1VTLE

Co-crystal structure of tbp recognizing the minor groove of a tata element
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
186
structure length
186
Chain Sequence
DLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Co-Crystal Structure of TBP Recognizing the Minor Groove of a TATA Element
pubmed doi rcsb
molecule keywords DNA (5'-D(*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*GP*GP*CP*A)-3')
molecule tags Transcription/dna
total genus 46
structure length 186
sequence length 186
chains with identical sequence F
ec nomenclature
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00352 TBP Transcription factor TFIID (or TATA-binding protein, TBP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vtlE01
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 1vtlE02
1W80A 2Z8UA 3EIKA 1NGMA 1B9KA 1R4XA 1KYFA 1PCZA 1C9BB 1VTLE 1E42A 1MP9A 1QN9A 1QNCA 1NVPA 1QNEA 1YTBA 2MJ7A 1YTFA 1VOLB 1QN8A 1TBPA 1QNBA 3HS8A 3H1ZA 1AISA 2D0CA 5IYCP 1D3UA 3ASMA 3VN5A 1QN3A 4RODB 2IV8A 4ROEB 1CDWA 1TBAB 1JFIC 1QNAA 2IV9A 3OC3C 2G30A 1RM1A 1KYUA 2D0BA 3OCIA 4PY5A 2D0AA 1QN6A 4WZSD 1KY7A 1QN7A 5IYBP 1KYDA 1NH2A 1QN4A 1PZDA 1QTPA 4ROCB 4B0AA 1TGHA 2VJ0A 1QTSA 1VOKA 3HS9A 1KY6A 1VTOA 1QN5A 5IYDP
chains in the Genus database with same CATH superfamily
2JOIA 1KYFA 4EJZA 2NOFA 2FGTA 3PMGA 3C04A 1PCZA 2HKPA 4EAGA 1N3CA 1N39A 2MZ8A 2MJ7A 1YTFA 4WXAA 1V5SA 1K35A 1UT7A 4D7RA 1AISA 2HL9A 3CWSA 2D0CA 2PWWA 2QRCA 4EAIA 5EPCA 1EBMA 3VN5A 2NWVA 3DPUA 2IV8A 1JFIC 2I5WA 3PDKA 2D0BA 3OCIA 4PY5A 3ENCA 1LXTA 3D4VA 2F7LA 3OSEA 5BMNA 3T4NA 1QN4A 4ROCB 1LWVA 1P5GX 1QTSA 1QN5A 1N3AA 4EAJA 3OSMA 1NGMA 1M3HA 2R5XA 3CWAA 2NOHA 1PCJX 5KL0A 1YTBA 2FKFA 2DKAA 2QR1A 5JN5A 2O3OA 1VKLA 1KO9A 1TBPA 2OOYA 4TPSA 1WJWA 1UT4A 1UL7A 4C7PA 1XSZA 1C4GA 2V9JA 1QN3A 4BJUA 3ENOC 1YQLA 2IV9A 1LWWA 1P5DX 3UW2A 1YQRA 3NA5A 4IL8A 3SNSA 3F0ZA 2YH5A 2QRDA 1QN7A 3OLPA 2QLVA 5IYBP 1KYDA 2HL8A 5AN4A 1PZDA 1QTPA 2V92A 2Y8QA 3RSMA 2OOXA 3IH7A 1TGHA 2NOZA 1C47A 3N89A 2NOIA 3HS9A 1KY6A 1EUVA 3D7QA 2DKCA 2NVMA 1VTOA 3CVTA 5IYDP 2QREA 1W80A 2Z8UA 3EIKA 1R4XA 2LAEA 5F9CA 4MRQA 2FUVA 1DIZA 1PCMX 4Q11A 2NOBA 1C9BB 3TE5A 1E42A 1QN9A 1VOLB 1QNEA 3I0WA 3BKQX 1QN8A 2FKMX 3H1ZA 2YA3A 4QG5A 1PVSA 5IYCP 3CVSA 1K2YX 1D3UA 3ASMA 4EAKA 3RPJA 1M5Q1 2Z0FA 3OH9A 2NOEA 1CDWA 3TDHA 2JHNA 1HU0A 1WQAA 3OC3C 2G30A 4I8OA 3I0XA 4D7QA 1QN6A 4WZSD 1KY7A 1YQMA 2HZSA 2JHJA 5JMVD 2V8QA 3KRMA 2EHBD 2HZMA 2ZFDB 4WX8A 1VOKA 2DKDA 1J3MA 3I3WA 4DULA 3CWTA 2H5AX 2XHIA 1B9KA 4EJYA 4EALA 3OGDA 1MP9A 4CFFA 2H4LX 3CWUA 1VTLE 2NLVA 1NVPA 1QNCA 3KTUA 3F10A 1FN7A 1QNBA 5HSHA 3HS8A 3OH6A 2NOLA 1Q9UA 1T6AA 3ULXA 1KFQA 3EAYA 1MPGA 4HJHA 4RODB 1TUOA 4ROEB 1TBAB 1QNAA 3DPTA 1RM1A 1KYUA 3CW7A 2D0AA 2JPIA 1KFIA 2Y8LA 1NH2A 1YQKA 4B0AA 2VJ0A 1M3QA 1LWYA 3OSTA 5BMPA 1JDYA
