1VTNC

Co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Co-Crystal Structure of the HNF-3/Fork Head DNA-Recognition Motif Resembles Histone H5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*AP*CP*TP*AP*AP*GP*TP*CP*AP*AP*CP*C)-3')
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1vtnC00
2F5DA 1LDDA 2DU9A 1XSXA 4G94A 5LRRA 5F6FA 4Q5SF 1GHCA 1XGOA 3V7CA 2ISZA 4HW0A 1YQAA 1REPC 4LK0F 1S29A 3CLOA 1HKSA 2C6YA 4N9HA 1FYMA 4ZH4F 1S6LA 2PEXA 2A07F 4LFUA 3PQJA 2L3DA 5FD5A 1TLHB 2F2EA 3H92A 1R7JA 4ZYGA 4M6XA 3HIFA 2F5EA 4FHTA 3QP6A 3T1BA 4YFXF 3M8EA 5K5OA 2HYGD 1KA8A 2DPDA 2O03A 3RPQA 4ETSA 2HQNA 3BWGA 1W7PA 3G73A 3I59A 2WWYA 2FSWA 2E1CA 3U1DA 1IW7F 3WTVC 4BHPA 3T5XA 1UFMA 3F3XA 4AWXB 5FLXZ 5LHIA 4N0BA 3L2CA 5TRDA 3FM3A 2CG4A 1MKMA 2QBYB 2DQLA 3GXOA 4MQVA 2K4BA 3WE3A 3CUQB 2OAZA 2M87A 1KU2A 2BE5F 3H3ZA 4CYDA 2OQRA 1ZRFA 2D1VA 1WQ2A 2QQ9A 2FMLA 5DCMB 1LB2A 3LFKA 2QBYA 2FF4A 1TBXA 1FP1D 2XKOA 1DP7P 2QVOA 1LDJA 3KP7A 2BYVE 3K1NA 2X0LA 3LWFA 1FYLA 1FBUA 5DUKA 1R1VA 1SFXA 3EYYA 5E18F 1LEBA 2L4MA 2XUBA 2WTEA 1PUEE 1CF7A 4BAYA 2O0YA 1IXCA 1ON1A 4I0BA 2VC1A 3Q5FA 2XAGA 5J6XA 1KQ0A 1R00A 3P9CA 2XAHA 3KE2A 4MNUA 1QZZA 5IT9Z 4G7HF 4HA8A 3HRUA 3K1MA 1J0RA 3KFWX 2Z9OA 2ZO4A 1R36A 4IRIA 1BI3A 4NB5A 3RKWA 3TOBA 4IRGA 1KGSA 3JAMK 1O7FA 1BI1A 4EJOA 2XROA 3EDPA 3FXRA 1O57A 2PN6A 1IN8A 2DAOA 3I64A 4KYWA 4IF4A 2QENA 4BHBA 5H20A 2DFIA 1JE8A 2W24A 4A0YA 1YW7A 2P7VB 4RS8A 2EK5A 3FXQA 1XMKA 4P9UA 3L09A 2EJRA 5BPDA 4L18B 4ENJA 4EVIA 1B6AA 1F5TA 4JK1X 4HZFA 4G8XA 1W5TA 4IPAA 4M72A 4GGGA 2HWVA 5D6FA 5DCFA 1XMAA 4UV9A 4KMUX 5H6RA 1D8JA 2FXAA 4U0VA 1W7PD 2GQQA 1FWZA 2L01A 3GZ5A 4A0ZA 2UZKA 3C1DA 1J2XA 4G6DA 3DXJF 1K79A 3F6OA 5D8KB 2J5PA 1BBYA 5EEGA 4P55A 3ZMUA 5JI6A 3MZYA 3Q9VA 2HOEA 2EFPA 5BOXA 1JHHA 1XN7A 4I01A 3JTGA 1LVAA 3DF8A 3U2RA 4CZZA 2ISYA 2V9VA 3WGGA 1PDNC 4WF2A 3T8TA 1R1TA 6PAXA 2IA2A 2IPQX 2ZFWA 3PFIA 1U5TA 4H0EA 2A68F 2MD5A 1HW1A 4EM2A 4ESBA 5HDKA 1BN5A 3IL2A 5HS8A 4M9ZA 2VE8A 4AVPA 5ICGA 2M8EA 1HXDA 3LA2A 2PMHA 4HF1A 3TO6A 2Y0MA 1S7AA 4WWCA 3ZMSA 3GO5A 2EB7A 2G7UA 3F21A 5LBQA 2PQ8A 2NAZA 3LQRA 1BI2A 1OYWA 4IXAA 3E5UA 3L00A 5DYMA 5K5RA 2VE9A 1U78A 2QYOA 5D5VB 3P9IA 4LG0B 2QQAA 1IZ1A 1KU7A 1U6GA 2FE3A 3V4GA 2LDUA 1IN7A 1BI0A 3RKYA 1BC8C 3R4KA 4M73A 4A5NA 3GWZA 2ZKZA 4O3MA 3BOQA 1YFHA 2ACJA 1FNNA 5HLHA 2IP2A 3DEUA 1ZAOA 2ZCWA 4EJUA 1Z6TA 4LG0A 4HYEA 1B1BA 5HS7A 1R5GA 3B73A 4OU0A 3J7AO 3K1PA 4Z2YA 2XV4S 4EJTA 3KZZA 1XB4A 3TO9A 2VN2A 3WODF 5BS6A 1K7AA 2HFHA 5HLIA 2BV6A 2HGCA 3I0TA 1T98A 1TW3A 2PFBA 5DCMA 4BYYA 3WGHA 2HTJA 1QO0D 2K02A 1UHMA 4KNYA 3QAHA 3SZTA 1JGSA 2LSOA 4MTDA 3LA3A 2R7FA 5A2QK 3LQQA 3QOPA 1R23A 4Q48A 2VT3A 1J5YA 1I5ZA 2EFWA 5ICEA 2STTA 2DI3A 4WXDA 1FBQA 2M1BA 2FOKA 1QZYA 4NQWA 4EQQA 3F8NA 3R6SA 4S05A 1ZGJA 2Q0OA 2RKHA 3L9FA 4N9IA 4UVAA 3IRQA 1HKTA 4MTEA 3L7WA 3BROA 1XGNA 5FD6A 3TOAA 4IHSA 5L3CA 1HSJA 5LGTA 1ONVA 2FBIA 4DQ2A 5HS9A 2V79A 4GO1A 4OMZA 5LHHA 1J9IA 2VC0A 4RB3C 4EJWA 3MAJA 4U0YA 1DUXC 1FSHA 4YFKF 1LJ9A 3FMQA 4BNCA 2FA5A 1LDKB 1A04A 4HX4A 1SAXA 4ZZLA 3BDDA 2MBFA 3QU6A 3TO7A 4ZYEA 2B0LA 3NRVA 1Z9CA 2RQPA 2NNNA 3PQKA 1O3SA 4MQ9F 5ICCA 4L5JA 3WE2A 4I98B 1H9GA 3IWFA 3GUDA 2Y75A 2RN7A 1BC7C 3RIRA 3WTWC 5E20A 2JZYA 1GVJA 3CUQA 1B59A 3HOTA 3E3VA 1ZRCA 3AAFA 3ISPA 5D5UB 2E1NA 4OIRF 3NQOA 1ZRDA 3TQNA 4RGUA 5LHGA 2ZXJA 4LJZF 1OMIA 2DQRA 3OOPA 2MH9A 1E2XA 2QZ8A 1Q1HA 5L3EA 1IRGA 2L02A 4XRFA 3FF5A 2A3SA 3BPXA 5ILUA 2UXNA 1SD7A 3C18A 1KU3A 5DD8A 3J80K 4LD5A 1FP2A 4RGSA 2VXZA 4HF2A 5HVQC 1G6NA 3K0LA 1FLIA 4EM1A 3HSEA 5HLGA 3EQLF 5LGUA 2IT0A 4UV8A 3HTSB 4R1HA 1U8RA 2GWRA 3KCCA 3HYIA 1J59A 1Z91A 4KN7X 3IC7A 2M45A 1YS6A 2H09A 5D8LB 4HLXA 5CVIA 1XDSA 3FMRA 2IVMA 3K69A 2A6EF 2VONA 1HKQA 3RKXA 3ML6A 5DD4A 2EV0A 2PLYA 1FZPB 5F1RA 5FLXK 2OA4A 2K4JA 1FY7A 2Z99A 4P9FA 4UXNA 2DLLA 1P4XA 1I6XA 5E8GA 1DPUA 3TDZC 2F5CA 3V7RA 1IUYA 4CICA 4ENKA 3N97A 2VBZA 4BQAA 2COMA 5D4SA 2Z5UA 3I5UA 3WTZA 1EH6A 1HW2A 3P7NA 1TQMA 3WTYC 4HDVA 3K2ZA 3WU0A 3KP2A 2CQKA 4GCVA 2V1XA 3KETA 3GYHX 2YX7A 4ESFA 2FMYA 3WTSC 3E5XA 2GA2A 1SMYF 2HDCA 3HSFA 3F8MA 1MJAA 1F1ZA 4L9NA 1NHAA 4IVNA 3LAPA 4I7HA 2XAJA 2XVCA 2DTRA 3BJOA 2ESHA 5H6QA 3V7SA 1KQ9A 5IT9K 4NHJA 1V3FA 1OR7A 2QLZA 1C0WA 3E6BA 3C7JA 3QPTA 2LF8A 2A61A 3ULQB 3GFJA 2Q2EA 4AIJA 1RI7A 2GXGA 3JAMZ 3ECHA 3DPTA 1YTYA 4K2EA 1YYVA 3H3UA 1Z6RA 3NEUA 4R8HA 1FSEA 2A6HF 1PP8F 4UHTA 3LAJA 2EV6A 2MLGA 1F9NA 1D5VA 5JFRA 1DDNA 3ECOA 3V8LA 2H6CA 4UUVA 1B9MA 3GLXA 3JSPA 5D6EA 1IN6A 1T38A 1L0OC 1QQIA 2HKOA 1USSA 4P96A 5ICFA 3JSOA 2K7LA 3HHGA 2KIUA 5ILSA 3SXYA 1EH8A 5D4RA 4UVCA 2W84A 1XDUA 1MJ9A 1ZHFA 4LB6B 5JHUA 3K9TA 3I53A 4LB5A 2HQRA 3I71A 1CF7B 1YO5C 1Z1DA 2XHKA 1ZGAA 1RIOH 4P5OA 2KKOA 3RYPA 5AONA 1YW8A 3FX3A 4RB2C 3BPVA 3CDHA 2TDXA 3BZ6A 1K78A 5LEKA 1JHFA 1I27A 2D2WA 4IJAA 3B02A 2VOOA 1XD7A 3SFZA 3M1EA 3E6CC 5BMZA 2RV8A 1Y0UA 1S3JA 2XRNA 2P6TA 4OINF 4U0WA 4WCGA 1IRFA 2ZNZA 4B8XA 4U7BA 2HEOA 3CO7C 3ERED 2ADUA 2JRTA 1IF1A 1U3EM 3ZMTA 3DQVC 2KJBA 5AIPA 3KP4A 1TNTA 1XGMA 2BGCA 1XCBA 3GFMA 2D1HA 2DW4A 5ED4A 4G9YA 2FU4A 4IHTA 3LA7A 2EV5A 2OZ6A 1W5SA 3RJPA 5FFZA 2E7XA 3M7GA 4RAZA 3D0SA 1YG2A 1H0MA 2GA1A 1QGPA 1OKRA 2FBKA 2P5VA 4PZJA 5DEQA 2DPUA 2YPRA 4CDGA 5DV5A 4XLNF 4G7ZF 3WGIA 1BIBA 4EM0B 1X3UA 5KK1A 4ASNA 4M6YA 4AIHA 1O7LA 4IRHA 4LLNA 3HOSA 2JT1A 3EYIA 4R79A 1RUNA 1O3QA 4RGRA 4WXHA 1IXRC 5DDGA 3CTAA 1YIOA 3F22A 1T2KA 4EJVA 4BH9A 3EETA 1F4KA 3KP3A 2VBYA 5L3GA 5L3DA 1G3WA 3HTUA 4KDPA 4E70A 1P92A 4EGZA 4M74A 1CGPA 3R61A 2A5YB 4YIIA 2L54A 1WSUA 2VT2A 2NYXA 2VBWA 3COAC 4FX4A 2Y48A 3R0AA 2CWEA 4Y13A 2LKPA 4ZZDA 2H27A 5CVJA 3KP5A 1GXPA 2O6GE 2ESNA 1RUOA 2OD5A 3J81Z 4L0ZB 1TQIA 3FZVA 2FNAA 4A2UA 1TTYA 2O61A 2RVCA 4LGWA 1K78B 4OOIA 4CGZA 4KT5C 5CJ9A 2STWA 3ZN0A 2DK8A 4YG2F 3ZMDA 2JTVA 3P9KA 2QUFA 4ON0A 4LK1F 1FT9A 5L3FA 4WX9A 3S2WA 1QBJA 3T8RA 4I2OA 3F6VA 2UWMA 2GXBA 4CXFA 5FFXA 2OZUA 1WWXA 3SZPA 3HHHA 3GX4X 4ENNA 2G9WA 3DFGA 3KLNA 1D3YA 3FMSA 1MGTA 4HAMA 4LLLA 4WK8F 3ROUA 3WU1B 3ZPLA 1FX7A 5HOOA 2PBIA 3DPLC 2KIFA 3O6BB 3IRRA 1ZYRF 3GVAA 4A6DA 1LQ1A 5EEHA 1FYKA 2LF7A 4M71A 2PI0A 1LEAA 3C3WA 2FNPA 2QM3A 4MHGA 1AOYA 4JBAA 1XCVA 3RDIA 3IKVA 2KIMA 1ZH5A 1GXQA 4HF0A 2XIGA 4ENMA 3FWEA 2CSOA 1SD4A 5D5XB 2VODA 4PGHA 4KFCA 4L9JA 4OIQF 1R58A 1XSVA 1U2WA 1ON2A 4QWQA 4HV6A 1FBSA 3KLOA 2FRHA 1STZA 1B4AA 4B09A 1W4MA 4A5MA 5HDNA 2ZBKA 1IN4A 1WI9A 1KU9A 1J7KA 4RAYA 2GIVA 4MEXF 1QPMA 1ZLJA 4OIOF 3R0JA 3HUGA 5D5WB 1S7OA 1LNWA 3ZMZA 4FT8A 4WXCA 4TV7A 2MH2A 4HX7A 2EA4A 2KJCA 3O2PE 2XAQA 1UCRA 3MZHA 4XSXF 3SHFA 3DV8A 1KYZA 1Z05A 4FX0A 2RNJA 3F72A 5ILVA 1YW9A 2ZMEA 3RPUA 3VB2A 5CVRA 3TDUC 2Q8KA 2O8XA 2K27A 3WTUC 4EV0A 1B9NA 4BXUA 1FOKA 3VFZA 1U5TC 2MC3A 2XGXA 4ZYHA 1L3LA 3MEXA 4PDKA 2PJPA 4RB0A 1RNLA 3W6JB 5CVVA 3N4MA 1DPRA 3HRTA 2JPBA 5LRSA 4HX8A 1R22A 2P8TA 1MDMA 4OMYA 1FPQA 2YSRA 1P4WA 1MZBA 4BHCA 4EGYA 5CVUA 5K5QA 3RYRA 3GFIA 2P7CB 3TGNA 1SD6A 1H9TA 3Q9SA 5FO5A 3D5LA 1UB9A 3I58A 5ERIA 4ZYDA 2UXXA 4GXOA 4HBLA 2VBXA 4CHUA 5J8CA 3O3KA 3REOA 3IHUA 1JXSA 5DUIA 3JTHA 3E6DA 2CO5A 2XASA 1SFUA 3MFKA 1E17A 1HW5A 4HV5A 4AD9A 2V1UA 1PP7U 2ZNYA 3BJAA 2V1DA 3ZP5A 3R60A 5CYVA 5HDGA 3ZN1A 2DT5A 2DBBA 2EWNA 1G3SA 2KRFA 3MQ0A 3HRSA 4G7OF 5L3BA 3J80Z 2HR3A 5FB2A 2Z33A 1P4AA 3KEQA 3QPHA 1TNSA 2PG4A 3VOEA 2FQ3A 1IXSB 2FEZA 2NRAC 2P4WA 4YIFA 3FHZA 2OQGA 3QP5A 3WG9A 2QWWA 4Q4ZF 2IW5A 2DK5A 1ZG5A 3EUHA 3QRFF 1BM9A 2ZJ2A 1OYYA 3I59B 1SD5A 3GF2A 2X4HA 3CUQC 1MDMB 5E1ZB 3GEZA 1G3YA 1KYWA 4RGXA 2K86A 4KIFA 2WC2A 3ZQ7A 3BP8A 3CO6C 2XKPA 2OU2A 4MGRA 3LSTA 2RDPA 1ZREA 4A12A 3F8FA 4GYGA 4KA4A 2JSCA 3WTXC 2HTSA 4OIPF 5E1XA 3MCZA 2L4AA 5A2QZ 5E17F 1SMTA 1XGSA 1XSDA 3V8JA 1WKMA 1HSTA 1ZG3A 4RB1A 2YR2A 1UHWA 1S8NA 1OYIA 3JW4A 4O5VA 2IJLA 5LLQA 1ZLKA 3KEOA 4Y17A 3E6MA 1YLFA 2XAFA 4A6EA 2RC4A 2HZTA 3KP6A 2ETHA 1BJAA 2E7WA 4XBFA 2F5FA 3E5QA 1ZG1A 2EA2A 4KUMA 1HQCA 2QQBA 4KMFA 3E97A 1FC3A 1USTA 1G4DA 3FM5A 1QNTA 4S04A 4GYIA 3T0YA 2W25A 4EMSA 4DNCA 4ESJA 3DKWA 1IN5A 4LLGF 2AXLA 1K6OA 2VOPA 2CYYA 2YX4A 4KIBA 3WTTC 1ZARA 2W57A 4XSZF 5JR3A 4LMYA 3BJ6A 1ULYA 3VEPA 3V8KA 5LEJA 3DP7A 1ODDA 2A69F 4AIKA 4KICA 4O6JA 5AIQA 1YS7A 2LNBA 2H6BA 1OPCA 3BY6A 2BBYA 2M30A 3J81K 3SQNA 2G7HA 1V4RA 4HOBA 2YU3A 4KIGA 2V6CA 2OBPA 4I02A 2R7DA 5F64A 2IA0A 2EFOA 4CO8A 5E8IA 1P2FA 2AS5F 2NNYA 2P5LC 2ELHA 3MWMA 1T39A 2PMUA 3M9AA 1R5HA 4L5IA 4PGGA 5BPIA 2MA3A 2J5OA 1HBXG 4HLYA 3KZYA 4L0YB 3RI4A 1G3TA 2FBHA 1KQ8A 1MJBA 3IKTA 1P6RA 4G6QA 1O3TA 3RTRA 2RGVA 3FXUA 3M8FA 4I0AA 4I09A 1D8KA 3ZMVA 2HS5A 2CGPA 5JVTA 1J75A 1MD0A 3VODA 1T0FA 3F23A 2MLKA 3TKYA 2W85A 4M9XA 2JPCA 2O3FA 3OV8A 4M9SA 5K1YA 4F7ZA 3CUOA 4YFNF 3ABTA 4JQFA 4UVBA 5KVRA 4Q47A 2EFNA 4HQEA 2M5WA 5BQTA 3GW2A 2DO7A 1W7PB 3I4PA 1TQPA 2NS0A 2GZWA 5IT3A 3QU3A 1SFEA 4A0XA 4Y15A 3GFLA 4MEYF 4U7DA 4L9VA 2P6SA 2CFXA 5LGNA 2R3SA 1IAWA 3GZ6A 4U88A 4QLCU 5FGMA 4XLPF 2D45A 1VTNC 2Z3YA 2CW0F 3HSRA 1U5TB 3I54A 1BOAA 2IA1A 5E1WA 3U9GA 3HRMA 3IWZA 2BEOA 1I1SA 4HDUA 1I1GA 4D0PA 1AWCA 2IRFG 1EH7A 1WRJA 3W6KB 4HQMA 3F8CA 3ELKA 2HKXA 2P5KA 1O3RA 5CLSA 5J8FA 3G3ZA 2WV0A 4KN4X 2H94A 4PCQA 1RZ4A 1Z7UA 3F8BA 1BIAA 4L9TA 2HYFA 2EFQA 1TW2A 4UNOA 3ABUA 3CJNA 2GAUA 5TJJA 2ZMEB 1EV7A 1R1UA 1T6SA 1ZN2A
chains in the Genus database with same CATH superfamily
2F5DA 1LDDA 3ZR8X 1VQMI 4XKVA 2DU9A 1XSXA 4G94A 5LRRA 3G1MA 3MN2A 5F6FA 4Q5SF 4PSWA 3K10A 1GHCA 1QPIA 1XGOA 1TP4A 3V7CA 1JJ8C 2ISZA 3OYHA 2E36A 2AQFA 4HW0A 2F4IA 1Y8RB 3DPUA 3OYDA 1R49A 2Z16A 3DLLF 2X1DA 3CCLI 1YQAA 2MABA 3RKQA 1REPC 4LK0F 2W4SA 3PUBA 1S29A 3CLOA 1U9OA 1HKSA 2C6YA 1VFCA 4N9HA 1FYMA 1VQ4I 4ZH4F 4BQQA 1S6LA 2VJJA 1JGGA 2PEXA 2A07F 4AM3A 4LFUA 3LSJA 3PQJA 4E6KG 2L3DA 5FD5A 2LVSA 1TLHB 2F2EA 3GLLA 3H92A 1R7JA 1NK3P 4ZYGA 3OYFA 4M6XA 4C30A 1IJWC 2K9NA 3ABLH 3IH4A 4HEA2 4B1RA 3HIFA 2F5EA 4BQNA 4FHTA 3QP6A 4I99C 3T1BA 4YFXF 4P1WA 4J01A 3M8EA 5K5OA 1LKXA 2GOMA 2HYGD 3AG3H 1P9QC 1KA8A 2DPDA 2O03A 1ORKA 3RPQA 4ETSA 2HQNA 1TWCJ 1YE9A 2L7MP 2LREA 2NOGA 1XS9A 3BWGA 2DOAA 4KITB 1W7PA 1F43A 3A01A 2LYCA 3G73A 3I59A 3S32A 3H9JA 2FSWA 2WWYA 3E7LA 2EPFA 2E1CA 1MW7A 4B43A 3U1DA 1IW7F 3WTVC 3NARA 4BHPA 3T5XA 4OAZA 1DQUA 1UFMA 3F3XA 4AWXB 5FLXZ 3A1YA 5LHIA 4N0BA 3L2CA 5TRDA 3FM3A 3SDBA 2CG4A 1MKMA 4II3A 2QBYB 2ICWG 3DLAA 1ETYA 4HNTA 2DQLA 2AQEA 1T56A 1U8BA 1XTAA 1TZLA 3GXOA 4MQVA 2K4BA 3WE3A 3CESA 3CUQB 2OAZA 2W48A 3TL4X 2M87A 1KU2A 2BE5F 3H3ZA 4CYDA 5J4YA 3JRGA 1TWFJ 1UHSA 2OQRA 1ZRFA 4IHYA 1MBEA 2GBYA 2D1VA 2V1NA 1WQ2A 2QQ9A 1X3ZB 2FMLA 2VKHA 1TC3C 5DCMB 3F9KA 1LB2A 3LFKA 2QBYA 2FF4A 3CCSI 4DJAA 1TBXA 2E1OA 1FP1D 5F27A 2XKOA 3ZQLA 4E7KA 2LOOA 1DP7P 1OCPA 2QVOA 1LDJA 2HU9A 2D5VA 1MBHA 2K3FA 3KP7A 1J09A 3AKZA 2BYVE 4BE1A 3K1NA 2X0LA 3LWFA 1FYLA 1FBUA 5DUKA 4FISA 2KT0A 1R1VA 1SFXA 2CW8A 3EYYA 5E18F 1LEBA 2L4MA 3OS1A 2ECBA 2XUBA 2WTEA 3OIPA 2K3PA 3M3YJ 1PUEE 1CF7A 4BAYA 1TT5B 1IXCA 1ON1A 2O0YA 4I0BA 2BXZA 2VC1A 1K4SA 3Q5FA 2XPVA 2XAGA 3KYCB 5J6XA 1KQ0A 1R00A 3ERMA 2R4GA 1VZ0A 3P9CA 2XAHA 2V6EA 3KE2A 4MNUA 1X1DA 1QZZA 5IT9Z 3A01B 4G7HF 2E35A 3HRUA 4HA8A 5FLVA 3K1MA 1J0RA 3KFWX 2Z9OA 2ZO4A 1R36A 3OY9A 4IRIA 1BI3A 3K7AJ 1FOYA 4RAGA 3OL3A 2JA5J 4NB5A 3RKWA 1NH3A 3TOBA 1WVRA 4BDZA 3OS0A 4IRGA 3CF5F 1KGSA 2VQGA 3JAMK 1MIJA 2FD5A 1O7FA 1BI1A 4EJOA 2XROA 2NS7A 5J1RA 3EDPA 3FXRA 3V42A 3EUAA 1O57A 2PN6A 1IN8A 5IPAA 2HNHA 1VQKI 2GLOA 4ZTJA 2DAOA 3I64A 3WHBA 4ZDPA 4KYWA 2LRDA 4IF4A 2R7RA 2HXIA 4PJMA 2QENA 5E3NA 3ZXSA 4BHBA 3W6VA 5H20A 2DFIA 5H2FC 1JE8A 2W24A 4A0YA 1YW7A 2P7VB 2DYSH 2JQ7A 2XB0X 2R7SA 4RS8A 2EK5A 3I56I 3FXQA 1XMKA 1T33A 4P9UA 2BOLA 3L09A 3PSIA 3C2GA 3VDXA 2EJRA 5BPDA 4L18B 4ENJA 