1VTNC

Co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*GP*AP*CP*TP*AP*AP*GP*TP*CP*AP*AP*CP*C)-3')
publication title Co-Crystal Structure of the HNF-3/Fork Head DNA-Recognition Motif Resembles Histone H5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1vtnC00
3R0JA 1IAWA 2K4BA 1I6XA 3FF5A 3E5QA 4P9UA 3Q9VA 4I2OA 4CDGA 1S7AA 3QP5A 3REOA 4RGSA 2A6EF 1FWZA 3BZ6A 5DCFA 2BV6A 4KMFA 4KIBA 4HV6A 3QPTA 1O3QA 2YPRA 2ZJ2A 4G7ZF 1BOAA 1YG2A 2NYXA 3TDUC 4PZJA 5JFRA 3BPVA 2GWRA 1XGOA 2OZ6A 4M9XA 4UV8A 2EFNA 3H3UA 3LSTA 3GXOA 2DPDA 2BGCA 1CGPA 4RB3C 3KP6A 4WF2A 2UXNA 3TOBA 4LJZF 1R36A 2ZCWA 3P9CA 3I5UA 4OOIA 4HZFA 5LRRA 4G6QA 4KYWA 3WTTC 3WTSC 1S6LA 2F5EA 3I0TA 4MEXF 4M9SA 1TQPA 4K2EA 1DUXC 1J0RA 2WC2A 2W25A 3CJNA 2Q2EA 1Z6RA 1ZGJA 2FF4A 2RV8A 2YX4A 3KZYA 5DDGA 2XAGA 3K1MA 5IT9Z 3ABUA 3BWGA 5K5OA 1BC8C 2VBWA 4M72A 3FX3A 5BS6A 3WTUC 4WXHA 5L3DA 4I01A 3O6BB 3IWFA 4LB6B 2FMYA 1B1BA 4ESFA 4UNOA 2ZBKA 3LA7A 2W84A 4KFCA 2MBFA 1XSXA 3P7NA 1K78B 3D0SA 3KP2A 1ODDA 1YW8A 2CW0F 2FBIA 5LGNA 2PEXA 5AONA 2FMLA 4BHBA 4JBAA 3HRSA 1FPQA 2A61A 3JW4A 5D4SA 1SD6A 4O3MA 2ACJA 2IA1A 4ENMA 2L02A 2FNAA 2EA2A 3WTVC 1KYZA 3WE3A 4WWCA 4KDPA 2EV0A 5E1XA 5HLIA 3KEQA 5L3GA 1BI2A 3DP7A 5ERIA 4CICA 2A5YB 3SXYA 4S05A 5D4RA 1HQCA 2K02A 4L9NA 1OR7A 1KU9A 5E18F 4ZYGA 1R7JA 1T39A 1LNWA 1V4RA 2HDCA 5DCMA 1H0MA 2WTEA 1QPMA 1SD7A 3KZZA 2ZMEA 2DO7A 1XDUA 2NNNA 3BPXA 3WTXC 2QLZA 2DQRA 2R7FA 3ABTA 4TV7A 1Z7UA 3E97A 1ZH5A 2P8TA 3L09A 5K1YA 1X3UA 1OYYA 2FXAA 5ICGA 2K7LA 4GGGA 1XCBA 2L4MA 3GZ6A 1O7LA 2O03A 2QBYA 1BI1A 3I4PA 5A2QK 4LG0B 1P4XA 5BOXA 1OYIA 3GEZA 4M74A 1IXCA 2UWMA 4HDVA 3ZMSA 3BP8A 2P7CB 2FU4A 4NQWA 3J80Z 5ILUA 2DI3A 2E7WA 1BC7C 1ZARA 1YS6A 2IW5A 1RZ4A 2XUBA 