chains in the Genus database with same CATH topology
2JOIA 1KYFA 4EJZA 2NOFA 2FGTA 1N3CA 1PCZA 1N39A 2MZ8A 2MJ7A 1YTFA 1AISA 1UT7A 2D0CA 1EBMA 3VN5A 3DPUA 2IV8A 1JFIC 2I5WA 2D0BA 3OCIA 4PY5A 1QN4A 4ROCB 1LWVA 1QTSA 1QN5A 1N3AA 3OSMA 1NGMA 1M3HA 2NOHA 2O3OA 1KO9A 1TBPA 4TPSA 1UT4A 1QN3A 1YQLA 2IV9A 1LWWA 1YQRA 3SNSA 3F0ZA 2YH5A 1QN7A 5IYBP 1KYDA 5AN4A 1PZDA 1QTPA 3IH7A 1TGHA 2NOZA 3N89A 2NOIA 3HS9A 1KY6A 1VTOA 5IYDP 1W80A 2Z8UA 3EIKA 1R4XA 2LAEA 4Q11A 2NOBA 1C9BB 1E42A 1QN9A 1VOLB 1QNEA 3I0WA 1QN8A 3H1ZA 5IYCP 1D3UA 3ASMA 3RPJA 2NOEA 1CDWA 1HU0A 3OC3C 4I8OA 2G30A 3I0XA 1QN6A 4WZSD 1KY7A 1YQMA 2HZSA 3KRMA 2HZMA 1VOKA 4DULA 2XHIA 1B9KA 4EJYA 1VTLE 1YTBA 1MP9A 1QNCA 1NVPA 3KTUA 3F10A 1FN7A 1QNBA 3HS8A 2NOLA 3ULXA 4RODB 4ROEB 1TBAB 1QNAA 3DPTA 1RM1A 1KYUA 2D0AA 1NH2A 1YQKA 4B0AA 2VJ0A 1M3QA 1LWYA 3OSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W80 A;  2Z8U A;  3EIK A;  1NGM A;  1B9K A;  1R4X A;  1KYF A;  1PCZ A;  1C9B B;  1VTL E;  1E42 A;  1MP9 A;  1QN9 A;  1QNC A;  1NVP A;  1QNE A;  1YTB A;  2MJ7 A;  1YTF A;  1VOL B;  1QN8 A;  1TBP A;  1QNB A;  3HS8 A;  3H1Z A;  1AIS A;  2D0C A;  5IYC P;  1D3U A;  3ASM A;  3VN5 A;  1QN3 A;  4ROD B;  2IV8 A;  4ROE B;  1CDW A;  1TBA B;  1JFI C;  1QNA A;  2IV9 A;  3OC3 C;  2G30 A;  1RM1 A;  1KYU A;  2D0B A;  3OCI A;  4PY5 A;  2D0A A;  1QN6 A;  4WZS D;  1KY7 A;  1QN7 A;  5IYB P;  1KYD A;  1NH2 A;  1QN4 A;  1PZD A;  1QTP A;  4ROC B;  4B0A A;  1TGH A;  2VJ0 A;  1QTS A;  1VOK A;  3HS9 A;  1KY6 A;  1VTO A;  1QN5 A;  5IYD P; 
#chains in the Genus database with same CATH topology
 2JOI A;  1KYF A;  4EJZ A;  2NOF A;  2FGT A;  3PMG A;  3C04 A;  1PCZ A;  2HKP A;  4EAG A;  1N3C A;  1N39 A;  2MZ8 A;  2MJ7 A;  1YTF A;  4WXA A;  1V5S A;  1K35 A;  1UT7 A;  4D7R A;  1AIS A;  2HL9 A;  3CWS A;  2D0C A;  2PWW A;  2QRC A;  4EAI A;  5EPC A;  1EBM A;  3VN5 A;  2NWV A;  3DPU A;  2IV8 A;  1JFI C;  2I5W A;  3PDK A;  2D0B A;  3OCI A;  4PY5 A;  3ENC A;  1LXT A;  3D4V A;  2F7L A;  3OSE A;  5BMN A;  3T4N A;  1QN4 A;  4ROC B;  1LWV A;  1P5G X;  1QTS A;  1QN5 A;  1N3A A;  4EAJ A;  3OSM A;  1NGM A;  1M3H A;  2R5X A;  3CWA A;  2NOH A;  1PCJ X;  5KL0 A;  1YTB A;  2FKF A;  2DKA A;  2QR1 A;  5JN5 A;  2O3O A;  1VKL A;  1KO9 A;  1TBP A;  2OOY A;  4TPS A;  1WJW A;  1UT4 A;  1UL7 A;  4C7P A;  1XSZ A;  1C4G A;  2V9J A;  1QN3 A;  4BJU A;  3ENO C;  1YQL A;  2IV9 A;  1LWW A;  1P5D X;  3UW2 A;  1YQR A;  3NA5 A;  4IL8 A;  3SNS A;  3F0Z A;  2YH5 A;  2QRD A;  