2QKLB 1JKPC 4EVIA 2AXTC 1B6AA 1F5TA 4JK1X 1FOWA 5EDNA 4CCOA 4HZFA 4G8XA 1W5TA 4G6TB 4D7NA 2DMTA 4HNVA 4IPAA 1QZEA 4M72A 4GGGA 5TGTA 4NC6A 5M5YJ 2HWVA 3FBNB 1MBJA 3FXOA 5D6FA 1SC7A 1S5LC 3IP4B 1R71A 1TT0A 3JRBA 1DGRM 3ZQGA 1FMVA 3K4JA 4FQGA 1XMAA 4UV9A 5DCFA 4XOTA 4KMUX 5H6RA 4ITVA 3U1KA 3UR3C 4IZZA 2L9NA 3PSFA 3K4BA 3LMMA 1D8JA 2FXAA 3EPZA 4U0VA 3BR0A 1GT0C 2JA6J 1W7PD 2GQQA 1FWZA 2JJ7A 2L01A 3GZ5A 5JHFA 3HM5A 5GPCA 4A0ZA 2UZKA 2ZJQF 2HOTA 5EYRA 3C1DA 1V54H 1J2XA 4G6DA 3DXJF 4NBQA 1K79A 3F6OA 4A69C 2EILH 2COBA 2XB5A 5D8KB 2J5PA 1BBYA 1RETA 1S7EA 4LG3A 5EEGA 4P55A 3ZMUA 5JI6A 3HOZJ 3MZYA 3Q9VA 3S2DJ 2HOEA 2UUZA 3OYKA 2EFPA 4XN3A 5BOXA 5CKTA 1JHHA 1M1EB 1XN7A 4I01A 3JTGA 2CUFA 1LVAA 3KEYA 3AL0B 3PJRA 3SEQA 3L2QA 3DF8A 3U2RA 1BR4A 4CZZA 2ISYA 3CCMI 1IC8A 1ZQ3P 2V9VA 4XKWA 3WGGA 2OTLI 3JRIA 1B72A 1PDNC 5FLMJ 3D5RC 2JUGA 3OYEA 4WF2A 3C2HA 4JP0A 3T8TA 2F6CA 1R1TA 4F91B 2IA2A 2IPQX 6PAXA 2DA4A 2EQRA 2ZFWA 3PFIA 3P5JA 1U5TA 3HL2A 4H0EA 2A05A 2A68F 2MD5A 1HW1A 4EM2A 4UB6C 2LR8A 4ESBA 2OJED 3FKIJ 5HDKA 4IO9F 1IV8A 4RDUA 1BN5A 3IL2A 3OIQA 3Q3SA 5E79C 5HS8A 1Z3YA 2VE8A 3O8HA 4M9ZA 4AVPA 3G71I 5ICGA 2M8EA 4IEJA 2KDZA 1HXDA 1AKHA 3LA2A 2PMHA 4HF1A 1R4NB 1Y0NA 3FDYA 2Y0MA 1S7AA 3TO6A 4Y4RA 4WWCA 3ZMSA 5GAGJ 3GO5A 1T6SA 2EB7A 2G7UA 2X6OA 3VSKA 3F21A 1DU0A 5LBQA 2OF7A 1S9HA 4U87A 2PQ8A 3DBRB 1R5ID 2NAZA 1EJ9A 3LQRA 3H0GJ 4HNUA 1BI2A 4RLQA 4E7LA 1PUFA 2WY8Q 1MNEA 3H9QA 1OYWA 2CS3A 4IXAA 2VUMJ 3E5UA 1X4OA 3L00A 5DYMA 5K5RA 2VE9A 4LOCA 1U78A 2QYOA 5FROA 5D5VB 2ZXIA 3P9IA 4LG0B 2QQAA 4A3JJ 1IZ1A 5FKNA 3I3LA 9ANTA 3I55I 1KU7A 3L2UA 1U6GA 4ZYAA 2FE3A 3IAS2 3V4GA 5M3FJ 2LDUA 4Z6YA 1IN7A 1BI0A 2KRHA 3RKYA 1BC8C 2VXDA 3R4KA 2GOXB 4M73A 1I3QJ 5KHDA 2R7WA 1WJDA 4A5NA 3GWZA 2ZKZA 3C2BA 4O3MA 1WH7A 3BOQA 3D1NI 1YFHA 2ACJA 1FNNA 5HLHA 2IP2A 5FKOA 3DEUA 1ZAOA 2ZCWA 3CD6I 4EJUA 1Z6TA 4LG0A 4HYEA 2WADA 1B1BA 5HS7A 4DBQA 4XICA 1R5GA 3B73A 4OU0A 4J00A 3J7AO 3K1PA 1D1CA 2MD0A 4Z2YA 2XV4S 4EJTA 2JN6A 3KZZA 4W97A 1Z21A 2BVLA 2NVXJ 2XF6A 1XB4A 3TO9A 1LE8A 2VN2A 3WODF 3CCJI 5B66C 5BS6A 1K7AA 2HFHA 5HLIA 4A3KJ 5B1AH 1NK2P 2M4KA 3WHCA 2BV6A 2HGCA 2JWTA 1MMSA 4D7MA 3I0TA 3HOVJ 1TL8A 1T98A 1TW3A 2PFBA 3GTJJ 3JCUC 5DCMA 4B47A 1QRYA 3I4NJ 4BYYA 3WGHA 3HOXJ 3GTQJ 3A0HC 2HTJA 1QO0D 2VJIA 2K02A 1UHMA 1D0ZA 3HGGA 3LSRA 1H89C 5F04A 4KNYA 4I76A 3QAHA 3K6GA 3HXLA 5KAIC 3KYDB 3SZTA 1JGSA 2RNGA 2LSOA 1HDPA 4MTDA 1AA7A 3FXMA 2KMUA 4XKBA 3LA3A 2R7FA 4ZDOA 4CCJA 5A2QK 3LQQA 3QOPA 3TW6A 1R23A 4Q48A 3QWLA 2ZFUA 4HPQA 2VT3A 1J5YA 1CQTA 1JT6A 4BY7J 1I5ZA 2EFWA 5ICEA 2STTA 2DI3A 4WXDA 1FBQA 4L5EA 3NWSA 1XMXA 2M1BA 2FOKA 2KDOA 4RMNA 1QZYA 3DTIA 2HVSA 4NQWB 4NQWA 4EQQA 3F8NA 3R6SA 4RA2A 1ZGJA 4S05A 2Q0OA 2RKHA 3Q0VA 2LC2A 3I4MJ 3L9FA 1FIAA 4N9IA 4UVAA 3IRQA 1HKTA 5EEAA 1FIPA 4MTEA 3L7WA 1QHGA 3BROA 2V7FA 3WU2C 1XGNA 2CV1A 5FD6A 1QU3A 3S16J 3TOAA 3LSMA 3E0JB 4IHSA 5L3CA 2OUMA 1A5JA 1ZELA 1HSJA 1AHDP 1LPQA 3FXJA 5LGTA 1ONVA 1A31A 1ETOA 5FJ8J 2FBIA 4DQ2A 1WI3A 5HS9A 2V79A 4GO1A 1BR2A 1BOBA 1BR1A 4OMZA 5LHHA 2VC0A 1FTZA 1J9IA 4RB3C 4EJWA 3MAJA 4U0YA 3VWBA 1DUXC 4BE2A 1FSHA 5GPAA 4E7SA 2X51A 2XC7A 2R5YB 4YFKF 3ZQCA 1LJ9A 1UG2A 4MLOA 2DMQA 4OAYA 1I6HJ 3DBLB 3FMQA 3W2WA 5KNLA 4BNCA 2HYJA 4PJ0C 3CCQI 2X1CA 2ZSHB 2DTZA 2KRCA 2FA5A 4I6ZA 4UUSB 1LDKB 1A04A 4HX4A 4Y7NJ 3OS2A 1SAXA 1PJRA 4ZZLA 3BDDA 2MBFA 3QU6A 1R4MB 2BHZA 2OTJI 3TO7A 4ZYEA 2B0LA 3CCUI 2CH0A 3LOCA 3NRVA 3LSGA 1GUUA 4UB8C 3JR9A 3OSGA 1Z9CA 2RQPA 2NNNA 3PQKA 1KONA 1O3SA 2XAUA 4MQ9F 5ICCA 4L5JA 3WE2A 1B72B 4I98B 1H9GA 3IWFA 2FUG2 3GUDA 2ZJPF 2Y75A 2RN7A 1BC7C 3RIRA 3DEWA 4PFPA 3WTWC 4C3HJ 3PIOF 4NUBA 2E60A 3OYLA 5E20A 2K9LA 2JZYA 3BG9A 1GVJA 3BQZA 1OQYA 3GTPJ 3BZKA 1GVDA 4BQOA 2DA1A 3CUQA 5J3LA 4BGDA 1B59A 1UELB 3CMMA 2IGNA 1XG1A 3HOTA 3E3VA 1ZRCA 1U0JA 1HCRA 3AAFA 3ISPA 5D5UB 3EUKL 3VYTB 1XPXA 4RLFA 2E1NA 3SDGA 1ERDA 4MIMA 4OIRF 2DJNA 2HXOA 3NQOA 1ZRDA 1E3PA 2HVRA 1X1BA 3TQNA 2E2HJ 4RGUA 5LHGA 2ZXJA 4LJZF 2BY3A 1OMIA 2NS8A 1Z0XA 2DQRA 3OOPA 2MH9A 2XSDC 1E2XA 2QZ8A 2L9RA 3L2VA 1K6YA 1YX3A 4LITA 5EJCA 1SANA 1Q1HA 3GBGA 1Z67A 5L3EA 1IRGA 2L02A 3ABKH 4XRFA 4XQFA 3FF5A 1VQLI 2A3SA 2WBMA 4IHWA 3BPXA 1W1WE 5ILUA 3MKZA 3BR1A 2UXNA 1SD7A 1ZGWA 3GZNB 3C18A 1KU3A 3PNVA 1I50J 5DD8A 4XLCA 3L1PA 3J80K 4LD5A 5IP6A 1FP2A 4RGSA 2VXZA 4HF2A 5HVQC 1G6NA 2LH9A 2L9SA 3K0LA 1FLIA 4EM1A 3HSEA 1N78A 2XSJC 5HLGA 2IS2A 3FKJA 3CDIA 3FK6A 4AYBN 2R7XA 3EQLF 5F1JA 5LGUA 5DTDA 2IT0A 1WJAA 3H0DA 3JRAA 4UV8A 3HTSB 4R1HA 2L2OA 1U8RA 2GWRA 2O7OA 4XRSG 3S1RJ 3KCCA 3HYIA 2VPLA 1J59A 1Z91A 4KN7X 3IC7A 2M45A 1YS6A 2H09A 2LBFB 5D8LB 1HA8A 4HLXA 5GAEJ 5CVIA 2L7KA 2WAFA 2R7ZJ 1XDSA 2LY9A 2XPWA 3FMRA 1X19A 1R9TJ 2IVMA 3BTJA 3K69A 1PUFB 2A6EF 2VONA 1HKQA 2IGOA 3RKXA 3ML6A 5DD4A 4E7IA 2EV0A 2PLYA 1FZPB 3SJMA 2ELJA 4XIDA 4BDYA 5F1RA 5FLXK 2EBIA 2XGDA 3J7ZI 3CCRI 2OA4A 2VJ4A 3UNGC 4Y33A 2VJ5A 3K4MA 3BR6A 2K4JA 1FY7A 2Z99A 2E2IJ 3OYJA 4P9FA 2IGKA 2FOWA 4UXNA 3MD2A 2DLLA 1P4XA 1I6XA 2V4JC 5E8GA 1DPUA 3TDZC 2JMWA 3CCVI 1VQOI 2F5CA 3V7RA 2ME0A 5F0CA 1IUYA 4CICA 4ENKA 3N97A 2DCEA 2VBZA 4BQAA 2CV0A 4J19A 2CU7A 2COMA 1O4XA 5D4SA 2NVTJ 2Z5UA 3I5UA 3WTZA 1EH6A 3DU6A 1HW2A 1WJFA 2IGMA 3P7NA 1TQMA 3WTYC 4HDVA 3K2ZA 2K9MA 3LL7A 3WU0A 1I39A 3KP2A 1NG7A 1RR7A 4V2GA 4E7HA 2CQKA 1OLTA 2KLOA 4GCVA 4XOPA 2K9SA 2V1XA 3KETA 3CC4I 5FKKA 2KHMA 3GYHX 2JA2A 2YX7A 4ESFA 2XRLA 1E3OC 1Q1VA 1A6IA 3QOEA 2FMYA 3WTSC 3E5XA 2CUJA 1SMYF 2GA2A 1BL0A 2FQ4A 2HDCA 1ETXA 3X2QH 2X1EA 3DU5A 1VQ6I 3HSFA 2E19A 3F8MA 4FE4A 1MJAA 1F1ZA 3E1SA 5C3EJ 2K40A 4L9NA 3Q0UA 1NHAA 4IVNA 3LAPA 4I7HA 2XAJA 2XVCA 3HKZN 3G2BA 1H8AC 2HOSA 1OCOH 2DTRA 3BJOA 3PFYA 3BG7A 2ESHA 4DGWB 5H6QA 1RKWA 1OCZH 3SZGA 3JRHA 3CCEI 2ZSIB 4N4NB 2CQXA 1MSEC 3W3CA 3HBLA 2LK2A 3V7SA 1KQ9A 5IT9K 2HVQA 4NHJA 1V3FA 1OR7A 2QLZA 1C0WA 2M7AA 3E6BA 1UAAA 2Y9YA 1SVMA 3CF2A 3C7JA 3QPTA 2LF8A 4C9YA 1Z3XA 2A61A 4BEHB 3ULQB 1IDYA 2R0QC 3GFJA 2Q2EA 1D1BA 3QYFA 5JVGF 4FCYA 2ZXHA 3DTKA 2DOEA 3TP3A 1RI7A 2GXGA 4AIJA 3JAMZ 4IQJA 3ECHA 3DPTA 1YTYA 4K2EA 1YYVA 4HSTA 3HUGB 4NC7A 3HOUJ 3H3UA 1Z6RA 3NEUA 1K61A 1AKHB 3S8PA 1G2HA 4QSHA 4R8HA 1PVEA 4CYCB 1FSEA 1UZCA 2A6HF 1PP8F 4UHTA 3LAJA 3K4NA 3OYIA 2EV6A 2K85A 1I3AA 1T0FC 2MLGA 2DFFA 1F9NA 1D5VA 1WFXA 5M3MJ 5JFRA 3OSFA 3RCOA 1DDNA 3ECOA 3V8LA 2QGUA 5GTIC 2H6CA 1ACIA 4UUVA 2HPIA 4QIWN 1B9MA 3GLXA 3JSPA 3JRCA 5D6EA 4CA0A 1IN6A 4BBRJ 1T38A 3KYLA 1L0OC 3BCBA 1QQIA 2HKOA 4HG2A 1Y39A 4XLEA 1USSA 4B4CA 2BHYA 3QPSA 4P96A 2Y31A 5ICFA 5EGOA 2WAQN 3JSOA 2I5UA 2K7LA 4JOMA 2Y0SN 3HHGA 1OCTC 2KIUA 5FRMA 5ILSA 3SXYA 4GFBA 4PJJA 3B6CA 5K7HA 1EH8A 4EATA 3IUOA 2KISA 2F48A 1X4PA 5D4RA 1LFUP 4UVCA 3LNQA 2W84A 1XDUA 2UV1A 3DBHB 1MJ9A 1OFCX 2A5WA 4YRVA 4AU7A 1ZHFA 4LB6B 3GTGJ 3K4LA 5TISC 5IOZA 2M8GX 2M0MA 4F93B 4B44A 5JHUA 3K9TA 3KPHA 2EH3A 1TWAJ 3S15J 3I53A 4LB5A 2HQRA 3I71A 1BJZA 2X48A 4PFOA 2DDBA 1WGXA 2QCOA 2WY7Q 3S3MA 4AC0A 1WJ5A 5F08A 1CF7B 1YO5C 1Z1DA 2XHKA 4AYBA 4Y52J 3OYBA 1HDDC 1ZGAA 1RIOH 4P5OA 2KKOA 3RYPA 3ZQIA 5AONA 1YW8A 3FX3A 4RB2C 3IV5A 3BPVA 3OYMA 3CDHA 2XF7A 2G0EA 1T95A 2TDXA 4M3FA 1OISA 3BZ6A 3IH3A 1K78A 5LEKA 4FE7A 4MFDA 1Y6IA 2F4MB 2CQQA 1JHFA 4D5FA 3AG4H 1I27A 4A3CJ 2D2WA 5GAHJ 2E2JJ 4IJAA 3B02A 1G8XA 2VOOA 1WJCA 1XD7A 3M1EA 1MMAA 3SFZA 3E6CC 2R7QA 4ZTFA 5BMZA 2KIQA 2RV8A 4ZJZA 2ZJRF 1Y0UA 1S3JA 2XRNA 2P6TA 2Z1DA 1FTTA 2HI3A 4OINF 4U0WA 4YELA 4WCGA 3QYBA 2DMPA 3CZ6A 4BACA 2DT7B 1IRFA 2ZNZA 4B8XA 3H5RA 4U7BA 2HEOA 3CO7C 1APLC 2H8RA 1ENHA 2ADUA 2JRTA 3ERED 1N77A 3CJRB 3BG6A 3ZMTA 1U3EM 1IF1A 3DQVC 5KAFC 2KJBA 5AIPA 3RPUD 2H1KA 3KP4A 4F55A 2CQ7A 1TNTA 1XGMA 3TP0A 2BGCA 2KZGA 1XCBA 4BBSJ 3GFMA 4PSXA 2KL4A 2D1HA 2DW4A 5ED4A 1YJ9I 4G9YA 4BJTA 2FU4A 3PNTA 1WCMJ 4IHTA 3LA7A 1W36C 2M4GA 1BW6A 2EV5A 1A6QA 1X1PA 2OZ6A 4DBRA 1W5SA 3RJPA 1SVLA 5FFZA 2E7XA 3M7GA 4CYCA 2CQNA 3GCMA 4RAZA 2IS6A 3D0SA 1YG2A 2JUCA 3HZJA 3CJQB 1H0MA 3GTMJ 1LFBA 2GA1A 1IGNA 4CCMA 1QGPA 2O8KA 2M7BA 3HC7A 1OKRA 2FBKA 2IXSA 2P5VA 4PZJA 4BE0A 3ASNH 5DEQA 3MKWB 2DPUA 2YPRA 3HG9A 4CDGA 3H9GA 5DV5A 4XLNF 4G7ZF 3WGIA 2HOAA 1NG6A 1VQNI 1Y1WJ 2V26A 3NAUA 4YIRX 4A3FJ 4M3DA 1BIBA 3MZ8A 4EM0B 2R7TA 1X3UA 2DA7A 1VNDA 5KK1A 1V5GA 4ASNA 2Y69H 3ZCOA 2ID6A 2IS1A 3BR5A 2L5QA 5J1UA 4M6YA 4AIHA 3S1NJ 1O7LA 4DIQA 4IRHA 4LLNA 3TBIA 3FXLA 5CQEA 3HOSA 2JT1A 3EYIA 5HODA 4R79A 1RUNA 1O3QA 2NVYJ 4RGRA 3H36A 4WXHA 1IXRC 1T8IA 3HKZA 5DDGA 1B8IA 3CTAA 1JTXA 4HSRA 1YIOA 5FKMA 3F22A 1T2KA 4EJVA 4BH9A 3H1CA 1Y8QB 3BLYA 3EETA 1F4KA 4XLFA 2MW8A 3KP3A 2QKMB 2VBYA 4MO7A 1ZREA 2CW7A 5L3GA 3BR3A 2VIXA 2EIMH 5L3DA 1HF0A 2N8GA 5J4VA 2NOJB 2X6XA 4GRIA 1G3WA 1YHQI 2VQHA 3TW7A 3CC7I 4B3AA 3HTUA 2CUEA 4AIDA 2VQLA 4DYQA 4E70A 4KDPA 1P92A 1VQ5I 2LD5A 4NC8A 2VQCA 2V9KA 5B3SH 3DKXA 2YU9J 1HOMA 2RREA 3GMEA 1JKOC 4EGZA 4XRSA 2E5NA 4M74A 1P7IA 1IV6A 1DGWY 1CGPA 4E7ZA 3R61A 5B1BH 2A5YB 2W00A 4BS9A 4YIIA 2L54A 3QODA 1WSUA 3DCFA 5EZHA 1VI0A 2GM4A 2MGQA 2NYXA 2VBWA 2EINH 2VT2A 3COAC 4FX4A 4HRIA 2Y48A 1N25A 3R0AA 2B63J 2CWEA 4D1QA 4Y13A 3L2RA 2LKPA 5CQGA 3S1QJ 4ZZDA 2VLAA 3OIOA 2H27A 2QA4I 2VKDA 5CVJA 4F3QA 2FJ1A 2EZHA 2QQ8A 2VI6A 1MSFC 3KP5A 1FOXA 1GXPA 5DS9A 2R92J 4LIVA 1SAUA 4ZC3A 2O6GE 2ESNA 2YS9A 2HQAA 4RM2A 1RUOA 2OD5A 3J81Z 1TQIA 4L0ZB 3FZVA 2Q2EB 2FNAA 4A2UA 3A02A 1TTYA 2JSPA 2O61A 1YI2I 2RVCA 4LGWA 1K78B 1MNDA 4OOIA 1FJLA 4CGZA 2M34A 4KT5C 1RPWA 2MYSA 5CJ9A 2STWA 2JVGA 2XGEA 2Y0SA 3ZN0A 5LD2C 2DK8A 3L2WA 3BTCA 1IRZA 1RESA 2CUZA 4YG2F 2DMNA 2KQRA 3ZMDA 2DFHA 2JTVA 3P9KA 4A3DJ 2QUFA 4BXFA 2JA8J 4ON0A 3OR2C 3VPRA 4LK1F 1FMWA 5HLTA 2KP6A 4BJ5C 1FT9A 1MH3A 5FKLA 3ZQQA 5EZGA 3ZQFA 5L3FA 4WX9A 2IBDA 3S2WA 1D5YA 1QBJA 3T8RA 4I2OA 4IOCF 2BW3B 5DM7F 3LSHA 3DTEA 3F6VA 1VQ8I 2UWMA 3ZOBA 1D0YA 4M3EA 4XORA 1YJWI 2GXBA 4CXFA 5FFXA 2OZUA 1WWXA 1T08B 3SZPA 1HLVA 3HHHA 2XGCA 3AG1H 3GX4X 4ENNA 1MMDA 2G9WA 3DFGA 3KLNA 1D3YA 2DA3A 2WV1A 3FMSA 1MGTA 2WB1N 4HAMA 4LLLA 1MNMC 4WK8F 3ROUA 3WU1B 2MC4A 3M4OJ 1FX7A 5HOOA 3ZPLA 4A93J 4A3BJ 1X2MA 4BEHA 2DJIA 2I8DA 5KCMA 2PBIA 2O9LA 3OR1C 1MBKA 3DPLC 3H5AA 2KIFA 3O6BB 4FETA 2HDDA 3IRRA 1ZYRF 3GVAA 4A6DA 2DA6A 1LQ1A 5EEHA 2LY1A 1FYKA 2LF7A 4M71A 2LG4A 4M3GA 2PI0A 1LEAA 1K83J 3C3WA 2FNPA 3A0BC 3CMEI 2QM3A 3BTIA 4MHGA 1UG0A 4JBAA 1AOYA 3OMYA 2JRMA 1XCVA 3RDIA 2NVQJ 3IKVA 3I9V2 4C2TA 2KIMA 2LY2A 1ZH5A 1GXQA 4HF0A 2XIGA 4ENMA 2L7ZA 3FWEA 4Y3OA 2CSOA 1SD4A 3K4CA 5D5XB 1YIJI 2VODA 4PGHA 4KFCA 4L9JA 4OIQF 1R58A 1TWHJ 1XSVA 3CP8A 1U2WA 1ON2A 2BZTA 1HC8A 4E7JA 3S17J 2LMDA 1XC5A 2BVMA 2MG4A 3K4KA 4QWQA 5CPRB 1A35A 4HV6A 1IDZA 4E4HA 2DA2A 1FBSA 3KLOA 2K9QA 2FRHA 3BG3A 4QPOA 5IYCJ 1STZA 4X1EA 1B4AA 4CSWA 5HNFA 2R7UA 4B09A 1W4MA 4A5MA 1EA3A 5HDNA 1UJ8A 2ZBKA 4A3MJ 3JREA 1ITYA 1IN4A 3CP2A 1WI9A 1KU9A 4UUSA 3CLQA 4NNJA 1J7KA 4RAYA 1ETQA 2GIVA 4MEXF 3W2AA 3ONQA 1RR8C 1QPMA 1JUMA 3AL0C 1ZLJA 2TCTA 5C4JJ 4OIOF 3R0JA 3HUGA 5D5WB 2MFZA 4CZCA 3CC2I 1S7OA 5GADJ 3FHNA 1LNWA 3ZMZA 4FT8A 3S14J 3ZQHA 3HPGA 4DZPA 1RKTA 3F0CA 4WXCA 4TV7A 1WPKA 2QSGX 2MH2A 4HX7A 2CMPA 2V9PA 3ESWB 1GV5A 2EA4A 4BJ6C 2KJCA 3O2PE 2XAQA 1UCRA 3MZHA 2XF5A 4XSXF 3SHFA 2ZB9A 3FBIB 2LFBA 3DV8A 1Y56A 2KFDA 1KYZA 1Z05A 4FX0A 2RNJA 3F72A 5E3LA 5ILVA 1WHUA 1YW9A 2ZMEA 3QYEA 5J40A 3RPUA 3LSPA 1GDTA 1MH4A 3VB2A 2L9VA 5CVRA 3TDUC 2Q8KA 2O8XA 2K27A 3D5SC 3WTUC 4EV0A 1B9NA 3K2AA 4BXUA 1FOKA 1LFPA 4A3LJ 1BA5A 4C3IJ 1LE8B 3CMAI 2R5ZB 2JA7J 1WJEA 5EF6A 4X0GA 3OYCA 3VFZA 1U5TC 3VYRB 4CCNA 2NXNB 4IOAF 2PX9A 4ANJA 2MC3A 3CDLA 2XGXA 4ZYHA 1L3LA 3MEXA 4A3EJ 3H35A 4PDKA 1QA6A 3CCYA 2E1MC 3G4SI 2PJPA 3HOYJ 4RB0A 3PO3J 1RNLA 3W6JB 5CVVA 3N4MA 1DPRA 3HRTA 2X6YA 3MMYB 4ZDLA 2JPBA 5LRSA 4HX8A 2VKVA 1R22A 