1IZ1A 1U6GA 4O6JA 4GYGA 2GQQA 4UVBA 1Z05A 3T0YA 2OAZA 1YW7A 3K0LA 3EYYA 4M73A 2JTVA 5D5WB 1HW5A 2RGVA 4JK1X 2XHKA 3RPQA 4KA4A 3DKWA 3F22A 1L3LA 2CFXA 4LLLA 1IRFA 2HQNA 2V6CA 4FX4A 4U0VA 1O3TA 3KFWX 1E2XA 3U9GA 3CTAA 1TNTA 3FHZA 3TO9A 2HOEA 4UHTA 3NQOA 1UHWA 4D0PA 1W4MA 1XGSA 2MC3A 3F6VA 4MQ9F 5F6FA 3O3KA 2H6CA 5LGTA 4HX7A 2O3FA 4ZH4F 5KVRA 1FOKA 2M1BA 2MA3A 1DPRA 3CLOA 3ZMTA 1ZG5A 4I98B 1ON1A 1QO0D 3FM3A 2O61A 1P2FA 3MAJA 1SFEA 4HV5A 3RPUA 3J80K 1FP1D 1DPUA 4G7HF 2O0YA 2EWNA 3HSEA 4MNUA 1T38A 4B8XA 2EJRA 1MKMA 3V8LA 2JRTA 4BQAA 2CYYA 3RYRA 1RUNA 4WCGA 4UXNA 4OIRF 4L0ZB 1ZAOA 2RDPA 4RB1A 3ZN0A 3BJAA 2A68F 2E7XA 3M7GA 4G7OF 3E6CC 5LBQA 3GVAA 3CO7C 3WE2A 2KJCA 4A6DA 1KU7A 1RI7A 2DK8A 1MGTA 3IKTA 3R0AA 1YLFA 1LDKB 2P7VB 1XB4A 2MD5A 1BIBA 1PUEE 2M30A 1MDMB 4XSZF 2VBYA 1G3SA 1IN4A 1OMIA 3MCZA 2DTRA 2OA4A 3RTRA 1PDNC 1FNNA 2KIUA 5K5QA 2ETHA 2VC1A 2GZWA 1IF1A 2VC0A 4R1HA 4IXAA 3VFZA 3MZYA 3ML6A 1HW1A 1F5TA 1BJAA 2KKOA 4N0BA 3GFMA 4UVCA 2M45A 4EJTA 2D45A 5L3BA 3GYHX 2A69F 4KN7X 3ROUA 5CVRA 5HDGA 1SFXA 4I09A 1QZZA 5HS9A 3TOAA 2WWYA 3I53A 1U2WA 5FD5A 3TQNA 2FEZA 4AD9A 4U7BA 1K78A 3HHGA 1MJAA 3TKYA 2QQAA 4AIJA 2CQKA 4Y15A 4QLCU 2QWWA 3K1NA 2YX7A 1OPCA 5CLSA 1IXSB 1YTYA 1BI0A 5JR3A 1WKMA 3WODF 2XV4S 1TTYA 3CUQB 3F6OA 4PGHA 2GAUA 5IT3A 1JXSA 1LVAA 1Z9CA 1MJ9A 1EH8A 5BPDA 2ADUA 1B9NA 4XLNF 4BAYA 5FLXZ 3LQQA 2VOOA 4ZYHA 2C6YA 3C18A 5J6XA 4EGYA 3IRRA 4HF0A 3LA2A 5E8GA 1J59A 1ON2A 4A0YA 4MEYF 2CGPA 4OIPF 3BDDA 2F5CA 1B59A 2H6BA 3K2ZA 1DP7P 4XLPF 1ZG1A 3EQLF 1QNTA 2FRHA 3MEXA 4L18B 5LHIA 1YQAA 4PDKA 4CHUA 4DQ2A 1T2KA 1R58A 2ISZA 2PMUA 1XCVA 4N9IA 4GXOA 3TO6A 3I58A 2V9VA 2PQ8A 2FOKA 1WSUA 3WGGA 5ILSA 3F8FA 3O2PE 2IJLA 2XKOA 5BQTA 1TW3A 1CF7A 