PQ3A 4BZWA 4EUEA 4KCGA 1NSTA 2P8JA 1WKCA 2BV3A 3CSDA 2XMCA 5CVEA 2QY9A 4Y2TA 2HUPA 3BMOB 1F4LA 2F43B 3V97A 3Q88A 1M6EX 3QXJA 2H29A 2H1IA 5B5SA 3HN6A 2FWAA 4L0CA 4B32A 2A14A 3DS8A 2B34A 1THZA 1W1WA 1IZZA 4GYYA 5KJ1A 4O4JA 1U0BB 4MUJA 2HNBA 2I87A 2WU1A 2Z57A 5E9QA 4P83A 3TEMA 3WNDA 4PG8A 1YZVA 3QLUA 2FK7A 4MUXA 1B26A 4WOCA 5IASA 4C04A 2PSHA 1EX7A 1GSHA 2NGRA 5FWXA 3WGUA 2GHTA 1COZA 1PQPA 2EJBA 4NBTA 3FVRA 4C5AA 3N2NA 1CY6A 1V2HE 2XF2A 3PRJA 4L0QA 1J8DA 1ULHA 5KCZA 4FBMA 3THWB 3GPDG 4G1EB 2QNRA 5C8VA 4G8DA 3K6SB 2Q3FA 4L5YA 1ZNYA 1H6AA 1C3OB 2YC4C 1XAJA 1FCJA 2HPHA 1JALA 2P41A 3B48A 3BIXA 4FHGA 4BEWA 1C80A 1H2RS 4WHMA 2R1VB 1T13A 1LUAA 1RYBA 2P9TA 4OOEA 2H1HA 1CJMA 2RKOA 3QSYA 1T2UA 5GWXA 1A8PA 2WTNA 3JSXA 3SLGA 1YR9A 4MPJA 2HMAA 4HX2A 4FKBA 1F3OA 2OGSA 5EKSA 3H3FA 3KYDA 3ZK9A 1JKIA 1GO2A 3OP1A 4LJAA 1TKAA 3I9MA 3IV6A 4IDDA 2FKAA 1E79A 1IXYA 4WJZA 2PXXA 4ZTUB 5JYDA 3H0CA 1SIBE 2I76A 4DR6B 3UJBA 1XVVA 2HFKA 2F00A 2ZP1A 2JD0A 1EWVA 2ZTSA 2VXBA 4BASA 3DZIA 3HS3A 4REOA 3NV7A 4M7OA 2IH4A 4E5PA 2Q28A 4FYMA 1B0PA 3WICA 4F5YA 5BSGA 1P3Y1 1P1HA 3R3HA 2PA3A 3S68A 1SQ6A 2HU2A 5KWSA 2EERA 2IPNA 4IQ8A 3T4XA 2E21A 2Y0BA 6NULA 3C1TA 4QFMA 2GDJA 2WJHA 2DFKB 2E55A 1UIMA 1T3LA 1V35A 1WZIA 1DELA 1ZISA 2DWOA 3KOZA 3TZEA 4EYEA 3KPJA 1KAOA 2MINA 1BCSA 1HRDA 2XCOA 3DR5A 4PNZA 1ZU4A 2Z5GA 1FP7A 1GR0A 3C1UA 4ZVSA 3TLXA 3C3BA 4EPTA 4EI7A 2AX3A 4AQDA 3D3NA 1Z8FA 3W7VA 5KYYB 1BFDA 2QE6A 2O3JA 1QQ5A 1BA2A 3ISTA 4JI7B 2Q0SA 2YWCA 3HCPA 4QHSA 1TYZA 5AKEA 2O52A 3FCCA 3R8XA 3WAGA 3OI7A 3BD6A 5K3OA 4FYWA 1ISFA 1Z9BA 5AKYA 5KDDA 1KEEA 4MULA 4OBEA 5COBA 2CXXA 1ISJA