2P8TA 1MDMA 2RQQA 3RZDJ 1E3HA 4OMYA 1FPQA 2YSRA 5J47A 4OWRB 1P4WA 1MZBA 2OV7A 1G59A 1ZTRA 4UY8I 4BHCA 4EGYA 4BXXJ 5CVUA 5K5QA 3RYRA 3GFIA 2P7CB 3TGNA 3JRDA 1SD6A 1H9TA 3Q9SA 5FO5A 2R7VA 1W5CC 3D5LA 1UB9A 2X85A 4D5CA 3I58A 4XK4A 5ERIA 4ZYDA 2QSFX 4KT6A 2E1MB 2UXXA 4GXOA 4HBLA 2VBXA 4CHUA 2DA5A 1YITI 5J8CA 3O3KA 3REOA 2HQ5A 3IHUA 1JXSA 2WA0A 5DUIA 2BY0A 3JTHA 2LKXA 1MBFA 5LFAA 2H1LA 3E6DA 3VSLA 2CO5A 2XASA 2Y30A 2DODA 1SFUA 3MFKA 2EIKH 5BNGA 1HW5A 4M3BA 1E17A 4HV5A 4AD9A 2V1UA 3KX2A 3N05A 1OJLA 1PP7U 2ZNYA 3G1LA 4DW6A 3A2KA 3BJAA 2V1DA 2B9SA 3ZP5A 3H5NA 3R60A 5CYVA 5HDGA 3ZN1A 5EGOB 2W7NA 2R93J 2DT5A 5GP9A 5E3MA 2DBBA 4II2A 2NVUB 1GV2A 2OC6A 4F52A 4IKFA 2WAEA 2E34A 2DDAA 1G3SA 2EWNA 3M07A 2KRFA 4IX7A 3MQ0A 3HRSA 3S3NA 1K4TA 1JT0A 4G7OF 3PIPF 5L3BA 2KPMA 2HR3A 3FXKA 5FB2A 1R6RA 3J80Z 2Z33A 4IHXA 1VF9A 2GXAA 1PYVA 3OYAA 1WJBA 4XONA 1P4AA 2OCEA 2HZDA 4NDLA 4XM3A 4G12A 3U21A 5GTHC 3KEQA 1W0UA 3ASOH 4V2FA 3QPHA 1TNSA 1FEXA 3DWLE 3BC8A 2H8WA 2PG4A 3VOEA 4RBOA 4JX5A 2FQ3A 1IXSB 2PMZN 3BZCA 2FEZA 3A4CA 2ZC2A 2P4WA 4YIFA 2NRAC 3FHZA 1ZKGA 2P81A 2OQGA 3QP5A 4MFEA 3WG9A 2QWWA 4Q4ZF 2IW5A 2DK5A 1ZG5A 2ID3A 3EUHA 3QRFF 2LKSA 1BM9A 1MBGA 2ZJ2A 3RSNA 1SFOJ 1IG7A 1EF4A 2QF7A 1Z77A 4GDFA 1OYYA 3I59B 1SD5A 5EG0A 1WZ2A 3GF2A 5IOYA 4IL6C 1Y1VJ 2X4HA 2M9HA 3RQIA 3CUQC 1MDMB 5E1ZB 3GEZA 2F4OB 1G3YA 1V5EA 1SVOA 4A3GJ 1KYWA 4RGXA 3AFHA 3H3VK 1JTYA 2K86A 4KIFA 2WC2A 3IAM2 3ZQ7A 4IQ4A 3BP8A 2X6WA 2XKPA 2OU2A 2P0WA 2VASA 2RDPA 3LSTA 4MGRA 3CO6C 1JJ6C 2MSYA 3HPHA 2CFOA 4A12A 1KZHA 3F8FA 1TWGJ 3SFIA 4BL0B 2HPMA 4GYGA 2IAIA 2VKEA 1ETVA 2M3AA 4XN0A 4KA4A 2JSCA 3WTXC 4IHVA 2HTSA 1V55H 2R5ZA 4OIPF 5E1XA 4XMYA 3MCZA 1W0TA 2EZLA 2L4AA 4B48A 5A2QZ 5IYBJ 2IS4A 3BT9A 5E17F 1SMTA 1XGSA 1XX5A 1XSDA 3V8JA 1WKMA 1HSTA 1ZG3A 4RB1A 2IEKA 4XRMA 2YR2A 2Y2ZA 2AO9A 1A36A 1UHWA 1S8NA 1OYIA 3JW4A 4O5VA 1RRJA 2IJLA 4XR6A 3PM1A 5LLQA 1ZLKA 2DXIA 4AUXA 3KEOA 2PJRB 3S3OA 1OCRH 1SFKA 2LP0A 4EEFG 3LFUA 2DT6A 3E6MA 4Y17A 1YLFA 2XAFA 3PNYA 4A6EA 2E5ZA 1ETKA 1V5FA 1F36A 2RC4A 3GTLJ 2HZTA 3KP6A 5IP7J 5M5WJ 2B7EA 1D0XA 1ZK8A 2ETHA 2O5RA 2JVHA 1BJAA 4LIUA 2E7WA 1QVTA 1OR7C 4XBFA 2F5FA 4DOZA 3E5QA 5K7FA 1ZG1A 2JK3A 2VB6A 3DEEA 2EA2A 4KUMA 3UKGA 2W1OA 1HQCA 1VQPI 2BY2A 2QQBA 5C4XJ 4PJNA 4KMFA 3E97A 1FC3A 1USTA 1YOVB 1G4DA 3HDDA 2XDVA 3FM5A 1QNTA 1OCCH 3BCAA 2BY1A 4S04A 5K7ZA 3O8GA 4GYIA 2YUSA 3T0YA 2W25A 5M5XJ 4EMSA 2WAQA 1GLNA 4DNCA 4ESJA 3GTKJ 1P7JA 2LLKA 4XL9A 4BY1J 3DKWA 1IN5A 4LLGF 2CJJA 2AXLA 1K6OA 2VOPA 2LTPA 1MMNA 3S93A 2CYYA 1E0EA 2YX4A 4KIBA 4C2UA 4RAFA 3WTTC 1ZARA 3QQAA 2W57A 5FRNA 3BQYA 3EUHC 3IH2A 4XSZF 3KIOA 5JR3A 2ZXWH 4LMYA 4PJLA 4CCLA 1X2NA 2L7FP 3BJ6A 3PO2J 3SYTA 5J1YA 2CV2A 3TEDA 1ULYA 3VEPA 3FIWA 3S2HJ 2L0KA 3V8KA 5LEJA 3DP7A 1ODDA 2A69F 4AIKA 2CRGA 2TRTA 4KICA 4O6JA 5AIQA 2OCCH 1YS7A 2LNBA 2RAEA 2H6BA 1OPCA 3BY6A 3G1OA 3G6EI 2BBYA 2M30A 4UUTA 3J81K 3SQNA 3LSKA 3J7YJ 4JYKA 1POGA 3ZGKA 2G7HA 1D1AA 1V4RA 3K70C 1VQ7I 4HOBA 2YU3A 2E71A 3MVPA 5DM6F 1YJNI 5JLXA 1MMGA 4KIGA 4PUSA 4QPQA 4D9JA 2V6CA 2OBPA 3DKYA 4I02A 2DYRH 4FASD 2R7DA 5F64A 2IA0A 1S72I 2EFOA 4CO8A 5E8IA 5F0HA 1P2FA 2AS5F 1UMQA 1LUJB 1YRNA 4RM3A 2NNYA 3RQ4A 2P5LC 2ELHA 3MWMA 1T39A 2ME6A 1X58A 4H4KC 4DYRA 1EKEA 3MKYB 2EZKA 2PMUA 3M9AA 1R5HA 2BW3A 4L5IA 4PGGA 3ABMH 5BPIA 1N75A 2DN0A 2MA3A 2OPTA 4ABZA 3CJTB 2J5OA 3Q0WA 1HBXG 2HDWA 4XNFA 4HLYA 4XLHA 2X9DA 2Y9ZA 1SEUA 1QVUA 3KZYA 4L0YB 1LVKA 3RI4A 1G3TA 2FBHA 1ETWA 5C44J 3QPLA 3TMOA 4DYCA 5EG0B 3HGYA 1JKQC 1KQ8A 3SEZA 3W2VA 1MJBA 3IKTA 1P6RA 3OYNA 3A03A 4N4OB 4DZJA 4G6QA 3S1MJ 1X3WB 2EIJH 3RTRA 1O3TA 2RGVA 2KZVA 3FXUA 3M8FA 4I0AA 2ECCA 2Q1ZB 4I09A 1D8KA 3ZMVA 1ZR4A 1ZR2A 3HOWJ 3AG2H 4A3IJ 2HS5A 5B5EC 2CGPA 3BR2A 5E3OA 5JVTA 1J75A 1MD0A 3FISA 2GIZA 2K5CA 4B3XA 3VODA 1T0FA 3F23A 3M8JA 4JX4A 3OOUA 2DOFA 2MLKA 3TKYA 3BTLA 2W85A 4M9XA 2JPCA 4XKCA 2O3FA 5IP9J 4XLAA 3OV8A 4M9SA 3BG5A 5K1YA 4F7ZA 2A6TA 2PMZA 3ZRGA 3CUOA 4YFNF 3ABTA 3KZIC 2BXYA 4AVZA 3LSIA 2FX0A 4JQFA 4UVBA 3WG7H 2Z2SB 5KVRA 3CMYA 4Q47A 4S0HB 1JI8A 1Z7LA 2EFNA 4BUPA 4W1UA 2DFEA 4HQEA 2M5WA 5BQTA 5IY5H 3OYGA 4X6AJ 3GW2A 2DO7A 1W7PB 3I4PA 3VYUB 1TQPA 2NS0A 1IUFA 2GZWA 5IT3A 4YEJA 2EZIA 1JUPA 1NTCA 2VL8A 4V19K 3QU3A 1SFEA 4A0XA 4Y15A 5JLWA 2PJRA 2DMUA 1DP3A 3GFLA 4MEYF 4U7DA 1W36D 4L9VA 2W82A 2QSHX 2P6SA 4F92B 2WB1A 1YRNB 2CFXA 1BW5A 4M6VA 5LGNA 2R3SA 1IAWA 3GZ6A 1WH5A 4U88A 1DU6A 1X1CA 4QLCU 4BU2A 4PK4A 5FGMA 4XLPF 2D45A 3HB9A 1X1AA 2Z3YA 1VTNC 1RC9A 3HSRA 2CW0F 3PL8A 2R5YA 1U5TB 3I54A 1BOAA 1YX5A 2IA1A 1IRXA 2M0CA 5E1WA 3GTOJ 3U9GA 3RZOJ 3HRMA 3IWZA 1B8IB 3MKLA 2BEOA 1I1SA 4HDUA 1I1GA 2R7OA 4D0PA 1AWCA 2IRFG 1EH7A 1WRJA 2F5VA 3PUFA 3W6KB 4HQMA 1IO2A 2VPRA 3F8CA 3ELKA 4CCKA 2AHQA 2HKXA 1U9NA 2M2EA 1AU7A 2P5KA 1O3RA 5CLSA 5HNHA 1H88C 3J7AY 5J8FA 4QTRA 1JUSA 4CUGA 3G3ZA 4JX6A 2WV0A 4KJZA 3NWTA 4KN4X 3OL4A 3B6AA 2H94A 4PCQA 2XPUA 3HJEA 3JRFA 1RZ4A 1Z7UA 3F8BA 2ZMEC 1BIAA 2LBFA 4L9TA 2HYFA 4KISA 3CQZJ 3HEFA 1VQ9I 2EFQA 4C3JJ 5IYDJ 1TW2A 4UNOA 3ABUA 4CH7A 3CJNA 4C2MJ 2QEXI 3VYSB 2ELKA 4BKXA 5TJJA 3K70D 4FTHA 3OWTA 2ZMEB 1EV7A 1JKRC 2I10A 5F0FA 1R1UA 3FK7A 2GAUA 3M1CA 1QHHD 1ZN2A
chains in the Genus database with same CATH topology
2F5DA 1LDDA 2DU9A 1XSXA 4G94A 5LRRA 5F6FA 4Q5SF 1GHCA 1XGOA 3V7CA 2ISZA 4HW0A 1YQAA 1REPC 4LK0F 1S29A 3CLOA 1HKSA 2C6YA 4N9HA 1FYMA 4ZH4F 1S6LA 2PEXA 2A07F 4LFUA 3PQJA 2L3DA 5FD5A 1TLHB 2F2EA 3H92A 1R7JA 4ZYGA 4M6XA 3HIFA 2F5EA 4FHTA 3QP6A 3T1BA 4YFXF 3M8EA 5K5OA 2HYGD 1KA8A 2DPDA 2O03A 3RPQA 4ETSA 2HQNA 3BWGA 1W7PA 3G73A 3I59A 2WWYA 2FSWA 2E1CA 3U1DA 1IW7F 3WTVC 4BHPA 3T5XA 1UFMA 3F3XA 4AWXB 5FLXZ 5LHIA 4N0BA 3L2CA 5TRDA 3FM3A 2CG4A 1MKMA 2QBYB 2DQLA 3GXOA 4MQVA 2K4BA 3WE3A 3CUQB 2OAZA 2M87A 1KU2A 2BE5F 3H3ZA 4CYDA 2OQRA 1ZRFA 2D1VA 1WQ2A 2QQ9A 2FMLA 5DCMB 1LB2A 3LFKA 2QBYA 2FF4A 1TBXA 1FP1D 2XKOA 1DP7P 2QVOA 1LDJA 3KP7A 2BYVE 3K1NA 2X0LA 3LWFA 1FYLA 1FBUA 5DUKA 1R1VA 1SFXA 3EYYA 5E18F 1LEBA 2L4MA 2XUBA 2WTEA 1PUEE 1CF7A 4BAYA 2O0YA 1IXCA 1ON1A 4I0BA 2VC1A 3Q5FA 2XAGA 5J6XA 1KQ0A 1R00A 3P9CA 2XAHA 3KE2A 4MNUA 1QZZA 5IT9Z 4G7HF 4HA8A 3HRUA 3K1MA 1J0RA 3KFWX 2Z9OA 2ZO4A 1R36A 4IRIA 1BI3A 4NB5A 3RKWA 3TOBA 4IRGA 1KGSA 3JAMK 1O7FA 1BI1A 4EJOA 2XROA 3EDPA 3FXRA 1O57A 2PN6A 1IN8A 2DAOA 3I64A 4KYWA 4IF4A 2QENA 4BHBA 5H20A 2DFIA 1JE8A 2W24A 4A0YA 1YW7A 2P7VB 4RS8A 2EK5A 3FXQA 1XMKA 4P9UA 3L09A 2EJRA 5BPDA 4L18B 4ENJA 4EVIA 1B6AA 1F5TA 4JK1X 4HZFA 4G8XA 1W5TA 4IPAA 4M72A 4GGGA 2HWVA 5D6FA 5DCFA 1XMAA 4UV9A 4KMUX 5H6RA 1D8JA 2FXAA 4U0VA 1W7PD 2GQQA 1FWZA 2L01A 3GZ5A 4A0ZA 2UZKA 3C1DA 1J2XA 4G6DA 3DXJF 1K79A 3F6OA 5D8KB 2J5PA 1BBYA 5EEGA 4P55A 3ZMUA 5JI6A 3MZYA 3Q9VA 2HOEA 2EFPA 5BOXA 1JHHA 1XN7A 4I01A 3JTGA 1LVAA 3DF8A 3U2RA 4CZZA 2ISYA 2V9VA 3WGGA 1PDNC 4WF2A 3T8TA 1R1TA 6PAXA 2IA2A 2IPQX 2ZFWA 3PFIA 1U5TA 4H0EA 2A68F 2MD5A 1HW1A 4EM2A 4ESBA 5HDKA 1BN5A 3IL2A 5HS8A 4M9ZA 2VE8A 4AVPA 5ICGA 2M8EA 1HXDA 3LA2A 2PMHA 4HF1A 3TO6A 2Y0MA 1S7AA 4WWCA 3ZMSA 3GO5A 2EB7A 2G7UA 3F21A 5LBQA 2PQ8A 2NAZA 3LQRA 1BI2A 1OYWA 4IXAA 3E5UA 3L00A 5DYMA 5K5RA 2VE9A 1U78A 2QYOA 5D5VB 3P9IA 4LG0B 2QQAA 1IZ1A 1KU7A 1U6GA 2FE3A 3V4GA 2LDUA 1IN7A 1BI0A 3RKYA 1BC8C 3R4KA 4M73A 4A5NA 3GWZA 2ZKZA 4O3MA 3BOQA 1YFHA 2ACJA 1FNNA 5HLHA 2IP2A 3DEUA 1ZAOA 2ZCWA 4EJUA 1Z6TA 4LG0A 4HYEA 1B1BA 5HS7A 1R5GA 3B73A 4OU0A 3J7AO 3K1PA 4Z2YA 2XV4S 4EJTA 3KZZA 1XB4A 3TO9A 2VN2A 3WODF 5BS6A 1K7AA 2HFHA 5HLIA 2BV6A 2HGCA 3I0TA 1T98A 1TW3A 2PFBA 5DCMA 4BYYA 3WGHA 2HTJA 1QO0D 2K02A 1UHMA 4KNYA 3QAHA 3SZTA 1JGSA 2LSOA 4MTDA 3LA3A 2R7FA 5A2QK 3LQQA 3QOPA 1R23A 4Q48A 2VT3A 1J5YA 1I5ZA 2EFWA 5ICEA 2STTA 2DI3A 4WXDA 1FBQA 2M1BA 2FOKA 1QZYA 4NQWA 4EQQA 3F8NA 3R6SA 4S05A 1ZGJA 2Q0OA 2RKHA 3L9FA 4N9IA 4UVAA 3IRQA 1HKTA 4MTEA 3L7WA 3BROA 1XGNA 5FD6A 3TOAA 4IHSA 5L3CA 1HSJA 5LGTA 1ONVA 2FBIA 4DQ2A 5HS9A 2V79A 4GO1A 4OMZA 5LHHA 1J9IA 2VC0A 4RB3C 4EJWA 3MAJA 4U0YA 1DUXC 1FSHA 4YFKF 1LJ9A 3FMQA 4BNCA 2FA5A 1LDKB 1A04A 4HX4A 1SAXA 4ZZLA 3BDDA 2MBFA 3QU6A 3TO7A 4ZYEA 2B0LA 3NRVA 1Z9CA 2RQPA 2NNNA 3PQKA 1O3SA 4MQ9F 5ICCA 4L5JA 3WE2A 4I98B 1H9GA 3IWFA 3GUDA 2Y75A 2RN7A 1BC7C 3RIRA 3WTWC 5E20A 2JZYA 1GVJA 3CUQA 1B59A 3HOTA 3E3VA 1ZRCA 3AAFA 3ISPA 5D5UB 2E1NA 4OIRF 3NQOA 1ZRDA 3TQNA 4RGUA 5LHGA 2ZXJA 4LJZF 1OMIA 2DQRA 3OOPA 2MH9A 1E2XA 2QZ8A 1Q1HA 5L3EA 1IRGA 2L02A 4XRFA 3FF5A 2A3SA 3BPXA 5ILUA 2UXNA 1SD7A 3C18A 1KU3A 5DD8A 3J80K 4LD5A 1FP2A 4RGSA 2VXZA 4HF2A 5HVQC 1G6NA 3K0LA 1FLIA 4EM1A 3HSEA 5HLGA 3EQLF 5LGUA 2IT0A 4UV8A 3HTSB 4R1HA 1U8RA 2GWRA 3KCCA 3HYIA 1J59A 1Z91A 4KN7X 3IC7A 2M45A 1YS6A 2H09A 5D8LB 4HLXA 5CVIA 1XDSA 3FMRA 2IVMA 3K69A 2A6EF 2VONA 1HKQA 3RKXA 3ML6A 5DD4A 2EV0A 2PLYA 1FZPB 5F1RA 5FLXK 2OA4A 2K4JA 1FY7A 2Z99A 4P9FA 4UXNA 2DLLA 1P4XA 1I6XA 5E8GA 1DPUA 3TDZC 2F5CA 3V7RA 1IUYA 4CICA 4ENKA 3N97A 2VBZA 4BQAA 2COMA 5D4SA 2Z5UA 3I5UA 3WTZA 1EH6A 1HW2A 3P7NA 1TQMA 3WTYC 4HDVA 3K2ZA 3WU0A 3KP2A 2CQKA 4GCVA 2V1XA 3KETA 3GYHX 2YX7A 4ESFA 2FMYA 3WTSC 3E5XA 2GA2A 1SMYF 2HDCA 3HSFA 3F8MA 1MJAA 1F1ZA 4L9NA 1NHAA 4IVNA 3LAPA 4I7HA 2XAJA 2XVCA 2DTRA 3BJOA 2ESHA 5H6QA 3V7SA 1KQ9A 5IT9K 4NHJA 1V3FA 1OR7A 2QLZA 1C0WA 3E6BA 3C7JA 3QPTA 2LF8A 2A61A 3ULQB 3GFJA 2Q2EA 4AIJA 1RI7A 2GXGA 3JAMZ 3ECHA 3DPTA 1YTYA 4K2EA 1YYVA 3H3UA 1Z6RA 3NEUA 4R8HA 1FSEA 2A6HF 1PP8F 4UHTA 3LAJA 2EV6A 2MLGA 1F9NA 1D5VA 5JFRA 1DDNA 3ECOA 3V8LA 2H6CA 4UUVA 1B9MA 3GLXA 3JSPA 5D6EA 1IN6A 1T38A 1L0OC 1QQIA 2HKOA 1USSA 4P96A 5ICFA 3JSOA 2K7LA 3HHGA 2KIUA 5ILSA 3SXYA 1EH8A 5D4RA 4UVCA 2W84A 1XDUA 1MJ9A 1ZHFA 4LB6B 5JHUA 3K9TA 3I53A 4LB5A 2HQRA 3I71A 1CF7B 1YO5C 1Z1DA 2XHKA 1ZGAA 1RIOH 4P5OA 2KKOA 3RYPA 5AONA 1YW8A 3FX3A 4RB2C 3BPVA 3CDHA 2TDXA 3BZ6A 1K78A 5LEKA 1JHFA 1I27A 2D2WA 4IJAA 3B02A 2VOOA 1XD7A 3SFZA 3M1EA 3E6CC 5BMZA 2RV8A 1Y0UA 1S3JA 2XRNA 2P6TA 4OINF 4U0WA 4WCGA 1IRFA 2ZNZA 4B8XA 4U7BA 2HEOA 3CO7C 3ERED 2ADUA 2JRTA 1IF1A 1U3EM 3ZMTA 3DQVC 2KJBA 5AIPA 3KP4A 1TNTA 1XGMA 2BGCA 1XCBA 3GFMA 2D1HA 2DW4A 5ED4A 4G9YA 2FU4A 4IHTA 3LA7A 2EV5A 2OZ6A 1W5SA 3RJPA 5FFZA 2E7XA 3M7GA 4RAZA 3D0SA 1YG2A 1H0MA 2GA1A 1QGPA 1OKRA 2FBKA 2P5VA 4PZJA 5DEQA 2DPUA 2YPRA 4CDGA 5DV5A 4XLNF 4G7ZF 3WGIA 1BIBA 4EM0B 1X3UA 5KK1A 4ASNA 4M6YA 4AIHA 1O7LA 4IRHA 4LLNA 3HOSA 2JT1A 3EYIA 4R79A 1RUNA 1O3QA 4RGRA 4WXHA 1IXRC 5DDGA 3CTAA 1YIOA 3F22A 1T2KA 4EJVA 4BH9A 3EETA 1F4KA 3KP3A 2VBYA 5L3GA 5L3DA 1G3WA 3HTUA 4KDPA 4E70A 1P92A 4EGZA 4M74A 1CGPA 3R61A 2A5YB 4YIIA 2L54A 1WSUA 2VT2A 2NYXA 2VBWA 3COAC 4FX4A 2Y48A 3R0AA 2CWEA 4Y13A 2LKPA 4ZZDA 2H27A 5CVJA 3KP5A 1GXPA 2O6GE 2ESNA 1RUOA 2OD5A 3J81Z 4L0ZB 1TQIA 3FZVA 2FNAA 4A2UA 1TTYA 2O61A 2RVCA 4LGWA 1K78B 4OOIA 4CGZA 4KT5C 5CJ9A 2STWA 3ZN0A 2DK8A 4YG2F 3ZMDA 2JTVA 3P9KA 2QUFA 4ON0A 4LK1F 1FT9A 5L3FA 4WX9A 3S2WA 1QBJA 3T8RA 4I2OA 3F6VA 2UWMA 2GXBA 4CXFA 5FFXA 2OZUA 1WWXA 3SZPA 3HHHA 3GX4X 4ENNA 2G9WA 3DFGA 3KLNA 1D3YA 3FMSA 1MGTA 4HAMA 4LLLA 4WK8F 3ROUA 3WU1B 3ZPLA 1FX7A 5HOOA 2PBIA 3DPLC 2KIFA 3O6BB 3IRRA 1ZYRF 3GVAA 4A6DA 1LQ1A 5EEHA 1FYKA 2LF7A 4M71A 2PI0A 1LEAA 3C3WA 2FNPA 2QM3A 4MHGA 1AOYA 4JBAA 1XCVA 3RDIA 3IKVA 2KIMA 1ZH5A 1GXQA 4HF0A 2XIGA 4ENMA 3FWEA 2CSOA 1SD4A 5D5XB 2VODA 4PGHA 4KFCA 4L9JA 4OIQF 1R58A 1XSVA 1U2WA 1ON2A 4QWQA 4HV6A 1FBSA 3KLOA 2FRHA 1STZA 1B4AA 4B09A 1W4MA 4A5MA 5HDNA 2ZBKA 1IN4A 1WI9A 1KU9A 1J7KA 4RAYA 2GIVA 4MEXF 1QPMA 1ZLJA 4OIOF 3R0JA 3HUGA 5D5WB 1S7OA 1LNWA 3ZMZA 4FT8A 4WXCA 4TV7A 2MH2A 4HX7A 2EA4A 2KJCA 3O2PE 2XAQA 1UCRA 3MZHA 4XSXF 3SHFA 3DV8A 1KYZA 1Z05A 4FX0A 2RNJA 3F72A 5ILVA 1YW9A 2ZMEA 3RPUA 3VB2A 5CVRA 3TDUC 2Q8KA 2O8XA 2K27A 3WTUC 4EV0A 1B9NA 4BXUA 1FOKA 3VFZA 1U5TC 2MC3A 