5BMZA 4RAYA 3KP3A 1FT9A 5D5UB 1TQIA 2EV5A 1QQIA 1WQ2A 1KQ0A 5AIPA 3G3ZA 3ZMZA 4I0AA 3N97A 1UCRA 5CYVA 5FLXK 4RGRA 1S7OA 1Z91A 4A6EA 2W57A 5ICFA 4LG0A 5LLQA 3KLNA 3IKVA 4IJAA 1ULYA 4GCVA 5K5RA 4S04A 3DF8A 1R00A 4UVAA 3EYIA 2PLYA 3JTHA 3Q5FA 2XROA 4L9JA 3FZVA 1FSHA 4ESJA 2DBBA 4N9HA 2VBXA 3GX4X 2VXZA 4BNCA 4YFXF 1F9NA 2W24A 3CO6C 2P5VA 3SZTA 3ECHA 3JSPA 3KETA 1GXPA 1F1ZA 2EFOA 5TJJA 2NRAC 1IN5A 3F8NA 2ZNYA 1R23A 2V1DA 4XRFA 2EFWA 3IHUA 3I59B 4NB5A 3F8CA 2Y75A 2ZNZA 3QPHA 2ZFWA 1USTA 2WV0A 4HYEA 2YU3A 4CYDA 3SQNA 5LHGA 4YIFA 4RB2C 3FXUA 4WXDA 1L0OC 2XAHA 3I54A 3JTGA 2PBIA 3R4KA 4DNCA 3HTSB 2EK5A 2YSRA 2ZXJA 5IT9K 3RJPA 1QGPA 3RIRA 3RDIA 4LD5A 1ZRDA 2DK5A 4HBLA 1RIOH 1HSJA 4EQQA 4B09A 4GO1A 1OYWA 1WI9A 2CSOA 1IN6A 3E6BA 1FX7A 3PQKA 4ZZLA 2XASA 1BIAA 3HRUA 4GYIA 4RS8A 3ZPLA 3ULQB 3KP4A 1G3TA 3L9FA 4WXCA 2YR2A 3P9IA 2A07F 1K7AA 4OU0A 2IP2A 1P6RA 4HDUA 1YFHA 3HYIA 2OQRA 3ECOA 3WGHA 2D2WA 2G9WA 4ETSA 1SMYF 3MWMA 1MD0A 4EJUA 4IRGA 1DDNA 5LGUA 1FLIA 3WGIA 2MLKA 5FO5A 1IUYA 2GA2A 3D5LA 4L9VA 2R7DA 4CO8A 4UV9A 2RC4A 2ELHA 1XSDA 5LRSA 4EJWA 2A3SA 3C3WA 4G94A 3WU0A 5ICEA 2R3SA 1ZREA 2EB7A 3HSRA 5KK1A 3FMQA 4HW0A 2DW4A 5AIQA 3J81Z 4CZZA 1KA8A 1J9IA 5HS7A 3ISPA 3JSOA 3ZMVA 1MDMA 1USSA 4IRHA 1ZRCA 1GXQA 3JAMZ 4WX9A 1TNSA 2IPQX 5FD6A 3NEUA 4ASNA 4EM2A 2AS5F 2Y0MA 4BYYA 5DYMA 2RNJA 4IHTA 3ZQ7A 1QBJA 3MFKA 4CXFA 5CJ9A 3W6JB 2PI0A 4ENKA 3DPLC 1S29A 2BYVE 3KCCA 4MQVA 1YW9A 2MLGA 1TLHB 3EETA 4KICA 4ENNA 2FA5A 2ESNA 1LEAA 4Y13A 1WWXA 4ON0A 3HHHA 2KJBA 4Z2YA 3TO7A 3GLXA 5DV5A 4M6YA 3LWFA 4HOBA 5EEGA 3DXJF 3WTYC 2GIVA 1W5SA 4NHJA 2W85A 1E17A 2QENA 3BJ6A 3J81K 1IW7F 5D5XB 4KUMA 1MJBA 2MH9A 3GZ5A 2G7UA 1KGSA 3CUQA 4PCQA 1TQMA 3FM5A 2GXBA 2ZMEB 4FT8A 2DFIA 