1QN7 A;  3OLP A;  2QLV A;  5IYB P;  1KYD A;  2HL8 A;  5AN4 A;  1PZD A;  1QTP A;  2V92 A;  2Y8Q A;  3RSM A;  2OOX A;  3IH7 A;  1TGH A;  2NOZ A;  1C47 A;  3N89 A;  2NOI A;  3HS9 A;  1KY6 A;  1EUV A;  3D7Q A;  2DKC A;  2NVM A;  1VTO A;  3CVT A;  5IYD P;  2QRE A;  1W80 A;  2Z8U A;  3EIK A;  1R4X A;  2LAE A;  5F9C A;  4MRQ A;  2FUV A;  1DIZ A;  1PCM X;  4Q11 A;  2NOB A;  1C9B B;  3TE5 A;  1E42 A;  1QN9 A;  1VOL B;  1QNE A;  3I0W A;  3BKQ X;  1QN8 A;  2FKM X;  3H1Z A;  2YA3 A;  4QG5 A;  1PVS A;  5IYC P;  3CVS A;  1K2Y X;  1D3U A;  3ASM A;  4EAK A;  3RPJ A;  1M5Q 1;  2Z0F A;  3OH9 A;  2NOE A;  1CDW A;  3TDH A;  2JHN A;  1HU0 A;  1WQA A;  3OC3 C;  2G30 A;  4I8O A;  3I0X A;  4D7Q A;  1QN6 A;  4WZS D;  1KY7 A;  1YQM A;  2HZS A;  2JHJ A;  5JMV D;  2V8Q A;  3KRM A;  2EHB D;  2HZM A;  2ZFD B;  4WX8 A;  1VOK A;  2DKD A;  1J3M A;  3I3W A;  4DUL A;  3CWT A;  2H5A X;  2XHI A;  1B9K A;  4EJY A;  4EAL A;  3OGD A;  1MP9 A;  4CFF A;  2H4L X;  3CWU A;  1VTL E;  2NLV A;  1NVP A;  1QNC A;  3KTU A;  3F10 A;  1FN7 A;  1QNB A;  5HSH A;  3HS8 A;  3OH6 A;  2NOL A;  1Q9U A;  1T6A A;  3ULX A;  1KFQ A;  3EAY A;  1MPG A;  4HJH A;  4ROD B;  1TUO A;  4ROE B;  1TBA B;  1QNA A;  3DPT A;  1RM1 A;  1KYU A;  3CW7 A;  2D0A A;  2JPI A;  1KFI A;  2Y8L A;  1NH2 A;  1YQK A;  4B0A A;  2VJ0 A;  1M3Q A;  1LWY A;  3OST A;  5BMP A;  1JDY A; 
#chains in the Genus database with same CATH homology
 2JOI A;  1KYF A;  4EJZ A;  2NOF A;  2FGT A;  1N3C A;  1PCZ A;  1N39 A;  2MZ8 A;  2MJ7 A;  1YTF A;  1AIS A;  1UT7 A;  2D0C A;  1EBM A;  3VN5 A;  3DPU A;  2IV8 A;  1JFI C;  2I5W A;  2D0B A;  3OCI A;  4PY5 A;  1QN4 A;  4ROC B;  1LWV A;  1QTS A;  1QN5 A;  1N3A A;  3OSM A;  1NGM A;  1M3H A;  2NOH A;  2O3O A;  1KO9 A;  1TBP A;  4TPS A;  1UT4 A;  1QN3 A;  1YQL A;  2IV9 A;  1LWW A;  1YQR A;  3SNS A;  3F0Z A;  2YH5 A;  1QN7 A;  5IYB P;  1KYD A;  5AN4 A;  1PZD A;  1QTP A;  3IH7 A;  1TGH A;  2NOZ A;  3N89 A;  2NOI A;  3HS9 A;  1KY6 A;  1VTO A;  5IYD P;  1W80 A;  2Z8U A;  3EIK A;  1R4X A;  2LAE A;  4Q11 A;  2NOB A;  1C9B B;  1E42 A;  1QN9 A;  1VOL B;  1QNE A;  3I0W A;  1QN8 A;  3H1Z A;  5IYC P;  1D3U A;  3ASM A;  3RPJ A;  2NOE A;  1CDW A;  1HU0 A;  3OC3 C;  4I8O A;  2G30 A;  3I0X A;  1QN6 A;  4WZS D;  1KY7 A;  1YQM A;  2HZS A;  3KRM A;  2HZM A;  1VOK A;  4DUL A;  2XHI A;  1B9K A;  4EJY A;  1VTL E;  1YTB A;  1MP9 A;  1QNC A;  1NVP A;  3KTU A;  3F10 A;  1FN7 A;  1QNB A;  3HS8 A;  2NOL A;  3ULX A;  4ROD B;  4ROE B;  1TBA B;  1QNA A;  3DPT A;  1RM1 A;  1KYU A;  2D0A A;  1NH2 A;  1YQK A;  4B0A A;  2VJ0 A;  1M3Q A;  1LWY A;  3OST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...