2XGXA 4ZYHA 1L3LA 3MEXA 4PDKA 2PJPA 4RB0A 1RNLA 3W6JB 5CVVA 3N4MA 1DPRA 3HRTA 2JPBA 5LRSA 4HX8A 1R22A 2P8TA 1MDMA 4OMYA 1FPQA 2YSRA 1P4WA 1MZBA 4BHCA 4EGYA 5CVUA 5K5QA 3RYRA 3GFIA 2P7CB 3TGNA 1SD6A 1H9TA 3Q9SA 5FO5A 3D5LA 1UB9A 3I58A 5ERIA 4ZYDA 2UXXA 4GXOA 4HBLA 2VBXA 4CHUA 5J8CA 3O3KA 3REOA 3IHUA 1JXSA 5DUIA 3JTHA 3E6DA 2CO5A 2XASA 1SFUA 3MFKA 1E17A 1HW5A 4HV5A 4AD9A 2V1UA 1PP7U 2ZNYA 3BJAA 2V1DA 3ZP5A 3R60A 5CYVA 5HDGA 3ZN1A 2DT5A 2DBBA 2EWNA 1G3SA 2KRFA 3MQ0A 3HRSA 4G7OF 5L3BA 3J80Z 2HR3A 5FB2A 2Z33A 1P4AA 3KEQA 3QPHA 1TNSA 2PG4A 3VOEA 2FQ3A 1IXSB 2FEZA 2NRAC 2P4WA 4YIFA 3FHZA 2OQGA 3QP5A 3WG9A 2QWWA 4Q4ZF 2IW5A 2DK5A 1ZG5A 3EUHA 3QRFF 1BM9A 2ZJ2A 1OYYA 3I59B 1SD5A 3GF2A 2X4HA 3CUQC 1MDMB 5E1ZB 3GEZA 1G3YA 1KYWA 4RGXA 2K86A 4KIFA 2WC2A 3ZQ7A 3BP8A 3CO6C 2XKPA 2OU2A 4MGRA 3LSTA 2RDPA 1ZREA 4A12A 3F8FA 4GYGA 4KA4A 2JSCA 3WTXC 2HTSA 4OIPF 5E1XA 3MCZA 2L4AA 5A2QZ 5E17F 1SMTA 1XGSA 1XSDA 3V8JA 1WKMA 1HSTA 1ZG3A 4RB1A 2YR2A 1UHWA 1S8NA 1OYIA 3JW4A 4O5VA 2IJLA 5LLQA 1ZLKA 3KEOA 4Y17A 3E6MA 1YLFA 2XAFA 4A6EA 2RC4A 2HZTA 3KP6A 2ETHA 1BJAA 2E7WA 4XBFA 2F5FA 3E5QA 1ZG1A 2EA2A 4KUMA 1HQCA 2QQBA 4KMFA 3E97A 1FC3A 1USTA 1G4DA 3FM5A 1QNTA 4S04A 4GYIA 3T0YA 2W25A 4EMSA 4DNCA 4ESJA 3DKWA 1IN5A 4LLGF 2AXLA 1K6OA 2VOPA 2CYYA 2YX4A 4KIBA 3WTTC 1ZARA 2W57A 4XSZF 5JR3A 4LMYA 3BJ6A 1ULYA 3VEPA 3V8KA 5LEJA 3DP7A 1ODDA 2A69F 4AIKA 4KICA 4O6JA 5AIQA 1YS7A 2LNBA 2H6BA 1OPCA 3BY6A 2BBYA 2M30A 3J81K 3SQNA 2G7HA 1V4RA 4HOBA 2YU3A 4KIGA 2V6CA 2OBPA 4I02A 2R7DA 5F64A 2IA0A 2EFOA 4CO8A 5E8IA 1P2FA 2AS5F 2NNYA 2P5LC 2ELHA 3MWMA 1T39A 2PMUA 3M9AA 1R5HA 4L5IA 4PGGA 5BPIA 2MA3A 2J5OA 1HBXG 4HLYA 3KZYA 4L0YB 3RI4A 1G3TA 2FBHA 1KQ8A 1MJBA 3IKTA 1P6RA 4G6QA 1O3TA 3RTRA 2RGVA 3FXUA 3M8FA 4I0AA 4I09A 1D8KA 3ZMVA 2HS5A 2CGPA 5JVTA 1J75A 1MD0A 3VODA 1T0FA 3F23A 2MLKA 3TKYA 2W85A 4M9XA 2JPCA 2O3FA 3OV8A 4M9SA 5K1YA 4F7ZA 3CUOA 4YFNF 3ABTA 4JQFA 4UVBA 5KVRA 4Q47A 2EFNA 4HQEA 2M5WA 5BQTA 3GW2A 2DO7A 1W7PB 3I4PA 1TQPA 2NS0A 2GZWA 5IT3A 3QU3A 1SFEA 4A0XA 4Y15A 3GFLA 4MEYF 4U7DA 4L9VA 2P6SA 2CFXA 5LGNA 2R3SA 1IAWA 3GZ6A 4U88A 4QLCU 5FGMA 4XLPF 2D45A 1VTNC 2Z3YA 2CW0F 3HSRA 1U5TB 3I54A 1BOAA 2IA1A 5E1WA 3U9GA 3HRMA 3IWZA 2BEOA 1I1SA 4HDUA 1I1GA 4D0PA 1AWCA 2IRFG 1EH7A 1WRJA 3W6KB 4HQMA 3F8CA 3ELKA 2HKXA 2P5KA 1O3RA 5CLSA 5J8FA 3G3ZA 2WV0A 4KN4X 2H94A 4PCQA 1RZ4A 1Z7UA 3F8BA 1BIAA 4L9TA 2HYFA 2EFQA 1TW2A 4UNOA 3ABUA 3CJNA 2GAUA 5TJJA 2ZMEB 1EV7A 1R1UA 1T6SA 1ZN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5D A;  1LDD A;  2DU9 A;  1XSX A;  4G94 A;  5LRR A;  5F6F A;  4Q5S F;  1GHC A;  1XGO A;  3V7C A;  2ISZ A;  4HW0 A;  1YQA A;  1REP C;  4LK0 F;  1S29 A;  3CLO A;  1HKS A;  2C6Y A;  4N9H A;  1FYM A;  4ZH4 F;  1S6L A;  2PEX A;  2A07 F;  4LFU A;  3PQJ A;  2L3D A;  5FD5 A;  1TLH B;  2F2E A;  3H92 A;  1R7J A;  4ZYG A;  4M6X A;  3HIF A;  2F5E A;  4FHT A;  3QP6 A;  3T1B A;  4YFX F;  3M8E A;  5K5O A;  2HYG D;  1KA8 A;  2DPD A;  2O03 A;  3RPQ A;  4ETS A;  2HQN A;  3BWG A;  1W7P A;  3G73 A;  3I59 A;  2WWY A;  2FSW A;  2E1C A;  3U1D A;  1IW7 F;  3WTV C;  4BHP A;  3T5X A;  1UFM A;  3F3X A;  4AWX B;  5FLX Z;  5LHI A;  4N0B A;  3L2C A;  5TRD A;  3FM3 A;  2CG4 A;  1MKM A;  2QBY B;  2DQL A;  3GXO A;  4MQV A;  2K4B A;  3WE3 A;  3CUQ B;  2OAZ A;  2M87 A;  1KU2 A;  2BE5 F;  3H3Z A;  4CYD A;  2OQR A;  1ZRF A;  2D1V A;  1WQ2 A;  2QQ9 A;  2FML A;  5DCM B;  1LB2 A;  3LFK A;  2QBY A;  2FF4 A;  1TBX A;  1FP1 D;  2XKO A;  1DP7 P;  2QVO A;  1LDJ A;  3KP7 A;  2BYV E;  3K1N A;  2X0L A;  3LWF A;  1FYL A;  1FBU A;  5DUK A;  1R1V A;  1SFX A;  3EYY A;  5E18 F;  1LEB A;  2L4M A;  2XUB A;  2WTE A;  1PUE E;  1CF7 A;  4BAY A;  2O0Y A;  1IXC A;  1ON1 A;  4I0B A;  2VC1 A;  3Q5F A;  2XAG A;  5J6X A;  1KQ0 A;  1R00 A;  3P9C A;  2XAH A;  3KE2 A;  4MNU A;  1QZZ A;  5IT9 Z;  4G7H F;  4HA8 A;  3HRU A;  3K1M A;  1J0R A;  3KFW X;  2Z9O A;  2ZO4 A;  1R36 A;  4IRI A;  1BI3 A;  4NB5 A;  3RKW A;  3TOB A;  4IRG A;  1KGS A;  3JAM K;  1O7F A;  1BI1 A;  4EJO A;  2XRO A;  3EDP A;  3FXR A;  1O57 A;  2PN6 A;  1IN8 A;  2DAO A;  3I64 A;  4KYW A;  4IF4 A;  2QEN A;  4BHB A;  5H20 A;  2DFI A;  1JE8 A;  2W24 A;  4A0Y A;  1YW7 A;  2P7V B;  4RS8 A;  2EK5 A;  3FXQ A;  1XMK A;  4P9U A;  3L09 A;  2EJR A;  5BPD A;  4L18 B;  4ENJ A;  4EVI A;  1B6A A;  1F5T A;  4JK1 X;  4HZF A;  4G8X A;  1W5T A;  4IPA A;  4M72 A;  4GGG A;  2HWV A;  5D6F A;  5DCF A;  1XMA A;  4UV9 A;  4KMU X;  5H6R A;  1D8J A;  2FXA A;  4U0V A;  1W7P D;  2GQQ A;  1FWZ A;  2L01 A;  3GZ5 A;  4A0Z A;  2UZK A;  3C1D A;  1J2X A;  4G6D A;  3DXJ F;  1K79 A;  3F6O A;  5D8K B;  2J5P A;  1BBY A;  5EEG A;  4P55 A;  3ZMU A;  5JI6 A;  3MZY A;  3Q9V A;  2HOE A;  2EFP A;  5BOX A;  1JHH A;  1XN7 A;  4I01 A;  3JTG A;  1LVA A;  3DF8 A;  3U2R A;  4CZZ A;  2ISY A;  2V9V A;  3WGG A;  1PDN C;  4WF2 A;  3T8T A;  1R1T A;  6PAX A;  2IA2 A;  2IPQ X;  2ZFW A;  3PFI A;  1U5T A;  4H0E A;  2A68 F;  2MD5 A;  1HW1 A;  4EM2 A;  4ESB A;  5HDK A;  1BN5 A;  3IL2 A;  5HS8 A;  4M9Z A;  2VE8 A;  4AVP A;  5ICG A;  2M8E A;  1HXD A;  3LA2 A;  2PMH A;  4HF1 A;  3TO6 A;  2Y0M A;  1S7A A;  4WWC A;  3ZMS A;  3GO5 A;  2EB7 A;  2G7U A;  3F21 A;  5LBQ A;  2PQ8 A;  2NAZ A;  3LQR A;  1BI2 A;  1OYW A;  4IXA A;  3E5U A;  3L00 A;  5DYM A;  5K5R A;  2VE9 A;  1U78 A;  2QYO A;  5D5V B;  3P9I A;  4LG0 B;  2QQA A;  1IZ1 A;  1KU7 A;  1U6G A;  2FE3 A;  3V4G A;  2LDU A;  1IN7 A;  1BI0 A;  3RKY A;  1BC8 C;  3R4K A;  4M73 A;  4A5N A;  3GWZ A;  2ZKZ A;  4O3M A;  3BOQ A;  1YFH A;  2ACJ A;  1FNN A;  5HLH A;  2IP2 A;  3DEU A;  1ZAO A;  2ZCW A;  4EJU A;  1Z6T A;  4LG0 A;  4HYE A;  1B1B A;  5HS7 A;  1R5G A;  3B73 A;  4OU0 A;  3J7A O;  3K1P A;  4Z2Y A;  2XV4 S;  4EJT A;  3KZZ A;  1XB4 A;  3TO9 A;  2VN2 A;  3WOD F;  5BS6 A;  1K7A A;  2HFH A;  5HLI A;  2BV6 A;  2HGC A;  3I0T A;  1T98 A;  1TW3 A;  2PFB A;  5DCM A;  4BYY A;  3WGH A;  2HTJ A;  1QO0 D;  2K02 A;  1UHM A;  4KNY A;  3QAH A;  3SZT A;  1JGS A;  2LSO A;  4MTD A;  3LA3 A;  2R7F A;  5A2Q K;  3LQQ A;  3QOP A;  1R23 A;  4Q48 A;  2VT3 A;  1J5Y A;  1I5Z A;  2EFW A;  5ICE A;  2STT A;  2DI3 A;  4WXD A;  1FBQ A;  2M1B A;  2FOK A;  1QZY A;  4NQW A;  4EQQ A;  3F8N A;  3R6S A;  4S05 A;  1ZGJ A;  2Q0O A;  2RKH A;  3L9F A;  4N9I A;  4UVA A;  3IRQ A;  1HKT A;  4MTE A;  3L7W A;  3BRO A;  1XGN A;  5FD6 A;  3TOA A;  4IHS A;  5L3C A;  1HSJ A;  5LGT A;  1ONV A;  2FBI A;  4DQ2 A;  5HS9 A;  2V79 A;  4GO1 A;  4OMZ A;  5LHH A;  1J9I A;  2VC0 A;  4RB3 C;  4EJW A;  3MAJ A;  4U0Y A;  1DUX C;  1FSH A;  4YFK F;  1LJ9 A;  3FMQ A;  4BNC A;  2FA5 A;  1LDK B;  1A04 A;  4HX4 A;  1SAX A;  4ZZL A;  3BDD A;  2MBF A;  3QU6 A;  3TO7 A;  4ZYE A;  2B0L A;  3NRV A;  1Z9C A;  2RQP A;  2NNN A;  3PQK A;  1O3S A;  4MQ9 F;  5ICC A;  4L5J A;  3WE2 A;  4I98 B;  1H9G A;  3IWF A;  3GUD A;  2Y75 A;  2RN7 A;  1BC7 C;  3RIR A;  3WTW C;  5E20 A;  2JZY A;  1GVJ A;  3CUQ A;  1B59 A;  3HOT A;  3E3V A;  1ZRC A;  3AAF A;  3ISP A;  5D5U B;  2E1N A;  4OIR F;  3NQO A;  1ZRD A;  3TQN A;  4RGU A;  5LHG A;  2ZXJ A;  4LJZ F;  1OMI A;  2DQR A;  3OOP A;  2MH9 A;  1E2X A;  2QZ8 A;  1Q1H A;  5L3E A;  1IRG A;  2L02 A;  4XRF A;  3FF5 A;  2A3S A;  3BPX A;  5ILU A;  2UXN A;  1SD7 A;  3C18 A;  1KU3 A;  5DD8 A;  3J80 K;  4LD5 A;  1FP2 A;  4RGS A;  2VXZ A;  4HF2 A;  5HVQ C;  1G6N A;  3K0L A;  1FLI A;  4EM1 A;  3HSE A;  5HLG A;  3EQL F;  5LGU A;  2IT0 A;  4UV8 A;  3HTS B;  4R1H A;  1U8R A;  2GWR A;  3KCC A;  3HYI A;  1J59 A;  1Z91 A;  4KN7 X;  3IC7 A;  2M45 A;  1YS6 A;  2H09 A;  5D8L B;  4HLX A;  5CVI A;  1XDS A;  3FMR A;  2IVM A;  3K69 A;  2A6E F;  2VON A;  1HKQ A;  3RKX A;  3ML6 A;  5DD4 A;  2EV0 A;  2PLY A;  1FZP B;  5F1R A;  5FLX K;  2OA4 A;  2K4J A;  1FY7 A;  2Z99 A;  4P9F A;  4UXN A;  2DLL A;  1P4X A;  1I6X A;  5E8G A;  1DPU A;  3TDZ C;  2F5C A;  3V7R A;  1IUY A;  4CIC A;  4ENK A;  3N97 A;  2VBZ A;  4BQA A;  2COM A;  5D4S A;  2Z5U A;  3I5U A;  3WTZ A;  1EH6 A;  1HW2 A;  3P7N A;  1TQM A;  3WTY C;  4HDV A;  3K2Z A;  3WU0 A;  3KP2 A;  2CQK A;  4GCV A;  2V1X A;  3KET A;  3GYH X;  2YX7 A;  4ESF A;  2FMY A;  3WTS C;  3E5X A;  2GA2 A;  1SMY F;  2HDC A;  3HSF A;  3F8M A;  1MJA A;  1F1Z A;  4L9N A;  1NHA A;  4IVN A;  3LAP A;  4I7H A;  2XAJ A;  2XVC A;  2DTR A;  3BJO A;  2ESH A;  5H6Q A;  3V7S A;  1KQ9 A;  5IT9 K;  4NHJ A;  1V3F A;  1OR7 A;  2QLZ A;  1C0W A;  3E6B A;  3C7J A;  3QPT A;  2LF8 A;  2A61 A;  3ULQ B;  3GFJ A;  2Q2E A;  4AIJ A;  1RI7 A;  2GXG A;  3JAM Z;  3ECH A;  3DPT A;  1YTY A;  4K2E A;  1YYV A;  3H3U A;  1Z6R A;  3NEU A;  4R8H A;  1FSE A;  2A6H F;  1PP8 F;  4UHT A;  3LAJ A;  2EV6 A;  2MLG A;  1F9N A;  1D5V A;  5JFR A;  1DDN A;  3ECO A;  3V8L A;  2H6C A;  4UUV A;  1B9M A;  3GLX A;  3JSP A;  5D6E A;  1IN6 A;  1T38 A;  1L0O C;  1QQI A;  2HKO A;  1USS A;  4P96 A;  5ICF A;  3JSO A;  2K7L A;  3HHG A;  2KIU A;  5ILS A;  3SXY A;  1EH8 A;  5D4R A;  4UVC A;  2W84 A;  1XDU A;  1MJ9 A;  1ZHF A;  4LB6 B;  5JHU A;  3K9T A;  3I53 A;  4LB5 A;  2HQR A;  3I71 A;  1CF7 B;  1YO5 C;  1Z1D A;  2XHK A;  1ZGA A;  1RIO H;  4P5O A;  2KKO A;  3RYP A;  5AON A;  1YW8 A;  3FX3 A;  4RB2 C;  3BPV A;  3CDH A;  2TDX A;  3BZ6 A;  1K78 A;  5LEK A;  1JHF A;  1I27 A;  2D2W A;  4IJA A;  3B02 A;  2VOO A;  1XD7 A;  3SFZ A;  3M1E A;  3E6C C;  5BMZ A;  2RV8 A;  1Y0U A;  1S3J A;  2XRN A;  2P6T A;  4OIN F;  4U0W A;  4WCG A;  1IRF A;  2ZNZ A;  4B8X A;  4U7B A;  2HEO A;  3CO7 C;  3ERE D;  2ADU A;  2JRT A;  1IF1 A;  1U3E M;  3ZMT A;  3DQV C;  2KJB A;  5AIP A;  3KP4 A;  1TNT A;  1XGM A;  2BGC A;  1XCB A;  3GFM A;  2D1H A;  2DW4 A;  5ED4 A;  4G9Y A;  2FU4 A;  4IHT A;  3LA7 A;  2EV5 A;  2OZ6 A;  1W5S A;  3RJP A;  5FFZ A;  2E7X A;  3M7G A;  4RAZ A;  3D0S A;  1YG2 A;  1H0M A;  2GA1 A;  1QGP A;  1OKR A;  2FBK A;  2P5V A;  4PZJ A;  5DEQ A;  2DPU A;  2YPR A;  4CDG A;  5DV5 A;  4XLN F;  4G7Z F;  3WGI A;  1BIB A;  4EM0 B;  1X3U A;  5KK1 A;  4ASN A;  4M6Y A;  4AIH A;  1O7L A;  4IRH A;  4LLN A;  3HOS A;  2JT1 A;  3EYI A;  4R79 A;  1RUN A;  1O3Q A;  4RGR A;  4WXH A;  1IXR C;  5DDG A;  3CTA A;  1YIO A;  3F22 A;  1T2K A;  4EJV A;  4BH9 A;  3EET A;  1F4K A;  3KP3 A;  2VBY A;  5L3G A;  5L3D A;  1G3W A;  3HTU A;  4KDP A;  4E70 A;  1P92 A;  4EGZ A;  4M74 A;  1CGP A;  3R61 A;  2A5Y B;  4YII A;  2L54 A;  1WSU A;  2VT2 A;  2NYX A;  2VBW A;  3COA C;  4FX4 A;  2Y48 A;  3R0A A;  2CWE A;  4Y13 A;  2LKP A;  4ZZD A;  2H27 A;  5CVJ A;  3KP5 A;  1GXP A;  2O6G E;  2ESN A;  1RUO A;  2OD5 A;  3J81 Z;  4L0Z B;  1TQI A;  3FZV A;  2FNA A;  4A2U A;  1TTY A;  2O61 A;  2RVC A;  4LGW A;  1K78 B;  4OOI A;  4CGZ A;  4KT5 C;  5CJ9 A;  2STW A;  3ZN0 A;  2DK8 A;  4YG2 F;  3ZMD A;  2JTV A;  3P9K A;  2QUF A;  4ON0 A;  4LK1 F;  1FT9 A;  5L3F A;  4WX9 A;  3S2W A;  1QBJ A;  3T8R A;  4I2O A;  3F6V A;  2UWM A;  2GXB A;  4CXF A;  5FFX A;  2OZU A;  1WWX A;  3SZP A;  3HHH A;  3GX4 X;  4ENN A;  2G9W A;  3DFG A;  3KLN A;  1D3Y A;  3FMS A;  1MGT A;  4HAM A;  4LLL A;  4WK8 F;  3ROU A;  3WU1 B;  3ZPL A;  1FX7 A;  5HOO A;  2PBI A;  3DPL C;  2KIF A;  3O6B B;  3IRR A;  1ZYR F;  3GVA A;  4A6D A;  1LQ1 A;  5EEH A;  1FYK A;  2LF7 A;  4M71 A;  2PI0 A;  1LEA A;  3C3W A;  2FNP A;  2QM3 A;  4MHG A;  1AOY A;  4JBA A;  1XCV A;  3RDI A;  3IKV A;  2KIM A;  1ZH5 A;  1GXQ A;  4HF0 A;  2XIG A;  4ENM A;  3FWE A;  2CSO A;  1SD4 A;  5D5X B;  2VOD A;  4PGH A;  4KFC A;  4L9J A;  4OIQ F;  1R58 A;  1XSV A;  1U2W A;  1ON2 A;  4QWQ A;  4HV6 A;  1FBS A;  3KLO A;  2FRH A;  1STZ A;  1B4A A;  4B09 A;  1W4M A;  4A5M A;  