1YIOA 2IVMA 3T8RA 4R8HA 2HYFA 2XRNA 2X4HA 2XGXA 5F64A 4I02A 3T5XA 3ZMUA 4HLXA 3KEOA 1XSVA 3TGNA 1P92A 2JSCA 2DQLA 2AXLA 1F4KA 4KNYA 3VB2A 4MGRA 4LFUA 4ZYDA 3FWEA 3W6KB 3COAC 3TDZC 5HLHA 1D3YA 1O7FA 4HF2A 3HSFA 1FBQA 3E6DA 2A6HF 2HFHA 2KRFA 3GW2A 2DAOA 1UB9A 2GA1A 2JPCA 4H0EA 1KQ9A 3GFIA 3M1EA 4Y17A 2O8XA 4U88A 2HEOA 3QP6A 2HGCA 2IT0A 3QU3A 4IF4A 1IRGA 1SD5A 2P6TA 5D8KB 1SD4A 2HTSA 4IPAA 1ZYRF 3WG9A 2LF7A 3CDHA 3V7CA 1BN5A 4O5VA 3BJOA 2F5FA 1ONVA 4G9YA 5TRDA 4HAMA 5EEHA 1AWCA 4HF1A 2DU9A 2QQ9A 4A0XA 2PG4A 4BXUA 5JVTA 2NNYA 3F8BA 1W7PB 2QQBA 4LK1F 2VE9A 2NAZA 2VBZA 3SFZA 3RI4A 2XAQA 3T1BA 1K6OA 3DEUA 4CGZA 2Q0OA 3M9AA 4ZYEA 2OBPA 2VODA 1T0FA 2HKXA 1W5TA 4R79A 4Q48A 2LNBA 4ZZDA 1W7PD 2QVOA 4HX4A 3E6MA 2Y48A 2HQRA 1I1SA 3L2CA 1XDSA 2CO5A 1SAXA 2ZO4A 3FXRA 3QRFF 1WRJA 3E5UA 2RQPA 4M6XA 1BBYA 3ZMDA 3GF2A 3FMSA 5D8LB 2NS0A 4A2UA 3U2RA 2GXGA 1ZLKA 2L3DA 1G3YA 3R6SA 4L9TA 4MHGA 3I59A 1U5TC 1PP8F 5L3CA 2K4JA 2ZKZA 3ELKA 3M8FA 4HQEA 1R5HA 1U5TB 4KT5C 2XKPA 1ZGAA 3WTWC 1RNLA 4EM0B 3IRQA 2L4AA 2QM3A 4AVPA 4EJOA 3HOTA 1XGMA 2KIMA 3DPTA 5JI6A 2P4WA 3U1DA 3B73A 4YIIA 2VN2A 3MZHA 4XSXF 4MTEA 1FYLA 2LKPA 5FB2A 1UHMA 3I71A 2E1NA 2BE5F 5HOOA 5E1ZB 3J7AO 2HR3A 1OKRA 3GO5A 2FQ3A 4HQMA 5H20A 2VT2A 2HZTA 1H9TA 4EJVA 1FYKA 3E5XA 4KN4X 3OOPA 2V79A 2RVCA 3R61A 4QWQA 1O57A 2D1VA 5DD8A 5CVVA 3V8KA 1S8NA 5FGMA 1JGSA 5F1RA 3RKYA 3C1DA 1O3RA 2P6SA 3ZP5A 4OMZA 3F23A 2STWA 1R22A 1HW2A 3ZN1A 4Q47A 1S3JA 5CVJA 3OV8A 4I0BA 2EFQA 4OIQF 3WTZA 1LDDA 4A5NA 3DFGA 1REPC 1Z6TA 5J8FA 1FBUA 2XAFA 1P4AA 3HOSA 1KU2A 4LLNA 5D6EA 5HDNA 3E3VA 3V7RA 3HTUA 4UUVA 1B4AA 2OD5A 1J2XA 1RUOA 2STTA 2OZUA 1HKQA 2IA2A 4RGUA 4LB5A 5JHUA 3KP7A 1ZG3A 3V4GA 1T6SA 1IXRC 2P5LC 2LDUA 5DUKA 