5HDN A;  2ZBK A;  1IN4 A;  1WI9 A;  1KU9 A;  1J7K A;  4RAY A;  2GIV A;  4MEX F;  1QPM A;  1ZLJ A;  4OIO F;  3R0J A;  3HUG A;  5D5W B;  1S7O A;  1LNW A;  3ZMZ A;  4FT8 A;  4WXC A;  4TV7 A;  2MH2 A;  4HX7 A;  2EA4 A;  2KJC A;  3O2P E;  2XAQ A;  1UCR A;  3MZH A;  4XSX F;  3SHF A;  3DV8 A;  1KYZ A;  1Z05 A;  4FX0 A;  2RNJ A;  3F72 A;  5ILV A;  1YW9 A;  2ZME A;  3RPU A;  3VB2 A;  5CVR A;  3TDU C;  2Q8K A;  2O8X A;  2K27 A;  3WTU C;  4EV0 A;  1B9N A;  4BXU A;  1FOK A;  3VFZ A;  1U5T C;  2MC3 A;  2XGX A;  4ZYH A;  1L3L A;  3MEX A;  4PDK A;  2PJP A;  4RB0 A;  1RNL A;  3W6J B;  5CVV A;  3N4M A;  1DPR A;  3HRT A;  2JPB A;  5LRS A;  4HX8 A;  1R22 A;  2P8T A;  1MDM A;  4OMY A;  1FPQ A;  2YSR A;  1P4W A;  1MZB A;  4BHC A;  4EGY A;  5CVU A;  5K5Q A;  3RYR A;  3GFI A;  2P7C B;  3TGN A;  1SD6 A;  1H9T A;  3Q9S A;  5FO5 A;  3D5L A;  1UB9 A;  3I58 A;  5ERI A;  4ZYD A;  2UXX A;  4GXO A;  4HBL A;  2VBX A;  4CHU A;  5J8C A;  3O3K A;  3REO A;  3IHU A;  1JXS A;  5DUI A;  3JTH A;  3E6D A;  2CO5 A;  2XAS A;  1SFU A;  3MFK A;  1E17 A;  1HW5 A;  4HV5 A;  4AD9 A;  2V1U A;  1PP7 U;  2ZNY A;  3BJA A;  2V1D A;  3ZP5 A;  3R60 A;  5CYV A;  5HDG A;  3ZN1 A;  2DT5 A;  2DBB A;  2EWN A;  1G3S A;  2KRF A;  3MQ0 A;  3HRS A;  4G7O F;  5L3B A;  3J80 Z;  2HR3 A;  5FB2 A;  2Z33 A;  1P4A A;  3KEQ A;  3QPH A;  1TNS A;  2PG4 A;  3VOE A;  2FQ3 A;  1IXS B;  2FEZ A;  2NRA C;  2P4W A;  4YIF A;  3FHZ A;  2OQG A;  3QP5 A;  3WG9 A;  2QWW A;  4Q4Z F;  2IW5 A;  2DK5 A;  1ZG5 A;  3EUH A;  3QRF F;  1BM9 A;  2ZJ2 A;  1OYY A;  3I59 B;  1SD5 A;  3GF2 A;  2X4H A;  3CUQ C;  1MDM B;  5E1Z B;  3GEZ A;  1G3Y A;  1KYW A;  4RGX A;  2K86 A;  4KIF A;  2WC2 A;  3ZQ7 A;  3BP8 A;  3CO6 C;  2XKP A;  2OU2 A;  4MGR A;  3LST A;  2RDP A;  1ZRE A;  4A12 A;  3F8F A;  4GYG A;  4KA4 A;  2JSC A;  3WTX C;  2HTS A;  4OIP F;  5E1X A;  3MCZ A;  2L4A A;  5A2Q Z;  5E17 F;  1SMT A;  1XGS A;  1XSD A;  3V8J A;  1WKM A;  1HST A;  1ZG3 A;  4RB1 A;  2YR2 A;  1UHW A;  1S8N A;  1OYI A;  3JW4 A;  4O5V A;  2IJL A;  5LLQ A;  1ZLK A;  3KEO A;  4Y17 A;  3E6M A;  1YLF A;  2XAF A;  4A6E A;  2RC4 A;  2HZT A;  3KP6 A;  2ETH A;  1BJA A;  2E7W A;  4XBF A;  2F5F A;  3E5Q A;  1ZG1 A;  2EA2 A;  4KUM A;  1HQC A;  2QQB A;  4KMF A;  3E97 A;  1FC3 A;  1UST A;  1G4D A;  3FM5 A;  1QNT A;  4S04 A;  4GYI A;  3T0Y A;  2W25 A;  4EMS A;  4DNC A;  4ESJ A;  3DKW A;  1IN5 A;  4LLG F;  2AXL A;  1K6O A;  2VOP A;  2CYY A;  2YX4 A;  4KIB A;  3WTT C;  1ZAR A;  2W57 A;  4XSZ F;  5JR3 A;  4LMY A;  3BJ6 A;  1ULY A;  3VEP A;  3V8K A;  5LEJ A;  3DP7 A;  1ODD A;  2A69 F;  4AIK A;  4KIC A;  4O6J A;  5AIQ A;  1YS7 A;  2LNB A;  2H6B A;  1OPC A;  3BY6 A;  2BBY A;  2M30 A;  3J81 K;  3SQN A;  2G7H A;  1V4R A;  4HOB A;  2YU3 A;  4KIG A;  2V6C A;  2OBP A;  4I02 A;  2R7D A;  5F64 A;  2IA0 A;  2EFO A;  4CO8 A;  5E8I A;  1P2F A;  2AS5 F;  2NNY A;  2P5L C;  2ELH A;  3MWM A;  1T39 A;  2PMU A;  3M9A A;  1R5H A;  4L5I A;  4PGG A;  5BPI A;  2MA3 A;  2J5O A;  1HBX G;  4HLY A;  3KZY A;  4L0Y B;  3RI4 A;  1G3T A;  2FBH A;  1KQ8 A;  1MJB A;  3IKT A;  1P6R A;  4G6Q A;  1O3T A;  3RTR A;  2RGV A;  3FXU A;  3M8F A;  4I0A A;  4I09 A;  1D8K A;  3ZMV A;  2HS5 A;  2CGP A;  5JVT A;  1J75 A;  1MD0 A;  3VOD A;  1T0F A;  3F23 A;  2MLK A;  3TKY A;  2W85 A;  4M9X A;  2JPC A;  2O3F A;  3OV8 A;  4M9S A;  5K1Y A;  4F7Z A;  3CUO A;  4YFN F;  3ABT A;  4JQF A;  4UVB A;  5KVR A;  4Q47 A;  2EFN A;  4HQE A;  2M5W A;  5BQT A;  3GW2 A;  2DO7 A;  1W7P B;  3I4P A;  1TQP A;  2NS0 A;  2GZW A;  5IT3 A;  3QU3 A;  1SFE A;  4A0X A;  4Y15 A;  3GFL A;  4MEY F;  4U7D A;  4L9V A;  2P6S A;  2CFX A;  5LGN A;  2R3S A;  1IAW A;  3GZ6 A;  4U88 A;  4QLC U;  5FGM A;  4XLP F;  2D45 A;  1VTN C;  2Z3Y A;  2CW0 F;  3HSR A;  1U5T B;  3I54 A;  1BOA A;  2IA1 A;  5E1W A;  3U9G A;  3HRM A;  3IWZ A;  2BEO A;  1I1S A;  4HDU A;  1I1G A;  4D0P A;  1AWC A;  2IRF G;  1EH7 A;  1WRJ A;  3W6K B;  4HQM A;  3F8C A;  3ELK A;  2HKX A;  2P5K A;  1O3R A;  5CLS A;  5J8F A;  3G3Z A;  2WV0 A;  4KN4 X;  2H94 A;  4PCQ A;  1RZ4 A;  1Z7U A;  3F8B A;  1BIA A;  4L9T A;  2HYF A;  2EFQ A;  1TW2 A;  4UNO A;  3ABU A;  3CJN A;  2GAU A;  5TJJ A;  2ZME B;  1EV7 A;  1R1U A;  1T6S A;  1ZN2 A; 
#chains in the Genus database with same CATH topology
 2F5D A;  1LDD A;  3ZR8 X;  1VQM I;  4XKV A;  2DU9 A;  1XSX A;  4G94 A;  5LRR A;  3G1M A;  3MN2 A;  5F6F A;  4Q5S F;  4PSW A;  3K10 A;  1GHC A;  1QPI A;  1XGO A;  1TP4 A;  3V7C A;  1JJ8 C;  2ISZ A;  3OYH A;  2E36 A;  2AQF A;  4HW0 A;  2F4I A;  1Y8R B;  3DPU A;  3OYD A;  1R49 A;  2Z16 A;  3DLL F;  2X1D A;  3CCL I;  1YQA A;  2MAB A;  3RKQ A;  1REP C;  4LK0 F;  2W4S A;  3PUB A;  1S29 A;  3CLO A;  1U9O A;  1HKS A;  2C6Y A;  1VFC A;  4N9H A;  1FYM A;  1VQ4 I;  4ZH4 F;  4BQQ A;  1S6L A;  2VJJ A;  1JGG A;  2PEX A;  2A07 F;  4AM3 A;  4LFU A;  3LSJ A;  3PQJ A;  4E6K G;  2L3D A;  5FD5 A;  2LVS A;  1TLH B;  2F2E A;  3GLL A;  3H92 A;  1R7J A;  1NK3 P;  4ZYG A;  3OYF A;  4M6X A;  4C30 A;  1IJW C;  2K9N A;  3ABL H;  3IH4 A;  4HEA 2;  4B1R A;  3HIF A;  2F5E A;  4BQN A;  4FHT A;  3QP6 A;  4I99 C;  3T1B A;  4YFX F;  4P1W A;  4J01 A;  3M8E A;  5K5O A;  1LKX A;  2GOM A;  2HYG D;  3AG3 H;  1P9Q C;  1KA8 A;  2DPD A;  2O03 A;  1ORK A;  3RPQ A;  4ETS A;  2HQN A;  1TWC J;  1YE9 A;  2L7M P;  2LRE A;  2NOG A;  1XS9 A;  3BWG A;  2DOA A;  4KIT B;  1W7P A;  1F43 A;  3A01 A;  2LYC A;  3G73 A;  3I59 A;  3S32 A;  3H9J A;  2FSW A;  2WWY A;  3E7L A;  2EPF A;  2E1C A;  1MW7 A;  4B43 A;  3U1D A;  1IW7 F;  3WTV C;  3NAR A;  4BHP A;  3T5X A;  4OAZ A;  1DQU A;  1UFM A;  3F3X A;  4AWX B;  5FLX Z;  3A1Y A;  5LHI A;  4N0B A;  3L2C A;  5TRD A;  3FM3 A;  3SDB A;  2CG4 A;  1MKM A;  4II3 A;  2QBY B;  2ICW G;  3DLA A;  1ETY A;  4HNT A;  2DQL A;  2AQE A;  1T56 A;  1U8B A;  1XTA A;  1TZL A;  3GXO A;  4MQV A;  2K4B A;  3WE3 A;  3CES A;  3CUQ B;  2OAZ A;  2W48 A;  3TL4 X;  2M87 A;  1KU2 A;  2BE5 F;  3H3Z A;  4CYD A;  5J4Y A;  3JRG A;  1TWF J;  1UHS A;  2OQR A;  1ZRF A;  4IHY A;  1MBE A;  2GBY A;  2D1V A;  2V1N A;  1WQ2 A;  2QQ9 A;  1X3Z B;  2FML A;  2VKH A;  1TC3 C;  5DCM B;  3F9K A;  1LB2 A;  3LFK A;  2QBY A;  2FF4 A;  3CCS I;  4DJA A;  1TBX A;  2E1O A;  1FP1 D;  5F27 A;  2XKO A;  3ZQL A;  4E7K A;  2LOO A;  1DP7 P;  1OCP A;  2QVO A;  1LDJ A;  2HU9 A;  2D5V A;  1MBH A;  2K3F A;  3KP7 A;  1J09 A;  3AKZ A;  2BYV E;  4BE1 A;  3K1N A;  2X0L A;  3LWF A;  1FYL A;  1FBU A;  5DUK A;  4FIS A;  2KT0 A;  1R1V A;  1SFX A;  2CW8 A;  3EYY A;  5E18 F;  1LEB A;  2L4M A;  3OS1 A;  2ECB A;  2XUB A;  2WTE A;  3OIP A;  2K3P A;  3M3Y J;  1PUE E;  1CF7 A;  4BAY A;  1TT5 B;  1IXC A;  1ON1 A;  2O0Y A;  4I0B A;  2BXZ A;  2VC1 A;  1K4S A;  3Q5F A;  2XPV A;  2XAG A;  3KYC B;  5J6X A;  1KQ0 A;  1R00 A;  3ERM A;  2R4G A;  1VZ0 A;  3P9C A;  2XAH A;  2V6E A;  3KE2 A;  4MNU A;  1X1D A;  1QZZ A;  5IT9 Z;  3A01 B;  4G7H F;  2E35 A;  3HRU A;  4HA8 A;  5FLV A;  3K1M A;  1J0R A;  3KFW X;  2Z9O A;  2ZO4 A;  1R36 A;  3OY9 A;  4IRI A;  1BI3 A;  3K7A J;  1FOY A;  4RAG A;  3OL3 A;  2JA5 J;  4NB5 A;  3RKW A;  1NH3 A;  3TOB A;  1WVR A;  4BDZ A;  3OS0 A;  4IRG A;  3CF5 F;  1KGS A;  2VQG A;  3JAM K;  1MIJ A;  2FD5 A;  1O7F A;  1BI1 A;  4EJO A;  2XRO A;  2NS7 A;  5J1R A;  3EDP A;  3FXR A;  3V42 A;  3EUA A;  1O57 A;  2PN6 A;  1IN8 A;  5IPA A;  2HNH A;  1VQK I;  2GLO A;  4ZTJ A;  2DAO A;  3I64 A;  3WHB A;  4ZDP A;  4KYW A;  2LRD A;  4IF4 A;  2R7R A;  2HXI A;  4PJM A;  2QEN A;  5E3N A;  3ZXS A;  4BHB A;  3W6V A;  5H20 A;  2DFI A;  5H2F C;  1JE8 A;  2W24 A;  4A0Y A;  1YW7 A;  2P7V B;  2DYS H;  2JQ7 A;  2XB0 X;  2R7S A;  4RS8 A;  2EK5 A;  3I56 I;  3FXQ A;  1XMK A;  1T33 A;  4P9U A;  2BOL A;  3L09 A;  3PSI A;  3C2G A;  3VDX A;  2EJR A;  5BPD A;  4L18 B;  4ENJ A;  2QKL B;  1JKP C;  4EVI A;  2AXT C;  1B6A A;  1F5T A;  4JK1 X;  1FOW A;  5EDN A;  4CCO A;  4HZF A;  4G8X A;  1W5T A;  4G6T B;  4D7N A;  2DMT A;  4HNV A;  4IPA A;  1QZE A;  4M72 A;  4GGG A;  5TGT A;  4NC6 A;  5M5Y J;  2HWV A;  3FBN B;  1MBJ A;  3FXO A;  5D6F A;  1SC7 A;  1S5L C;  3IP4 B;  1R71 A;  1TT0 A;  3JRB A;  1DGR M;  3ZQG A;  1FMV A;  3K4J A;  4FQG A;  1XMA A;  4UV9 A;  5DCF A;  4XOT A;  4KMU X;  5H6R A;  4ITV A;  3U1K A;  3UR3 C;  4IZZ A;  2L9N A;  3PSF A;  3K4B A;  3LMM A;  1D8J A;  2FXA A;  3EPZ A;  4U0V A;  3BR0 A;  1GT0 C;  2JA6 J;  1W7P D;  2GQQ A;  1FWZ A;  2JJ7 A;  2L01 A;  3GZ5 A;  5JHF A;  3HM5 A;  5GPC A;  4A0Z A;  2UZK A;  2ZJQ F;  2HOT A;  5EYR A;  3C1D A;  1V54 H;  1J2X A;  4G6D A;  3DXJ F;  4NBQ A;  1K79 A;  3F6O A;  4A69 C;  2EIL H;  2COB A;  2XB5 A;  5D8K B;  2J5P A;  1BBY A;  1RET A;  1S7E A;  4LG3 A;  5EEG A;  4P55 A;  3ZMU A;  5JI6 A;  3HOZ J;  3MZY A;  3Q9V A;  3S2D J;  2HOE A;  2UUZ A;  3OYK A;  2EFP A;  4XN3 A;  5BOX A;  5CKT A;  1JHH A;  1M1E B;  1XN7 A;  4I01 A;  3JTG A;  2CUF A;  1LVA A;  3KEY A;  3AL0 B;  3PJR A;  3SEQ A;  3L2Q A;  3DF8 A;  3U2R A;  1BR4 A;  4CZZ A;  2ISY A;  3CCM I;  1IC8 A;  1ZQ3 P;  2V9V A;  4XKW A;  3WGG A;  2OTL I;  3JRI A;  1B72 A;  1PDN C;  5FLM J;  3D5R C;  2JUG A;  3OYE A;  4WF2 A;  3C2H A;  4JP0 A;  3T8T A;  2F6C A;  1R1T A;  4F91 B;  2IA2 A;  2IPQ X;  6PAX A;  2DA4 A;  2EQR A;  2ZFW A;  3PFI A;  3P5J A;  1U5T A;  3HL2 A;  4H0E A;  2A05 A;  2A68 F;  2MD5 A;  1HW1 A;  4EM2 A;  4UB6 C;  2LR8 A;  4ESB A;  2OJE D;  3FKI J;  5HDK A;  4IO9 F;  1IV8 A;  4RDU A;  1BN5 A;  3IL2 A;  3OIQ A;  3Q3S A;  5E79 C;  5HS8 A;  1Z3Y A;  2VE8 A;  3O8H A;  4M9Z A;  4AVP A;  3G71 I;  5ICG A;  2M8E A;  4IEJ A;  2KDZ A;  1HXD A;  1AKH A;  3LA2 A;  2PMH A;  4HF1 A;  1R4N B;  1Y0N A;  3FDY A;  2Y0M A;  1S7A A;  3TO6 A;  4Y4R A;  4WWC A;  3ZMS A;  5GAG J;  3GO5 A;  1T6S A;  2EB7 A;  2G7U A;  2X6O A;  3VSK A;  3F21 A;  1DU0 A;  5LBQ A;  2OF7 A;  1S9H A;  4U87 A;  2PQ8 A;  3DBR B;  1R5I D;  2NAZ A;  1EJ9 A;  3LQR A;  3H0G J;  4HNU A;  1BI2 A;  4RLQ A;  4E7L A;  1PUF A;  2WY8 Q;  1MNE A;  3H9Q A;  1OYW A;  2CS3 A;  4IXA A;  2VUM J;  3E5U A;  1X4O A;  3L00 A;  5DYM A;  5K5R A;  2VE9 A;  4LOC A;  1U78 A;  2QYO A;  5FRO A;  5D5V B;  2ZXI A;  3P9I A;  4LG0 B;  2QQA A;  4A3J J;  1IZ1 A;  5FKN A;  3I3L A;  9ANT A;  3I55 I;  1KU7 A;  3L2U A;  1U6G A;  4ZYA A;  2FE3 A;  3IAS 2;  3V4G A;  5M3F J;  2LDU A;  4Z6Y A;  1IN7 A;  1BI0 A;  2KRH A;  3RKY A;  1BC8 C;  2VXD A;  3R4K A;  2GOX B;  4M73 A;  1I3Q J;  5KHD A;  2R7W A;  1WJD A;  4A5N A;  3GWZ A;  2ZKZ A;  3C2B A;  4O3M A;  1WH7 A;  3BOQ A;  3D1N I;  1YFH A;  2ACJ A;  1FNN A;  5HLH A;  2IP2 A;  5FKO A;  3DEU A;  1ZAO A;  2ZCW A;  3CD6 I;  4EJU A;  1Z6T A;  4LG0 A;  4HYE A;  2WAD A;  1B1B A;  5HS7 A;  4DBQ A;  4XIC A;  1R5G A;  3B73 A;  4OU0 A;  4J00 A;  3J7A O;  3K1P A;  1D1C A;  2MD0 A;  4Z2Y A;  2XV4 S;  4EJT A;  2JN6 A;  3KZZ A;  4W97 A;  1Z21 A;  2BVL A;  2NVX J;  2XF6 A;  1XB4 A;  3TO9 A;  1LE8 A;  2VN2 A;  3WOD F;  3CCJ I;  5B66 C;  5BS6 A;  1K7A A;  2HFH A;  5HLI A;  4A3K J;  5B1A H;  1NK2 P;  2M4K A;  3WHC A;  2BV6 A;  2HGC A;  2JWT A;  1MMS A;  4D7M A;  3I0T A;  3HOV J;  1TL8 A;  1T98 A;  1TW3 A;  2PFB A;  3GTJ J;  3JCU C;  5DCM A;  4B47 A;  1QRY A;  3I4N J;  4BYY A;  3WGH A;  3HOX J;  3GTQ J;  3A0H C;  2HTJ A;  1QO0 D;  2VJI A;  2K02 A;  1UHM A;  1D0Z A;  3HGG A;  3LSR A;  1H89 C;  5F04 A;  4KNY A;  4I76 A;  3QAH A;  3K6G A;  3HXL A;  5KAI C;  3KYD B;  3SZT A;  1JGS A;  2RNG A;  2LSO A;  1HDP A;  4MTD A;  1AA7 A;  3FXM A;  2KMU A;  4XKB A;  3LA3 A;  2R7F A;  4ZDO A;  4CCJ A;  5A2Q K;  3LQQ A;  3QOP A;  3TW6 A;  1R23 A;  4Q48 A;  3QWL A;  2ZFU A;  4HPQ A;  2VT3 A;  1J5Y A;  1CQT A;  1JT6 A;  4BY7 J;  1I5Z A;  2EFW A;  5ICE A;  2STT A;  2DI3 A;  4WXD A;  1FBQ A;  4L5E A;  3NWS A;  1XMX A;  2M1B A;  2FOK A;  2KDO A;  4RMN A;  1QZY A;  3DTI A;  2HVS A;  4NQW B;  4NQW A;  4EQQ A;  3F8N A;  3R6S A;  4RA2 A;  1ZGJ A;  4S05 A;  2Q0O A;  2RKH A;  3Q0V A;  2LC2 A;  3I4M J;  3L9F A;  1FIA A;  4N9I A;  4UVA A;  3IRQ A;  1HKT A;  5EEA A;  1FIP A;  4MTE A;  3L7W A;  1QHG A;  3BRO A;  2V7F A;  3WU2 C;  1XGN A;  2CV1 A;  5FD6 A;  1QU3 A;  3S16 J;  3TOA A;  3LSM A;  3E0J B;  4IHS A;  5L3C A;  2OUM A;  1A5J A;  1ZEL A;  1HSJ A;  1AHD P;  1LPQ A;  3FXJ A;  5LGT A;  1ONV A;  1A31 A;  1ETO A;  5FJ8 J;  2FBI A;  4DQ2 A;  1WI3 A;  5HS9 A;  2V79 A;  4GO1 A;  1BR2 A;  1BOB A;  1BR1 A;  4OMZ A;  5LHH A;  2VC0 A;  1FTZ A;  1J9I A;  4RB3 C;  4EJW A;  3MAJ A;  4U0Y A;  3VWB A;  1DUX C;  4BE2 A;  1FSH A;  5GPA A;  4E7S A;  2X51 A;  2XC7 A;  2R5Y B;  4YFK F;  3ZQC A;  1LJ9 A;  1UG2 A;  4MLO A;  2DMQ A;  4OAY A;  1I6H J;  3DBL B;  3FMQ A;  3W2W A;  5KNL A;  4BNC A;  2HYJ A;  4PJ0 C;  3CCQ I;  2X1C A;  2ZSH B;  2DTZ A;  2KRC A;  2FA5 A;  4I6Z A;  4UUS B;  1LDK B;  1A04 A;  4HX4 A;  4Y7N J;  3OS2 A;  1SAX A;  1PJR A;  4ZZL A;  3BDD A;  2MBF A;  3QU6 A;  1R4M B;  2BHZ A;  2OTJ I;  3TO7 A;  4ZYE A;  2B0L A;  3CCU I;  2CH0 A;  3LOC A;  3NRV A;  3LSG A;  1GUU A;  4UB8 C;  3JR9 A;  3OSG A;  1Z9C A;  2RQP A;  2NNN A;  3PQK A;  1KON A;  1O3S A;  2XAU A;  4MQ9 F;  5ICC A;  4L5J A;  3WE2 A;  1B72 B;  4I98 B;  1H9G A;  3IWF A;  2FUG 2;  3GUD A;  2ZJP F;  2Y75 A;  2RN7 A;  1BC7 C;  3RIR A;  3DEW A;  4PFP A;  3WTW C;  4C3H J;  3PIO F;  4NUB A;  2E60 A;  3OYL A;  5E20 A;  2K9L A;  2JZY A;  3BG9 A;  1GVJ A;  3BQZ A;  1OQY A;  3GTP J;  3BZK A;  1GVD A;  4BQO A;  2DA1 A;  3CUQ A;  5J3L A;  4BGD A;  1B59 A;  1UEL B;  3CMM A;  2IGN A;  1XG1 A;  3HOT A;  3E3V A;  1ZRC A;  1U0J A;  1HCR A;  3AAF A;  3ISP A;  5D5U B;  3EUK L;  3VYT B;  1XPX A;  4RLF A;  2E1N A;  3SDG A;  1ERD A;  4MIM A;  4OIR F;  2DJN A;  2HXO A;  3NQO A;  1ZRD A;  1E3P A;  2HVR A;  1X1B A;  3TQN A;  2E2H J;  4RGU A;  5LHG A;  2ZXJ A;  4LJZ F;  2BY3 A;  1OMI A;  2NS8 A;  1Z0X A;  2DQR A;  3OOP A;  2MH9 A;  2XSD C;  1E2X A;  2QZ8 A;  2L9R A;  3L2V A;  1K6Y A;  1YX3 A;  4LIT A;  5EJC A;  1SAN A;  1Q1H A;  3GBG A;  1Z67 A;  5L3E A;  1IRG A;  2L02 A;  3ABK H;  4XRF A;  4XQF A;  3FF5 A;  1VQL I;  2A3S A;  2WBM A;  4IHW A;  3BPX A;  1W1W E;  5ILU A;  3MKZ A;  3BR1 A;  2UXN A;  1SD7 A;  1ZGW A;  3GZN B;  3C18 A;  1KU3 A;  3PNV A;  1I50 J;  5DD8 A;  4XLC A;  3L1P A;  3J80 K;  4LD5 A;  5IP6 A;  1FP2 A;  4RGS A;  2VXZ A;  4HF2 A;  5HVQ C;  1G6N A;  2LH9 A;  2L9S A;  3K0L A;  1FLI A;  4EM1 A;  3HSE A;  1N78 A;  2XSJ C;  5HLG A;  2IS2 A;  3FKJ A;  3CDI A;  3FK6 A;  4AYB N;  2R7X A;  3EQL F;  5F1J A;  5LGU A;  5DTD A;  2IT0 A;  1WJA A;  3H0D A;  3JRA A;  4UV8 A;  3HTS B;  4R1H A;  2L2O A;  1U8R A;  2GWR A;  2O7O A;  4XRS G;  3S1R J;  3KCC A;  3HYI A;  2VPL A;  1J59 A;  1Z91 A;  4KN7 X;  3IC7 A;  2M45 A;  1YS6 A;  2H09 A;  2LBF B;  5D8L B;  1HA8 A;  4HLX A;  5GAE J;  5CVI A;  2L7K A;  2WAF A;  2R7Z J;  1XDS A;  2LY9 A;  2XPW A;  3FMR A;  1X19 A;  1R9T J;  2IVM A;  3BTJ A;  3K69 A;  1PUF B;  2A6E F;  2VON A;  1HKQ A;  2IGO A;  3RKX A;  3ML6 A;  5DD4 A;  4E7I A;  2EV0 A;  2PLY A;  1FZP B;  3SJM A;  2ELJ A;  4XID A;  4BDY A;  5F1R A;  5FLX K;  2EBI A;  2XGD A;  3J7Z I;  3CCR I;  2OA4 A;  2VJ4 A;  3UNG C;  4Y33 A;  2VJ5 A;  3K4M A;  3BR6 A;  2K4J A;  1FY7 A;  2Z99 A;  2E2I J;  3OYJ A;  4P9F A;  2IGK A;  2FOW A;  4UXN A;  3MD2 A;  2DLL A;  1P4X A;  1I6X A;  2V4J C;  5E8G A;  1DPU A;  3TDZ C;  2JMW A;  3CCV I;  1VQO I;  2F5C A;  3V7R A;  2ME0 A;  5F0C A;  1IUY A;  4CIC A;  4ENK A;  3N97 A;  2DCE A;  2VBZ A;  4BQA A;  2CV0 A;  4J19 A;  2CU7 A;  2COM A;  1O4X A;  5D4S A;  2NVT J;  2Z5U A;  3I5U A;  3WTZ A;  1EH6 A;  3DU6 A;  1HW2 A;  1WJF A;  2IGM A;  3P7N A;  1TQM A;  3WTY C;  4HDV A;  3K2Z A;  2K9M A;  3LL7 A;  3WU0 A;  1I39 A;  3KP2 A;  1NG7 A;  1RR7 A;  4V2G A;  4E7H A;  2CQK A;  1OLT A;  2KLO A;  4GCV A;  4XOP A;  2K9S A;  2V1X A;  3KET A;  3CC4 I;  5FKK A;  2KHM A;  3GYH X;  2JA2 A;  2YX7 A;  4ESF A;  2XRL A;  1E3O C;  1Q1V A;  1A6I A;  3QOE A;  2FMY A;  3WTS C;  3E5X A;  2CUJ A;  1SMY F;  2GA2 A;  1BL0 A;  2FQ4 A;  2HDC A;  1ETX A;  3X2Q H;  2X1E A;  3DU5 A;  1VQ6 I;  3HSF A;  2E19 A;  3F8M A;  4FE4 A;  1MJA A;  1F1Z A;  3E1S A;  5C3E J;  2K40 A;  4L9N A;  3Q0U A;  1NHA A;  4IVN A;  3LAP A;  4I7H A;  2XAJ A;  2XVC A;  3HKZ N;  3G2B A;  1H8A C;  2HOS A;  1OCO H;  2DTR A;  3BJO A;  3PFY A;  3BG7 A;  2ESH A;  4DGW B;  5H6Q A;  1RKW A;  1OCZ H;  3SZG A;  3JRH A;  3CCE I;  2ZSI B;  4N4N B;  2CQX A;  1MSE C;  3W3C A;  3HBL A;  2LK2 A;  3V7S A;  1KQ9 A;  5IT9 K;  2HVQ A;  4NHJ A;  1V3F A;  1OR7 A;  2QLZ A;  1C0W A;  2M7A A;  3E6B A;  1UAA A;  2Y9Y A;  1SVM A;  3CF2 A;  3C7J A;  3QPT A;  2LF8 A;  4C9Y A;  1Z3X A;  2A61 A;  4BEH B;  3ULQ B;  1IDY A;  2R0Q C;  3GFJ A;  2Q2E A;  1D1B A;  3QYF A;  5JVG F;  4FCY A;  2ZXH A;  3DTK A;  2DOE A;  3TP3 A;  1RI7 A;  2GXG A;  4AIJ A;  3JAM Z;  4IQJ A;  3ECH A;  3DPT A;  1YTY A;  4K2E A;  1YYV A;  4HST A;  3HUG B;  4NC7 A;  3HOU J;  3H3U A;  1Z6R A;  3NEU A;  1K61 A;  1AKH B;  3S8P A;  1G2H A;  4QSH A;  4R8H A;  1PVE A;  4CYC B;  1FSE A;  1UZC A;  2A6H F;  1PP8 F;  4UHT A;  3LAJ A;  3K4N A;  3OYI A;  2EV6 A;  2K85 A;  1I3A A;  1T0F C;  2MLG A;  2DFF A;  1F9N A;  1D5V A;  1WFX A;  5M3M J;  5JFR A;  3OSF A;  3RCO A;  1DDN A;  3ECO A;  3V8L A;  2QGU A;  5GTI C;  2H6C A;  1ACI A;  4UUV A;  2HPI A;  4QIW N;  1B9M A;  3GLX A;  3JSP A;  3JRC A;  5D6E A;  4CA0 A;  1IN6 A;  4BBR J;  1T38 A;  3KYL A;  1L0O C;  3BCB A;  1QQI A;  2HKO A;  4HG2 A;  1Y39 A;  4XLE A;  1USS A;  4B4C A;  2BHY A;  3QPS A;  4P96 A;  2Y31 A;  5ICF A;  5EGO A;  2WAQ N;  3JSO A;  2I5U A;  2K7L A;  4JOM A;  2Y0S N;  3HHG A;  1OCT C;  2KIU A;  5FRM A;  5ILS A;  3SXY A;  4GFB A;  4PJJ A;  3B6C A;  5K7H A;  1EH8 A;  4EAT A;  3IUO A;  2KIS A;  2F48 A;  1X4P A;  5D4R A;  1LFU P;  4UVC A;  3LNQ A;  2W84 A;  1XDU A;  2UV1 A;  3DBH B;  1MJ9 A;  1OFC X;  2A5W A;  4YRV A;  4AU7 A;  1ZHF A;  4LB6 B;  3GTG J;  3K4L A;  5TIS C;  5IOZ A;  2M8G X;  2M0M A;  4F93 B;  4B44 A;  5JHU A;  3K9T A;  3KPH A;  2EH3 A;  1TWA J;  3S15 J;  3I53 A;  4LB5 A;  2HQR A;  3I71 A;  1BJZ A;  2X48 A;  4PFO A;  2DDB A;  1WGX A;  2QCO A;  2WY7 Q;  3S3M A;  4AC0 A;  1WJ5 A;  5F08 A;  1CF7 B;  1YO5 C;  1Z1D A;  2XHK A;  4AYB A;  4Y52 J;  3OYB A;  1HDD C;  1ZGA A;  1RIO H;  4P5O A;  2KKO A;  3RYP A;  3ZQI A;  5AON A;  1YW8 A;  3FX3 A;  4RB2 C;  3IV5 A;  3BPV A;  3OYM A;  3CDH A;  2XF7 A;  2G0E A;  1T95 A;  2TDX A;  4M3F A;  1OIS A;  3BZ6 A;  3IH3 A;  1K78 A;  5LEK A;  4FE7 A;  4MFD A;  1Y6I A;  2F4M B;  2CQQ A;  1JHF A;  4D5F A;  3AG4 H;  1I27 A;  4A3C J;  2D2W A;  5GAH J;  2E2J J;  4IJA A;  3B02 A;  1G8X A;  2VOO A;  1WJC A;  1XD7 A;  3M1E A;  1MMA A;  3SFZ A;  3E6C C;  2R7Q A;  4ZTF A;  5BMZ A;  2KIQ A;  2RV8 A;  4ZJZ A;  2ZJR F;  1Y0U A;  1S3J A;  2XRN A;  2P6T A;  2Z1D A;  1FTT A;  2HI3 A;  4OIN F;  4U0W A;  4YEL A;  4WCG A;  3QYB A;  2DMP A;  3CZ6 A;  4BAC A;  2DT7 B;  1IRF A;  2ZNZ A;  4B8X A;  3H5R A;  4U7B A;  2HEO A;  3CO7 C;  1APL C;  2H8R A;  1ENH A;  2ADU A;  2JRT A;  3ERE D;  1N77 A;  3CJR B;  3BG6 A;  3ZMT A;  1U3E M;  1IF1 A;  3DQV C;  5KAF C;  2KJB A;  5AIP A;  3RPU D;  2H1K A;  3KP4 A;  4F55 A;  2CQ7 A;  1TNT A;  1XGM A;  3TP0 A;  2BGC A;  2KZG A;  1XCB A;  4BBS J;  3GFM A;  4PSX A;  2KL4 A;  2D1H A;  2DW4 A;  5ED4 A;  1YJ9 I;  4G9Y A;  4BJT A;  2FU4 A;  3PNT A;  1WCM J;  4IHT A;  3LA7 A;  1W36 C;  2M4G A;  1BW6 A;  2EV5 A;  1A6Q A;  1X1P A;  2OZ6 A;  4DBR A;  1W5S A;  3RJP A;  1SVL A;  5FFZ A;  2E7X A;  3M7G A;  4CYC A;  2CQN A;  3GCM A;  4RAZ A;  2IS6 A;  3D0S A;  1YG2 A;  2JUC A;  3HZJ A;  3CJQ B;  1H0M A;  3GTM J;  1LFB A;  2GA1 A;  1IGN A;  4CCM A;  1QGP A;  2O8K A;  2M7B A;  3HC7 A;  1OKR A;  2FBK A;  2IXS A;  2P5V A;  4PZJ A;  4BE0 A;  3ASN H;  5DEQ A;  3MKW B;  2DPU A;  2YPR A;  3HG9 A;  4CDG A;  3H9G A;  5DV5 A;  4XLN F;  4G7Z F;  3WGI A;  2HOA A;  1NG6 A;  1VQN I;  1Y1W J;  2V26 A;  3NAU A;  4YIR X;  4A3F J;  4M3D A;  1BIB A;  3MZ8 A;  4EM0 B;  2R7T A;  1X3U A;  2DA7 A;  1VND A;  5KK1 A;  1V5G A;  4ASN A;  2Y69 H;  3ZCO A;  2ID6 A;  2IS1 A;  3BR5 A;  2L5Q A;  5J1U A;  4M6Y A;  4AIH A;  3S1N J;  1O7L A;  4DIQ A;  4IRH A;  4LLN A;  3TBI A;  3FXL A;  5CQE A;  3HOS A;  2JT1 A;  3EYI A;  5HOD A;  4R79 A;  1RUN A;  1O3Q A;  2NVY J;  4RGR A;  3H36 A;  4WXH A;  1IXR C;  1T8I A;  3HKZ A;  5DDG A;  1B8I A;  3CTA A;  1JTX A;  4HSR A;  1YIO A;  5FKM A;  3F22 A;  1T2K A;  4EJV A;  4BH9 A;  3H1C A;  1Y8Q B;  3BLY A;  3EET A;  1F4K A;  4XLF A;  2MW8 A;  3KP3 A;  2QKM B;  2VBY A;  4MO7 A;  1ZRE A;  2CW7 A;  5L3G A;  3BR3 A;  2VIX A;  2EIM H;  5L3D A;  1HF0 A;  2N8G A;  5J4V A;  2NOJ B;  2X6X A;  4GRI A;  1G3W A;  1YHQ I;  2VQH A;  3TW7 A;  3CC7 I;  4B3A A;  3HTU A;  2CUE A;  4AID A;  2VQL A;  4DYQ A;  4E70 A;  4KDP A;  1P92 A;  1VQ5 I;  2LD5 A;  4NC8 A;  2VQC A;  2V9K A;  5B3S H;  3DKX A;  2YU9 J;  1HOM A;  2RRE A;  3GME A;  1JKO C;  4EGZ A;  4XRS A;  2E5N A;  4M74 A;  1P7I A;  1IV6 A;  1DGW Y;  1CGP A;  4E7Z A;  3R61 A;  5B1B H;  2A5Y B;  2W00 A;  4BS9 A;  4YII A;  2L54 A;  3QOD A;  1WSU A;  3DCF A;  5EZH A;  1VI0 A;  2GM4 A;  2MGQ A;  2NYX A;  2VBW A;  2EIN H;  2VT2 A;  3COA C;  4FX4 A;  4HRI A;  2Y48 A;  1N25 A;  3R0A A;  2B63 J;  2CWE A;  4D1Q A;  4Y13 A;  3L2R A;  2LKP A;  5CQG A;  3S1Q J;  4ZZD A;  2VLA A;  3OIO A;  2H27 A;  2QA4 I;  2VKD A;  5CVJ A;  4F3Q A;  2FJ1 A;  2EZH A;  2QQ8 A;  2VI6 A;  1MSF C;  3KP5 A;  1FOX A;  1GXP A;  5DS9 A;  2R92 J;  4LIV A;  1SAU A;  4ZC3 A;  2O6G E;  2ESN A;  2YS9 A;  2HQA A;  4RM2 A;  1RUO A;  2OD5 A;  3J81 Z;  1TQI A;  4L0Z B;  3FZV A;  2Q2E B;  2FNA A;  4A2U A;  3A02 A;  1TTY A;  2JSP A;  2O61 A;  1YI2 I;  2RVC A;  4LGW A;  1K78 B;  1MND A;  4OOI A;  1FJL A;  4CGZ A;  2M34 A;  4KT5 C;  1RPW A;  2MYS A;  5CJ9 A;  2STW A;  2JVG A;  2XGE A;  2Y0S A;  3ZN0 A;  5LD2 C;  2DK8 A;  3L2W A;  3BTC A;  1IRZ A;  1RES A;  2CUZ A;  4YG2 F;  2DMN A;  2KQR A;  3ZMD A;  2DFH A;  2JTV A;  3P9K A;  4A3D J;  2QUF A;  4BXF A;  2JA8 J;  4ON0 A;  3OR2 C;  3VPR A;  4LK1 F;  1FMW A;  5HLT A;  2KP6 A;  4BJ5 C;  1FT9 A;  1MH3 A;  5FKL A;  3ZQQ A;  5EZG A;  3ZQF A;  5L3F A;  4WX9 A;  2IBD A;  3S2W A;  1D5Y A;  1QBJ A;  3T8R A;  4I2O A;  4IOC F;  2BW3 B;  5DM7 F;  3LSH A;  3DTE A;  3F6V A;  1VQ8 I;  2UWM A;  3ZOB A;  1D0Y A;  4M3E A;  4XOR A;  1YJW I;  2GXB A;  4CXF A;  5FFX A;  2OZU A;  1WWX A;  1T08 B;  3SZP A;  1HLV A;  3HHH A;  2XGC A;  3AG1 H;  3GX4 X;  4ENN A;  1MMD A;  2G9W A;  3DFG A;  3KLN A;  1D3Y A;  2DA3 A;  2WV1 A;  3FMS A;  1MGT A;  2WB1 N;  4HAM A;  4LLL A;  1MNM C;  4WK8 F;  3ROU A;  3WU1 B;  2MC4 A;  3M4O J;  1FX7 A;  5HOO A;  3ZPL A;  4A93 J;  4A3B J;  1X2M A;  4BEH A;  2DJI A;  2I8D A;  5KCM A;  2PBI A;  2O9L A;  3OR1 C;  1MBK A;  3DPL C;  3H5A A;  2KIF A;  3O6B B;  4FET A;  2HDD A;  3IRR A;  1ZYR F;  3GVA A;  4A6D A;  2DA6 A;  1LQ1 A;  5EEH A;  2LY1 A;  1FYK A;  2LF7 A;  4M71 A;  2LG4 A;  4M3G A;  2PI0 A;  1LEA A;  1K83 J;  3C3W A;  2FNP A;  3A0B C;  3CME I;  2QM3 A;  3BTI A;  4MHG A;  1UG0 A;  4JBA A;  1AOY A;  3OMY A;  2JRM A;  1XCV A;  3RDI A;  2NVQ J;  3IKV A;  3I9V 2;  