4A5MA 4EMSA 2ESHA 2VONA 4AWXB 5A2QZ 4U7DA 2XIGA 5H6RA 4HA8A 4FHTA 2G7HA 2L01A 2VT3A 1U3EM 2PMHA 2FBHA 2BBYA 1ZLJA 2UZKA 1R1TA 2LSOA 3K9TA 5E8IA 1JHHA 4KIGA 3PQJA 3DQVC 1UFMA 1B9MA 5E17F 2QUFA 3NRVA 1G4DA 1D8KA 1C0WA 1ZN2A 2EV6A 5LEJA 3LAJA 1CF7B 4HLYA 3GFLA 2COMA 2PFBA 2VOPA 3S2WA 2EFPA 3GWZA 1FY7A 4LK0F 2IRFG 3KLOA 3V7SA 1PP7U 3K1PA 1BI3A 1KYWA 1U8RA 3LQRA 5LEKA 1XGNA 2JPBA 4OIOF 2HYGD 3H92A 4LGWA 2XVCA 3IWZA 4EVIA 1R1UA 3LFKA 5D6FA 1JHFA 1H9GA 1FBSA 3ERED 3QOPA 5CVUA 2H27A 1LJ9A 3HRMA 5LHHA 3G73A 3C7JA 3KE2A 1HKSA 2HWVA 1KU3A 5L3FA 2H94A 1G6NA 2H09A 3L7WA 3BROA 1K79A 3M8EA 1D5VA 1V3FA 2DLLA 4P5OA 2OQGA 1LEBA 4IHSA 4M71A 2CWEA 5DD4A 4KIFA 4BHPA 1BM9A 4EGZA 4E70A 3FXQA 1P4WA 2Q8KA 4PGGA 4F7ZA 4AIKA 4ENJA 4OINF 5DUIA 2BEOA 4YG2F 2LF8A 2VE8A 3T8TA 4A0ZA 2HS5A 1W7PA 1SFUA 3BOQA 4JQFA 1XMKA 5CVIA 3WU1B 1GVJA 2MH2A 5HDKA 1XD7A 3HRTA 2FE3A 5BPIA 1A04A 3L00A 2ISYA 1Z1DA 2Z9OA 5FFXA 1FYMA 3F3XA 2PJPA 1TBXA 4IVNA 1SMTA 4I7HA 3RKWA 1LB2A 5ILVA 4U0YA 3MQ0A 1FC3A 2Z33A 1I5ZA 5DCMB 4KMUX 2Z3YA 5E20A 1EH6A 2TDXA 1J75A 4M9ZA 3JAMK 3R60A 4RAZA 3GFJA 3IL2A 3V8JA 5HS8A 3VOEA 1I27A 2M5WA 2KIFA 2HTJA 4RGXA 2V1UA 5HVQC 1QZYA 3Q9SA 1HBXG 1U5TA 2F5DA 1IN8A 2L54A 4L5JA 2CG4A 5DEQA 2QBYB 3GUDA 1EV7A 2F2EA 4P55A 1YO5C 1STZA 4L0YB 3PFIA 5L3EA 4HX8A 1G3WA 1B6AA 2J5PA 2K86A 4A12A 4ESBA 3BY6A 4BH9A 3VEPA 2FSWA 1JE8A 1J5YA 4YFNF 2UXXA 4XBFA 3SZPA 4BHCA 4Q5SF 2K27A 1MZBA 3HIFA 3F21A 2JZYA 2DT5A 2FNPA 1I1GA 3P9KA 2M87A 3HUGA 2RKHA 2DPUA 1IN7A 6PAXA 1T98A 1R5GA 4LMYA 5ICCA 1HXDA 3DV8A 1YS7A 1ZRFA 1FSEA 4P96A 4EM1A 1KQ8A 3AAFA 1Y0UA 5E1WA 1NHAA 2V1XA 2Z5UA 3N4MA 1FP2A 3SHFA 5HLGA 5ED4A 4LLGF 3KP5A 2XAJA 4EV0A 4WK8F 2IA0A 1TW2A 3QAHA 4L5IA 1ZHFA 3EUHA 3I64A 