4C2T A;  2KIM A;  2LY2 A;  1ZH5 A;  1GXQ A;  4HF0 A;  2XIG A;  4ENM A;  2L7Z A;  3FWE A;  4Y3O A;  2CSO A;  1SD4 A;  3K4C A;  5D5X B;  1YIJ I;  2VOD A;  4PGH A;  4KFC A;  4L9J A;  4OIQ F;  1R58 A;  1TWH J;  1XSV A;  3CP8 A;  1U2W A;  1ON2 A;  2BZT A;  1HC8 A;  4E7J A;  3S17 J;  2LMD A;  1XC5 A;  2BVM A;  2MG4 A;  3K4K A;  4QWQ A;  5CPR B;  1A35 A;  4HV6 A;  1IDZ A;  4E4H A;  2DA2 A;  1FBS A;  3KLO A;  2K9Q A;  2FRH A;  3BG3 A;  4QPO A;  5IYC J;  1STZ A;  4X1E A;  1B4A A;  4CSW A;  5HNF A;  2R7U A;  4B09 A;  1W4M A;  4A5M A;  1EA3 A;  5HDN A;  1UJ8 A;  2ZBK A;  4A3M J;  3JRE A;  1ITY A;  1IN4 A;  3CP2 A;  1WI9 A;  1KU9 A;  4UUS A;  3CLQ A;  4NNJ A;  1J7K A;  4RAY A;  1ETQ A;  2GIV A;  4MEX F;  3W2A A;  3ONQ A;  1RR8 C;  1QPM A;  1JUM A;  3AL0 C;  1ZLJ A;  2TCT A;  5C4J J;  4OIO F;  3R0J A;  3HUG A;  5D5W B;  2MFZ A;  4CZC A;  3CC2 I;  1S7O A;  5GAD J;  3FHN A;  1LNW A;  3ZMZ A;  4FT8 A;  3S14 J;  3ZQH A;  3HPG A;  4DZP A;  1RKT A;  3F0C A;  4WXC A;  4TV7 A;  1WPK A;  2QSG X;  2MH2 A;  4HX7 A;  2CMP A;  2V9P A;  3ESW B;  1GV5 A;  2EA4 A;  4BJ6 C;  2KJC A;  3O2P E;  2XAQ A;  1UCR A;  3MZH A;  2XF5 A;  4XSX F;  3SHF A;  2ZB9 A;  3FBI B;  2LFB A;  3DV8 A;  1Y56 A;  2KFD A;  1KYZ A;  1Z05 A;  4FX0 A;  2RNJ A;  3F72 A;  5E3L A;  5ILV A;  1WHU A;  1YW9 A;  2ZME A;  3QYE A;  5J40 A;  3RPU A;  3LSP A;  1GDT A;  1MH4 A;  3VB2 A;  2L9V A;  5CVR A;  3TDU C;  2Q8K A;  2O8X A;  2K27 A;  3D5S C;  3WTU C;  4EV0 A;  1B9N A;  3K2A A;  4BXU A;  1FOK A;  1LFP A;  4A3L J;  1BA5 A;  4C3I J;  1LE8 B;  3CMA I;  2R5Z B;  2JA7 J;  1WJE A;  5EF6 A;  4X0G A;  3OYC A;  3VFZ A;  1U5T C;  3VYR B;  4CCN A;  2NXN B;  4IOA F;  2PX9 A;  4ANJ A;  2MC3 A;  3CDL A;  2XGX A;  4ZYH A;  1L3L A;  3MEX A;  4A3E J;  3H35 A;  4PDK A;  1QA6 A;  3CCY A;  2E1M C;  3G4S I;  2PJP A;  3HOY J;  4RB0 A;  3PO3 J;  1RNL A;  3W6J B;  5CVV A;  3N4M A;  1DPR A;  3HRT A;  2X6Y A;  3MMY B;  4ZDL A;  2JPB A;  5LRS A;  4HX8 A;  2VKV A;  1R22 A;  2P8T A;  1MDM A;  2RQQ A;  3RZD J;  1E3H A;  4OMY A;  1FPQ A;  2YSR A;  5J47 A;  4OWR B;  1P4W A;  1MZB A;  2OV7 A;  1G59 A;  1ZTR A;  4UY8 I;  4BHC A;  4EGY A;  4BXX J;  5CVU A;  5K5Q A;  3RYR A;  3GFI A;  2P7C B;  3TGN A;  3JRD A;  1SD6 A;  1H9T A;  3Q9S A;  5FO5 A;  2R7V A;  1W5C C;  3D5L A;  1UB9 A;  2X85 A;  4D5C A;  3I58 A;  4XK4 A;  5ERI A;  4ZYD A;  2QSF X;  4KT6 A;  2E1M B;  2UXX A;  4GXO A;  4HBL A;  2VBX A;  4CHU A;  2DA5 A;  1YIT I;  5J8C A;  3O3K A;  3REO A;  2HQ5 A;  3IHU A;  1JXS A;  2WA0 A;  5DUI A;  2BY0 A;  3JTH A;  2LKX A;  1MBF A;  5LFA A;  2H1L A;  3E6D A;  3VSL A;  2CO5 A;  2XAS A;  2Y30 A;  2DOD A;  1SFU A;  3MFK A;  2EIK H;  5BNG A;  1HW5 A;  4M3B A;  1E17 A;  4HV5 A;  4AD9 A;  2V1U A;  3KX2 A;  3N05 A;  1OJL A;  1PP7 U;  2ZNY A;  3G1L A;  4DW6 A;  3A2K A;  3BJA A;  2V1D A;  2B9S A;  3ZP5 A;  3H5N A;  3R60 A;  5CYV A;  5HDG A;  3ZN1 A;  5EGO B;  2W7N A;  2R93 J;  2DT5 A;  5GP9 A;  5E3M A;  2DBB A;  4II2 A;  2NVU B;  1GV2 A;  2OC6 A;  4F52 A;  4IKF A;  2WAE A;  2E34 A;  2DDA A;  1G3S A;  2EWN A;  3M07 A;  2KRF A;  4IX7 A;  3MQ0 A;  3HRS A;  3S3N A;  1K4T A;  1JT0 A;  4G7O F;  3PIP F;  5L3B A;  2KPM A;  2HR3 A;  3FXK A;  5FB2 A;  1R6R A;  3J80 Z;  2Z33 A;  4IHX A;  1VF9 A;  2GXA A;  1PYV A;  3OYA A;  1WJB A;  4XON A;  1P4A A;  2OCE A;  2HZD A;  4NDL A;  4XM3 A;  4G12 A;  3U21 A;  5GTH C;  3KEQ A;  1W0U A;  3ASO H;  4V2F A;  3QPH A;  1TNS A;  1FEX A;  3DWL E;  3BC8 A;  2H8W A;  2PG4 A;  3VOE A;  4RBO A;  4JX5 A;  2FQ3 A;  1IXS B;  2PMZ N;  3BZC A;  2FEZ A;  3A4C A;  2ZC2 A;  2P4W A;  4YIF A;  2NRA C;  3FHZ A;  1ZKG A;  2P81 A;  2OQG A;  3QP5 A;  4MFE A;  3WG9 A;  2QWW A;  4Q4Z F;  2IW5 A;  2DK5 A;  1ZG5 A;  2ID3 A;  3EUH A;  3QRF F;  2LKS A;  1BM9 A;  1MBG A;  2ZJ2 A;  3RSN A;  1SFO J;  1IG7 A;  1EF4 A;  2QF7 A;  1Z77 A;  4GDF A;  1OYY A;  3I59 B;  1SD5 A;  5EG0 A;  1WZ2 A;  3GF2 A;  5IOY A;  4IL6 C;  1Y1V J;  2X4H A;  2M9H A;  3RQI A;  3CUQ C;  1MDM B;  5E1Z B;  3GEZ A;  2F4O B;  1G3Y A;  1V5E A;  1SVO A;  4A3G J;  1KYW A;  4RGX A;  3AFH A;  3H3V K;  1JTY A;  2K86 A;  4KIF A;  2WC2 A;  3IAM 2;  3ZQ7 A;  4IQ4 A;  3BP8 A;  2X6W A;  2XKP A;  2OU2 A;  2P0W A;  2VAS A;  2RDP A;  3LST A;  4MGR A;  3CO6 C;  1JJ6 C;  2MSY A;  3HPH A;  2CFO A;  4A12 A;  1KZH A;  3F8F A;  1TWG J;  3SFI A;  4BL0 B;  2HPM A;  4GYG A;  2IAI A;  2VKE A;  1ETV A;  2M3A A;  4XN0 A;  4KA4 A;  2JSC A;  3WTX C;  4IHV A;  2HTS A;  1V55 H;  2R5Z A;  4OIP F;  5E1X A;  4XMY A;  3MCZ A;  1W0T A;  2EZL A;  2L4A A;  4B48 A;  5A2Q Z;  5IYB J;  2IS4 A;  3BT9 A;  5E17 F;  1SMT A;  1XGS A;  1XX5 A;  1XSD A;  3V8J A;  1WKM A;  1HST A;  1ZG3 A;  4RB1 A;  2IEK A;  4XRM A;  2YR2 A;  2Y2Z A;  2AO9 A;  1A36 A;  1UHW A;  1S8N A;  1OYI A;  3JW4 A;  4O5V A;  1RRJ A;  2IJL A;  4XR6 A;  3PM1 A;  5LLQ A;  1ZLK A;  2DXI A;  4AUX A;  3KEO A;  2PJR B;  3S3O A;  1OCR H;  1SFK A;  2LP0 A;  4EEF G;  3LFU A;  2DT6 A;  3E6M A;  4Y17 A;  1YLF A;  2XAF A;  3PNY A;  4A6E A;  2E5Z A;  1ETK A;  1V5F A;  1F36 A;  2RC4 A;  3GTL J;  2HZT A;  3KP6 A;  5IP7 J;  5M5W J;  2B7E A;  1D0X A;  1ZK8 A;  2ETH A;  2O5R A;  2JVH A;  1BJA A;  4LIU A;  2E7W A;  1QVT A;  1OR7 C;  4XBF A;  2F5F A;  4DOZ A;  3E5Q A;  5K7F A;  1ZG1 A;  2JK3 A;  2VB6 A;  3DEE A;  2EA2 A;  4KUM A;  3UKG A;  2W1O A;  1HQC A;  1VQP I;  2BY2 A;  2QQB A;  5C4X J;  4PJN A;  4KMF A;  3E97 A;  1FC3 A;  1UST A;  1YOV B;  1G4D A;  3HDD A;  2XDV A;  3FM5 A;  1QNT A;  1OCC H;  3BCA A;  2BY1 A;  4S04 A;  5K7Z A;  3O8G A;  4GYI A;  2YUS A;  3T0Y A;  2W25 A;  5M5X J;  4EMS A;  2WAQ A;  1GLN A;  4DNC A;  4ESJ A;  3GTK J;  1P7J A;  2LLK A;  4XL9 A;  4BY1 J;  3DKW A;  1IN5 A;  4LLG F;  2CJJ A;  2AXL A;  1K6O A;  2VOP A;  2LTP A;  1MMN A;  3S93 A;  2CYY A;  1E0E A;  2YX4 A;  4KIB A;  4C2U A;  4RAF A;  3WTT C;  1ZAR A;  3QQA A;  2W57 A;  5FRN A;  3BQY A;  3EUH C;  3IH2 A;  4XSZ F;  3KIO A;  5JR3 A;  2ZXW H;  4LMY A;  4PJL A;  4CCL A;  1X2N A;  2L7F P;  3BJ6 A;  3PO2 J;  3SYT A;  5J1Y A;  2CV2 A;  3TED A;  1ULY A;  3VEP A;  3FIW A;  3S2H J;  2L0K A;  3V8K A;  5LEJ A;  3DP7 A;  1ODD A;  2A69 F;  4AIK A;  2CRG A;  2TRT A;  4KIC A;  4O6J A;  5AIQ A;  2OCC H;  1YS7 A;  2LNB A;  2RAE A;  2H6B A;  1OPC A;  3BY6 A;  3G1O A;  3G6E I;  2BBY A;  2M30 A;  4UUT A;  3J81 K;  3SQN A;  3LSK A;  3J7Y J;  4JYK A;  1POG A;  3ZGK A;  2G7H A;  1D1A A;  1V4R A;  3K70 C;  1VQ7 I;  4HOB A;  2YU3 A;  2E71 A;  3MVP A;  5DM6 F;  1YJN I;  5JLX A;  1MMG A;  4KIG A;  4PUS A;  4QPQ A;  4D9J A;  2V6C A;  2OBP A;  3DKY A;  4I02 A;  2DYR H;  4FAS D;  2R7D A;  5F64 A;  2IA0 A;  1S72 I;  2EFO A;  4CO8 A;  5E8I A;  5F0H A;  1P2F A;  2AS5 F;  1UMQ A;  1LUJ B;  1YRN A;  4RM3 A;  2NNY A;  3RQ4 A;  2P5L C;  2ELH A;  3MWM A;  1T39 A;  2ME6 A;  1X58 A;  4H4K C;  4DYR A;  1EKE A;  3MKY B;  2EZK A;  2PMU A;  3M9A A;  1R5H A;  2BW3 A;  4L5I A;  4PGG A;  3ABM H;  5BPI A;  1N75 A;  2DN0 A;  2MA3 A;  2OPT A;  4ABZ A;  3CJT B;  2J5O A;  3Q0W A;  1HBX G;  2HDW A;  4XNF A;  4HLY A;  4XLH A;  2X9D A;  2Y9Z A;  1SEU A;  1QVU A;  3KZY A;  4L0Y B;  1LVK A;  3RI4 A;  1G3T A;  2FBH A;  1ETW A;  5C44 J;  3QPL A;  3TMO A;  4DYC A;  5EG0 B;  3HGY A;  1JKQ C;  1KQ8 A;  3SEZ A;  3W2V A;  1MJB A;  3IKT A;  1P6R A;  3OYN A;  3A03 A;  4N4O B;  4DZJ A;  4G6Q A;  3S1M J;  1X3W B;  2EIJ H;  3RTR A;  1O3T A;  2RGV A;  2KZV A;  3FXU A;  3M8F A;  4I0A A;  2ECC A;  2Q1Z B;  4I09 A;  1D8K A;  3ZMV A;  1ZR4 A;  1ZR2 A;  3HOW J;  3AG2 H;  4A3I J;  2HS5 A;  5B5E C;  2CGP A;  3BR2 A;  5E3O A;  5JVT A;  1J75 A;  1MD0 A;  3FIS A;  2GIZ A;  2K5C A;  4B3X A;  3VOD A;  1T0F A;  3F23 A;  3M8J A;  4JX4 A;  3OOU A;  2DOF A;  2MLK A;  3TKY A;  3BTL A;  2W85 A;  4M9X A;  2JPC A;  4XKC A;  2O3F A;  5IP9 J;  4XLA A;  3OV8 A;  4M9S A;  3BG5 A;  5K1Y A;  4F7Z A;  2A6T A;  2PMZ A;  3ZRG A;  3CUO A;  4YFN F;  3ABT A;  3KZI C;  2BXY A;  4AVZ A;  3LSI A;  2FX0 A;  4JQF A;  4UVB A;  3WG7 H;  2Z2S B;  5KVR A;  3CMY A;  4Q47 A;  4S0H B;  1JI8 A;  1Z7L A;  2EFN A;  4BUP A;  4W1U A;  2DFE A;  4HQE A;  2M5W A;  5BQT A;  5IY5 H;  3OYG A;  4X6A J;  3GW2 A;  2DO7 A;  1W7P B;  3I4P A;  3VYU B;  1TQP A;  2NS0 A;  1IUF A;  2GZW A;  5IT3 A;  4YEJ A;  2EZI A;  1JUP A;  1NTC A;  2VL8 A;  4V19 K;  3QU3 A;  1SFE A;  4A0X A;  4Y15 A;  5JLW A;  2PJR A;  2DMU A;  1DP3 A;  3GFL A;  4MEY F;  4U7D A;  1W36 D;  4L9V A;  2W82 A;  2QSH X;  2P6S A;  4F92 B;  2WB1 A;  1YRN B;  2CFX A;  1BW5 A;  4M6V A;  5LGN A;  2R3S A;  1IAW A;  3GZ6 A;  1WH5 A;  4U88 A;  1DU6 A;  1X1C A;  4QLC U;  4BU2 A;  4PK4 A;  5FGM A;  4XLP F;  2D45 A;  3HB9 A;  1X1A A;  2Z3Y A;  1VTN C;  1RC9 A;  3HSR A;  2CW0 F;  3PL8 A;  2R5Y A;  1U5T B;  3I54 A;  1BOA A;  1YX5 A;  2IA1 A;  1IRX A;  2M0C A;  5E1W A;  3GTO J;  3U9G A;  3RZO J;  3HRM A;  3IWZ A;  1B8I B;  3MKL A;  2BEO A;  1I1S A;  4HDU A;  1I1G A;  2R7O A;  4D0P A;  1AWC A;  2IRF G;  1EH7 A;  1WRJ A;  2F5V A;  3PUF A;  3W6K B;  4HQM A;  1IO2 A;  2VPR A;  3F8C A;  3ELK A;  4CCK A;  2AHQ A;  2HKX A;  1U9N A;  2M2E A;  1AU7 A;  2P5K A;  1O3R A;  5CLS A;  5HNH A;  1H88 C;  3J7A Y;  5J8F A;  4QTR A;  1JUS A;  4CUG A;  3G3Z A;  4JX6 A;  2WV0 A;  4KJZ A;  3NWT A;  4KN4 X;  3OL4 A;  3B6A A;  2H94 A;  4PCQ A;  2XPU A;  3HJE A;  3JRF A;  1RZ4 A;  1Z7U A;  3F8B A;  2ZME C;  1BIA A;  2LBF A;  4L9T A;  2HYF A;  4KIS A;  3CQZ J;  3HEF A;  1VQ9 I;  2EFQ A;  4C3J J;  5IYD J;  1TW2 A;  4UNO A;  3ABU A;  4CH7 A;  3CJN A;  4C2M J;  2QEX I;  3VYS B;  2ELK A;  4BKX A;  5TJJ A;  3K70 D;  4FTH A;  3OWT A;  2ZME B;  1EV7 A;  1JKR C;  2I10 A;  5F0F A;  1R1U A;  3FK7 A;  2GAU A;  3M1C A;  1QHH D;  1ZN2 A; 
#chains in the Genus database with same CATH homology
 2F5D A;  1LDD A;  2DU9 A;  1XSX A;  4G94 A;  5LRR A;  5F6F A;  4Q5S F;  1GHC A;  1XGO A;  3V7C A;  2ISZ A;  4HW0 A;  1YQA A;  1REP C;  4LK0 F;  1S29 A;  3CLO A;  1HKS A;  2C6Y A;  4N9H A;  1FYM A;  4ZH4 F;  1S6L A;  2PEX A;  2A07 F;  4LFU A;  3PQJ A;  2L3D A;  5FD5 A;  1TLH B;  2F2E A;  3H92 A;  1R7J A;  4ZYG A;  4M6X A;  3HIF A;  2F5E A;  4FHT A;  3QP6 A;  3T1B A;  4YFX F;  3M8E A;  5K5O A;  2HYG D;  1KA8 A;  2DPD A;  2O03 A;  3RPQ A;  4ETS A;  2HQN A;  3BWG A;  1W7P A;  3G73 A;  3I59 A;  2WWY A;  2FSW A;  2E1C A;  3U1D A;  1IW7 F;  3WTV C;  4BHP A;  3T5X A;  1UFM A;  3F3X A;  4AWX B;  5FLX Z;  5LHI A;  4N0B A;  3L2C A;  5TRD A;  3FM3 A;  2CG4 A;  1MKM A;  2QBY B;  2DQL A;  3GXO A;  4MQV A;  2K4B A;  3WE3 A;  3CUQ B;  2OAZ A;  2M87 A;  1KU2 A;  2BE5 F;  3H3Z A;  4CYD A;  2OQR A;  1ZRF A;  2D1V A;  1WQ2 A;  2QQ9 A;  2FML A;  5DCM B;  1LB2 A;  3LFK A;  2QBY A;  2FF4 A;  1TBX A;  1FP1 D;  2XKO A;  1DP7 P;  2QVO A;  1LDJ A;  3KP7 A;  2BYV E;  3K1N A;  2X0L A;  3LWF A;  1FYL A;  1FBU A;  5DUK A;  1R1V A;  1SFX A;  3EYY A;  5E18 F;  1LEB A;  2L4M A;  2XUB A;  2WTE A;  1PUE E;  1CF7 A;  4BAY A;  2O0Y A;  1IXC A;  1ON1 A;  4I0B A;  2VC1 A;  3Q5F A;  2XAG A;  5J6X A;  1KQ0 A;  1R00 A;  3P9C A;  2XAH A;  3KE2 A;  4MNU A;  1QZZ A;  5IT9 Z;  4G7H F;  4HA8 A;  3HRU A;  3K1M A;  1J0R A;  3KFW X;  2Z9O A;  2ZO4 A;  1R36 A;  4IRI A;  1BI3 A;  4NB5 A;  3RKW A;  3TOB A;  4IRG A;  1KGS A;  3JAM K;  1O7F A;  1BI1 A;  4EJO A;  2XRO A;  3EDP A;  3FXR A;  1O57 A;  2PN6 A;  1IN8 A;  2DAO A;  3I64 A;  4KYW A;  4IF4 A;  2QEN A;  4BHB A;  5H20 A;  2DFI A;  1JE8 A;  2W24 A;  4A0Y A;  1YW7 A;  2P7V B;  4RS8 A;  2EK5 A;  3FXQ A;  1XMK A;  4P9U A;  3L09 A;  2EJR A;  5BPD A;  4L18 B;  4ENJ A;  4EVI A;  1B6A A;  1F5T A;  4JK1 X;  4HZF A;  4G8X A;  1W5T A;  4IPA A;  4M72 A;  4GGG A;  2HWV A;  5D6F A;  5DCF A;  1XMA A;  4UV9 A;  4KMU X;  5H6R A;  1D8J A;  2FXA A;  4U0V A;  1W7P D;  2GQQ A;  1FWZ A;  2L01 A;  3GZ5 A;  4A0Z A;  2UZK A;  3C1D A;  1J2X A;  4G6D A;  3DXJ F;  1K79 A;  3F6O A;  5D8K B;  2J5P A;  1BBY A;  5EEG A;  4P55 A;  3ZMU A;  5JI6 A;  3MZY A;  3Q9V A;  2HOE A;  2EFP A;  5BOX A;  1JHH A;  1XN7 A;  4I01 A;  3JTG A;  1LVA A;  3DF8 A;  3U2R A;  4CZZ A;  2ISY A;  2V9V A;  3WGG A;  1PDN C;  4WF2 A;  3T8T A;  1R1T A;  6PAX A;  2IA2 A;  2IPQ X;  2ZFW A;  3PFI A;  1U5T A;  4H0E A;  2A68 F;  2MD5 A;  1HW1 A;  4EM2 A;  4ESB A;  5HDK A;  1BN5 A;  3IL2 A;  5HS8 A;  4M9Z A;  2VE8 A;  4AVP A;  5ICG A;  2M8E A;  1HXD A;  3LA2 A;  2PMH A;  4HF1 A;  3TO6 A;  2Y0M A;  1S7A A;  4WWC A;  3ZMS A;  3GO5 A;  2EB7 A;  2G7U A;  3F21 A;  5LBQ A;  2PQ8 A;  2NAZ A;  3LQR A;  1BI2 A;  1OYW A;  4IXA A;  3E5U A;  3L00 A;  5DYM A;  5K5R A;  2VE9 A;  1U78 A;  2QYO A;  5D5V B;  3P9I A;  4LG0 B;  2QQA A;  1IZ1 A;  1KU7 A;  1U6G A;  2FE3 A;  3V4G A;  2LDU A;  1IN7 A;  1BI0 A;  3RKY A;  1BC8 C;  3R4K A;  4M73 A;  4A5N A;  3GWZ A;  2ZKZ A;  4O3M A;  3BOQ A;  1YFH A;  2ACJ A;  1FNN A;  5HLH A;  2IP2 A;  3DEU A;  1ZAO A;  2ZCW A;  4EJU A;  1Z6T A;  4LG0 A;  4HYE A;  1B1B A;  5HS7 A;  1R5G A;  3B73 A;  4OU0 A;  3J7A O;  3K1P A;  4Z2Y A;  2XV4 S;  4EJT A;  3KZZ A;  1XB4 A;  3TO9 A;  2VN2 A;  3WOD F;  5BS6 A;  1K7A A;  2HFH A;  5HLI A;  2BV6 A;  2HGC A;  3I0T A;  1T98 A;  1TW3 A;  2PFB A;  5DCM A;  4BYY A;  3WGH A;  2HTJ A;  1QO0 D;  2K02 A;  1UHM A;  4KNY A;  3QAH A;  3SZT A;  1JGS A;  2LSO A;  4MTD A;  3LA3 A;  2R7F A;  5A2Q K;  3LQQ A;  3QOP A;  1R23 A;  4Q48 A;  2VT3 A;  1J5Y A;  1I5Z A;  2EFW A;  5ICE A;  2STT A;  2DI3 A;  4WXD A;  1FBQ A;  2M1B A;  2FOK A;  1QZY A;  4NQW A;  4EQQ A;  3F8N A;  3R6S A;  4S05 A;  1ZGJ A;  2Q0O A;  2RKH A;  3L9F A;  4N9I A;  4UVA A;  3IRQ A;  1HKT A;  4MTE A;  3L7W A;  3BRO A;  1XGN A;  5FD6 A;  3TOA A;  4IHS A;  5L3C A;  1HSJ A;  5LGT A;  1ONV A;  2FBI A;  4DQ2 A;  5HS9 A;  2V79 A;  4GO1 A;  4OMZ A;  5LHH A;  1J9I A;  2VC0 A;  4RB3 C;  4EJW A;  3MAJ A;  4U0Y A;  1DUX C;  1FSH A;  4YFK F;  1LJ9 A;  3FMQ A;  4BNC A;  2FA5 A;  1LDK B;  1A04 A;  4HX4 A;  1SAX A;  4ZZL A;  3BDD A;  2MBF A;  3QU6 A;  3TO7 A;  4ZYE A;  2B0L A;  3NRV A;  1Z9C A;  2RQP A;  2NNN A;  3PQK A;  1O3S A;  4MQ9 F;  5ICC A;  4L5J A;  3WE2 A;  4I98 B;  1H9G A;  3IWF A;  3GUD A;  2Y75 A;  2RN7 A;  1BC7 C;  3RIR A;  3WTW C;  5E20 A;  2JZY A;  1GVJ A;  3CUQ A;  1B59 A;  3HOT A;  3E3V A;  1ZRC A;  3AAF A;  3ISP A;  5D5U B;  2E1N A;  4OIR F;  3NQO A;  1ZRD A;  3TQN A;  4RGU A;  5LHG A;  2ZXJ A;  4LJZ F;  1OMI A;  2DQR A;  3OOP A;  2MH9 A;  1E2X A;  2QZ8 A;  1Q1H A;  5L3E A;  1IRG A;  2L02 A;  4XRF A;  3FF5 A;  2A3S A;  3BPX A;  5ILU A;  2UXN A;  1SD7 A;  3C18 A;  1KU3 A;  5DD8 A;  3J80 K;  4LD5 A;  1FP2 A;  4RGS A;  2VXZ A;  4HF2 A;  5HVQ C;  1G6N A;  3K0L A;  1FLI A;  4EM1 A;  3HSE A;  5HLG A;  3EQL F;  5LGU A;  2IT0 A;  4UV8 A;  3HTS B;  4R1H A;  1U8R A;  2GWR A;  3KCC A;  3HYI A;  1J59 A;  1Z91 A;  4KN7 X;  3IC7 A;  2M45 A;  1YS6 A;  2H09 A;  5D8L B;  4HLX A;  5CVI A;  1XDS A;  3FMR A;  2IVM A;  3K69 A;  2A6E F;  2VON A;  1HKQ A;  3RKX A;  3ML6 A;  5DD4 A;  2EV0 A;  2PLY A;  1FZP B;  5F1R A;  5FLX K;  2OA4 A;  2K4J A;  1FY7 A;  2Z99 A;  4P9F A;  4UXN A;  2DLL A;  1P4X A;  1I6X A;  5E8G A;  1DPU A;  3TDZ C;  2F5C A;  3V7R A;  1IUY A;  4CIC A;  4ENK A;  3N97 A;  2VBZ A;  4BQA A;  2COM A;  5D4S A;  2Z5U A;  3I5U A;  3WTZ A;  1EH6 A;  1HW2 A;  3P7N A;  1TQM A;  3WTY C;  4HDV A;  3K2Z A;  3WU0 A;  3KP2 A;  2CQK A;  4GCV A;  2V1X A;  3KET A;  3GYH X;  2YX7 A;  4ESF A;  2FMY A;  3WTS C;  3E5X A;  2GA2 A;  1SMY F;  2HDC A;  3HSF A;  3F8M A;  1MJA A;  1F1Z A;  4L9N A;  1NHA A;  4IVN A;  3LAP A;  4I7H A;  2XAJ A;  2XVC A;  2DTR A;  3BJO A;  2ESH A;  5H6Q A;  3V7S A;  1KQ9 A;  5IT9 K;  4NHJ A;  1V3F A;  1OR7 A;  2QLZ A;  1C0W A;  3E6B A;  3C7J A;  3QPT A;  2LF8 A;  2A61 A;  3ULQ B;  3GFJ A;  2Q2E A;  4AIJ A;  1RI7 A;  2GXG A;  3JAM Z;  3ECH A;  3DPT A;  1YTY A;  4K2E A;  1YYV A;  3H3U A;  1Z6R A;  3NEU A;  4R8H A;  1FSE A;  2A6H F;  1PP8 F;  4UHT A;  3LAJ A;  2EV6 A;  2MLG A;  1F9N A;  1D5V A;  5JFR A;  1DDN A;  3ECO A;  3V8L A;  2H6C A;  4UUV A;  1B9M A;  3GLX A;  3JSP A;  5D6E A;  1IN6 A;  1T38 A;  1L0O C;  1QQI A;  2HKO A;  1USS A;  4P96 A;  5ICF A;  3JSO A;  2K7L A;  3HHG A;  2KIU A;  5ILS A;  3SXY A;  1EH8 A;  5D4R A;  4UVC A;  2W84 A;  1XDU A;  1MJ9 A;  1ZHF A;  4LB6 B;  5JHU A;  3K9T A;  3I53 A;  4LB5 A;  2HQR A;  3I71 A;  1CF7 B;  1YO5 C;  1Z1D A;  2XHK A;  1ZGA A;  1RIO H;  4P5O A;  2KKO A;  3RYP A;  5AON A;  1YW8 A;  3FX3 A;  4RB2 C;  3BPV A;  3CDH A;  2TDX A;  3BZ6 A;  1K78 A;  5LEK A;  1JHF A;  1I27 A;  2D2W A;  4IJA A;  3B02 A;  2VOO A;  1XD7 A;  3SFZ A;  3M1E A;  3E6C C;  5BMZ A;  2RV8 A;  1Y0U A;  1S3J A;  2XRN A;  2P6T A;  4OIN F;  4U0W A;  4WCG A;  1IRF A;  2ZNZ A;  4B8X A;  4U7B A;  2HEO A;  3CO7 C;  3ERE D;  2ADU A;  2JRT A;  1IF1 A;  1U3E M;  3ZMT A;  3DQV C;  2KJB A;  5AIP A;  3KP4 A;  1TNT A;  1XGM A;  2BGC A;  1XCB A;  3GFM A;  2D1H A;  2DW4 A;  5ED4 A;  4G9Y A;  2FU4 A;  4IHT A;  3LA7 A;  2EV5 A;  2OZ6 A;  1W5S A;  3RJP A;  5FFZ A;  2E7X A;  3M7G A;  4RAZ A;  3D0S A;  1YG2 A;  1H0M A;  2GA1 A;  1QGP A;  1OKR A;  2FBK A;  2P5V A;  4PZJ A;  5DEQ A;  2DPU A;  2YPR A;  4CDG A;  5DV5 A;  4XLN F;  4G7Z F;  3WGI A;  1BIB A;  4EM0 B;  1X3U A;  5KK1 A;  4ASN A;  4M6Y A;  4AIH A;  1O7L A;  4IRH A;  4LLN A;  3HOS A;  2JT1 A;  3EYI A;  4R79 A;  1RUN A;  1O3Q A;  4RGR A;  4WXH A;  1IXR C;  5DDG A;  3CTA A;  1YIO A;  3F22 A;  1T2K A;  4EJV A;  4BH9 A;  3EET A;  1F4K A;  3KP3 A;  2VBY A;  5L3G A;  5L3D A;  1G3W A;  3HTU A;  4KDP A;  4E70 A;  1P92 A;  4EGZ A;  4M74 A;  1CGP A;  3R61 A;  2A5Y B;  4YII A;  2L54 A;  1WSU A;  2VT2 A;  2NYX A;  2VBW A;  3COA C;  4FX4 A;  2Y48 A;  3R0A A;  2CWE A;  4Y13 A;  2LKP A;  4ZZD A;  2H27 A;  5CVJ A;  3KP5 A;  1GXP A;  2O6G E;  2ESN A;  1RUO A;  2OD5 A;  3J81 Z;  4L0Z B;  1TQI A;  3FZV A;  2FNA A;  4A2U A;  1TTY A;  2O61 A;  2RVC A;  4LGW A;  1K78 B;  4OOI A;  4CGZ A;  4KT5 C;  5CJ9 A;  2STW A;  3ZN0 A;  2DK8 A;  4YG2 F;  3ZMD A;  2JTV A;  3P9K A;  2QUF A;  4ON0 A;  4LK1 F;  1FT9 A;  5L3F A;  4WX9 A;  3S2W A;  1QBJ A;  3T8R A;  4I2O A;  3F6V A;  2UWM A;  2GXB A;  4CXF A;  5FFX A;  2OZU A;  1WWX A;  3SZP A;  3HHH A;  3GX4 X;  4ENN A;  2G9W A;  3DFG A;  3KLN A;  1D3Y A;  3FMS A;  1MGT A;  4HAM A;  4LLL A;  4WK8 F;  3ROU A;  3WU1 B;  3ZPL A;  1FX7 A;  5HOO A;  2PBI A;  3DPL C;  2KIF A;  3O6B B;  3IRR A;  1ZYR F;  3GVA A;  4A6D A;  1LQ1 A;  5EEH A;  1FYK A;  2LF7 A;  4M71 A;  2PI0 A;  1LEA A;  3C3W A;  2FNP A;  2QM3 A;  4MHG A;  1AOY A;  4JBA A;  1XCV A;  3RDI A;  3IKV A;  2KIM A;  1ZH5 A;  1GXQ A;  4HF0 A;  2XIG A;  4ENM A;  3FWE A;  2CSO A;  1SD4 A;  5D5X B;  2VOD A;  4PGH A;  4KFC A;  4L9J A;  4OIQ F;  1R58 A;  1XSV A;  1U2W A;  1ON2 A;  4QWQ A;  4HV6 A;  1FBS A;  3KLO A;  2FRH A;  1STZ A;  1B4A A;  4B09 A;  1W4M A;  4A5M A;  5HDN A;  2ZBK A;  1IN4 A;  1WI9 A;  1KU9 A;  1J7K A;  4RAY A;  2GIV A;  4MEX F;  1QPM A;  1ZLJ A;  4OIO F;  3R0J A;  3HUG A;  5D5W B;  1S7O A;  1LNW A;  3ZMZ A;  4FT8 A;  4WXC A;  4TV7 A;  2MH2 A;  4HX7 A;  2EA4 A;  2KJC A;  3O2P E;  2XAQ A;  1UCR A;  3MZH A;  4XSX F;  3SHF A;  3DV8 A;  1KYZ A;  1Z05 A;  4FX0 A;  2RNJ A;  3F72 A;  5ILV A;  1YW9 A;  2ZME A;  3RPU A;  3VB2 A;  5CVR A;  3TDU C;  2Q8K A;  2O8X A;  2K27 A;  3WTU C;  4EV0 A;  1B9N A;  4BXU A;  1FOK A;  3VFZ A;  1U5T C;  2MC3 A;  2XGX A;  4ZYH A;  1L3L A;  3MEX A;  4PDK A;  2PJP A;  4RB0 A;  1RNL A;  3W6J B;  5CVV A;  3N4M A;  1DPR A;  3HRT A;  2JPB A;  5LRS A;  4HX8 A;  1R22 A;  2P8T A;  1MDM A;  4OMY A;  1FPQ A;  2YSR A;  1P4W A;  1MZB A;  4BHC A;  4EGY A;  5CVU A;  5K5Q A;  3RYR A;  3GFI A;  2P7C B;  3TGN A;  1SD6 A;  1H9T A;  3Q9S A;  5FO5 A;  3D5L A;  1UB9 A;  3I58 A;  5ERI A;  4ZYD A;  2UXX A;  4GXO A;  4HBL A;  2VBX A;  4CHU A;  5J8C A;  3O3K A;  3REO A;  3IHU A;  1JXS A;  5DUI A;  3JTH A;  3E6D A;  2CO5 A;  2XAS A;  1SFU A;  3MFK A;  1E17 A;  1HW5 A;  4HV5 A;  4AD9 A;  2V1U A;  1PP7 U;  2ZNY A;  3BJA A;  2V1D A;  3ZP5 A;  3R60 A;  5CYV A;  5HDG A;  3ZN1 A;  2DT5 A;  2DBB A;  2EWN A;  1G3S A;  2KRF A;  3MQ0 A;  3HRS A;  4G7O F;  5L3B A;  3J80 Z;  2HR3 A;  5FB2 A;  2Z33 A;  1P4A A;  3KEQ A;  3QPH A;  1TNS A;  2PG4 A;  3VOE A;  2FQ3 A;  1IXS B;  2FEZ A;  2NRA C;  2P4W A;  4YIF A;  3FHZ A;  2OQG A;  3QP5 A;  3WG9 A;  2QWW A;  4Q4Z F;  2IW5 A;  2DK5 A;  1ZG5 A;  3EUH A;  3QRF F;  1BM9 A;  2ZJ2 A;  1OYY A;  3I59 B;  1SD5 A;  3GF2 A;  2X4H A;  3CUQ C;  1MDM B;  5E1Z B;  3GEZ A;  1G3Y A;  1KYW A;  4RGX A;  2K86 A;  4KIF A;  2WC2 A;  3ZQ7 A;  3BP8 A;  3CO6 C;  2XKP A;  2OU2 A;  4MGR A;  3LST A;  2RDP A;  1ZRE A;  4A12 A;  3F8F A;  4GYG A;  4KA4 A;  2JSC A;  3WTX C;  2HTS A;  4OIP F;  5E1X A;  3MCZ A;  2L4A A;  5A2Q Z;  5E17 F;  1SMT A;  1XGS A;  1XSD A;  3V8J A;  1WKM A;  1HST A;  1ZG3 A;  4RB1 A;  2YR2 A;  1UHW A;  1S8N A;  1OYI A;  3JW4 A;  4O5V A;  2IJL A;  5LLQ A;  1ZLK A;  3KEO A;  4Y17 A;  3E6M A;  1YLF A;  2XAF A;  4A6E A;  2RC4 A;  2HZT A;  3KP6 A;  2ETH A;  1BJA A;  2E7W A;  4XBF A;  2F5F A;  3E5Q A;  1ZG1 A;  2EA2 A;  4KUM A;  1HQC A;  2QQB A;  4KMF A;  3E97 A;  1FC3 A;  1UST A;  1G4D A;  3FM5 A;  1QNT A;  4S04 A;  4GYI A;  3T0Y A;  2W25 A;  4EMS A;  4DNC A;  4ESJ A;  3DKW A;  1IN5 A;  4LLG F;  2AXL A;  1K6O A;  2VOP A;  2CYY A;  2YX4 A;  4KIB A;  3WTT C;  1ZAR A;  2W57 A;  4XSZ F;  5JR3 A;  4LMY A;  3BJ6 A;  1ULY A;  3VEP A;  3V8K A;  5LEJ A;  3DP7 A;  1ODD A;  2A69 F;  4AIK A;  4KIC A;  4O6J A;  5AIQ A;  1YS7 A;  2LNB A;  2H6B A;  1OPC A;  3BY6 A;  2BBY A;  2M30 A;  3J81 K;  3SQN A;  2G7H A;  1V4R A;  4HOB A;  2YU3 A;  4KIG A;  2V6C A;  2OBP A;  4I02 A;  2R7D A;  5F64 A;  2IA0 A;  2EFO A;  4CO8 A;  5E8I A;  1P2F A;  2AS5 F;  2NNY A;  2P5L C;  2ELH A;  3MWM A;  1T39 A;  2PMU A;  3M9A A;  1R5H A;  4L5I A;  4PGG A;  5BPI A;  2MA3 A;  2J5O A;  1HBX G;  4HLY A;  3KZY A;  4L0Y B;  3RI4 A;  1G3T A;  2FBH A;  1KQ8 A;  1MJB A;  3IKT A;  1P6R A;  4G6Q A;  1O3T A;  3RTR A;  2RGV A;  3FXU A;  3M8F A;  4I0A A;  4I09 A;  1D8K A;  3ZMV A;  2HS5 A;  2CGP A;  5JVT A;  1J75 A;  1MD0 A;  3VOD A;  1T0F A;  3F23 A;  2MLK A;  3TKY A;  2W85 A;  4M9X A;  2JPC A;  2O3F A;  3OV8 A;  4M9S A;  5K1Y A;  4F7Z A;  3CUO A;  4YFN F;  3ABT A;  4JQF A;  4UVB A;  5KVR A;  4Q47 A;  2EFN A;  4HQE A;  2M5W A;  5BQT A;  3GW2 A;  2DO7 A;  1W7P B;  3I4P A;  1TQP A;  2NS0 A;  2GZW A;  5IT3 A;  3QU3 A;  1SFE A;  4A0X A;  4Y15 A;  3GFL A;  4MEY F;  4U7D A;  4L9V A;  2P6S A;  2CFX A;  5LGN A;  2R3S A;  1IAW A;  3GZ6 A;  4U88 A;  4QLC U;  5FGM A;  4XLP F;  2D45 A;  1VTN C;  2Z3Y A;  2CW0 F;  3HSR A;  1U5T B;  3I54 A;  1BOA A;  2IA1 A;  5E1W A;  3U9G A;  3HRM A;  3IWZ A;  2BEO A;  1I1S A;  4HDU A;  1I1G A;  4D0P A;  1AWC A;  2IRF G;  1EH7 A;  1WRJ A;  3W6K B;  4HQM A;  3F8C A;  3ELK A;  2HKX A;  2P5K A;  1O3R A;  5CLS A;  5J8F A;  3G3Z A;  2WV0 A;  4KN4 X;  2H94 A;  4PCQ A;  1RZ4 A;  1Z7U A;  3F8B A;  1BIA A;  4L9T A;  2HYF A;  2EFQ A;  1TW2 A;  4UNO A;  3ABU A;  3CJN A;  2GAU A;  5TJJ A;  2ZME B;  1EV7 A;  1R1U A;  1T6S A;  1ZN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...