2HKOA 4IRIA 4Q4ZF 2D1HA 3K69A 4MTDA 3H3ZA 3F72A 2O6GE 2E1CA 4G6DA 4OMYA 1GHCA 2PN6A 4AIHA 1XMAA 2M8EA 3LAPA 1O3SA 2P5KA 2J5OA 1VTNC 5H6QA 2QZ8A 3F8MA 2X0LA 2QYOA 2RN7A 1XN7A 3EDPA 1R1VA 1LDJA 3QU6A 2OU2A 4G8XA 5J8CA 3CUQC 3IC7A 1EH7A 3FMRA 1J7KA 4FX0A 4P9FA 2Z99A 3RKXA 2JT1A 3VODA 2B0LA 1D8JA 1FZPB 5D5VB 1YYVA 4YFKF 3CUOA 1HSTA 4RB0A 3LA3A 4U0WA 1AOYA 5FFZA 2FBKA 1U78A 1HKTA 1Q1HA 2EA4A 1LQ1A 3RYPA 3B02A
chains in the Genus database with same CATH superfamily
3R0JA 1IAWA 2K4BA 3LL7A 3KYDB 1I6XA 3K4JA 3FF5A 3E5QA 4P9UA 3Q9VA 4I2OA 2HYJA 4CDGA 2VIXA 1S7AA 3QP5A 3REOA 4RGSA 2A6EF 1FWZA 3BZ6A 3QWLA 4XKCA 5DCFA 2LLKA 3S8PA 3V42A 2V9PA 2BV6A 4KMFA 2ZC2A 4KIBA 1MMDA 4HV6A 3QPTA 1O3QA 4XN3A 2YPRA 4A3MJ 2ZJ2A 4G7ZF 1BOAA 1YG2A 4JX4A 2E60A 1FTZA 2NYXA 3TDUC 2L9VA 2VQHA 3OL3A 4PZJA 5JFRA 5EF6A 3W2AA 3BPVA 3WHBA 2GWRA 1XGOA 2FQ4A 2A05A 2OZ6A 5EG0B 1YJWI 4M9XA 2L7MP 1F43A 4UV8A 2YS9A 2QCOA 2EFNA 3H3UA 3LSTA 3HJEA 3PFYA 3GXOA 2DPDA 2BGCA 1CGPA 4RB3C 3KP6A 4WF2A 4XLFA 2UXNA 1VZ0A 3TOBA 2R7UA 4LJZF 1R36A 2WY7Q 2ZCWA 3P9CA 4DYQA 1RRJA 1IGNA 2LC2A 3I5UA 3OR2C 2JA6J 2XC7A 4OOIA 1ETWA 4IL6C 2R7XA 4HZFA 5LRRA 3CDIA 4V2GA 4G6QA 5M3FJ 4KYWA 5K7HA 3WTTC 3WTSC 1S6LA 1MSFC 2F5EA 3I0TA 4MEXF 4M9SA 1TQPA 4K2EA 1DUXC 2WAQA 3RZOJ 1TWFJ 3OY9A 1J0RA 2DDAA 2WC2A 3H35A 2W25A 1NG7A 2X6WA 3H3VK 2E71A 1JUPA 3CJNA 3DU5A 2BW3A 1Z6RA 1ZGJA 2FF4A 2Q2EA 2RV8A 2YX4A 3KZYA 3K70C 3MVPA 1U8BA 4LOCA 2ZXIA 1VF9A 5DDGA 2XAGA 2X1CA 4AC0A 1Y6IA 3K1MA 1PYVA 2HU9A 5IT9Z 2JA5J 3ABUA 3BWGA 5K5OA 1BC8C 2VBWA 4M72A 3FX3A 2LVSA 5BS6A 2XAUA 3WTUC 2XGEA 4B43A 3IAM2 3IH4A 4XOTA 4WXHA 1X4PA 3OSGA 5L3DA 5FRMA 3CCYA 1V55H 4I01A 3O6BB 3IWFA 3K70D 4LB6B 2FMYA 1ORKA 1B1BA 3TW6A 2X1DA 4E7JA 4ESFA 4UNOA 3LSGA 2ZBKA 1N25A 3LA7A 2DXIA 2W84A 4KFCA 2MBFA 1XSXA 3P7NA 3K4KA 3ZOBA 1K78B 2JUCA 3D0SA 4XQFA 2HVRA 4E7IA 3KP2A 1ODDA 1YW8A 2VUMJ 3GTQJ 2CW0F 2FBIA 5LGNA 4KISA 4HG2A 2PEXA 5AONA 1WZ2A 2FMLA 1LFBA 1GV5A 2IXSA 5GP9A 1OFCX 1X4OA 4BHBA 4JBAA 2ECCA 3HRSA 1KZHA 1FPQA 2A61A 3JW4A 2VXDA 4UUSA 2DN0A 2ME6A 5D4SA 1SD6A 1UG2A 4O3MA 3JRIA 2X48A 2ICWG 4XONA 2ACJA 2IA1A 2JWTA 5IYBJ 4ENMA 2L02A 2FNAA 2EA2A 4YRVA 4PK4A 3HM5A 2R7TA 4QTRA 3HPHA 2I10A 5J4VA 3WTVC 1KYZA 3WE3A 4WWCA 2K40A 3BQZA 4KDPA 3PO2J 2EV0A 5E1XA 5HLIA 3KEQA 3ABMH 5L3GA 1BI2A 3TW7A 3DP7A 3CMMA 5ERIA 2BZTA 4CICA 5M5YJ 2A5YB 3DKYA 4FCYA 3SXYA 4UY8I 4S05A 5D4RA 4Y7NJ 3Q0VA 1HQCA 2K02A 2EILH 2M8GX 4L9NA 3L2RA 4RAGA 1U0JA 2W48A 3SDGA 4E7LA 3CC4I 2XF6A 3GCMA 1GLNA 1N75A 1OR7A 1KU9A 5FKLA 5E18F 2YU9J 2CQ7A 4PJLA 2OTLI 4XRSA 4ZYGA 5E3OA 4F55A 3AG3H 3I9V2 1HF0A 4HPQA 2AHQA 3FXKA 1R7JA 1T39A 3VYUB 1Y56A 1LNWA 1ETVA 2R7VA 3W2VA 1V4RA 1MMSA 2EZKA 1YOVB 1XPXA 2HDCA 5DCMA 3QQAA 9ANTA 3TL4X 2CS3A 1H0MA 2WTEA 2MGQA 5B3SH 1QPMA 1VQPI 1SD7A 3CCMI 3KZZA 2ZMEA 2R5ZA 2DO7A 1OISA 1XDUA 2NNNA 3K6GA 3BPXA 2K9LA 4D1QA 4Y33A 3WTXC 4QPOA 3FBIB 5DS9A 2QEXI 5FROA 2QLZA 2DQRA 2LP0A 2R7FA 4MFEA 4XM3A 1BL0A 3CC7I 2XF7A 3ABTA 5HNFA 4TV7A 2EZLA 1Z7UA 2OF7A 1WJ5A 4JX5A 3E97A 2L9SA 1ZH5A 2P8TA 1HCRA 3L09A 5K1YA 1X3UA 1S5LC 1OYYA 2FXAA 5ICGA 1ZKGA 2K7LA 1MMGA 4GGGA 1W1WE 1XCBA 1X1BA 2L4MA 4DYCA 3GZ6A 3TMOA 1O7LA 2O03A 4ABZA 1W0UA 3OYEA 1BI1A 3I4PA 2QBYA 1TWCJ 3Q0WA 1T33A 5KAIC 5A2QK 4LG0B 1P4XA 1D0XA 2VKEA 5FLVA 5BOXA 1OYIA 3FKIJ 4DBRA 1X1DA 2XSJC 3J7ZI 3GEZA 2CW7A 2KHMA 3LOCA 3M07A 4M74A 1R6RA 2RQQA 2WAFA 1IXCA 2QF7A 5IOYA 2UWMA 2PMZN 4HDVA 2EPFA 3ZMSA 4BE1A 3ZR8X 4A3IJ 3BP8A 3K7AJ 2P7CB 4IZZA 2CQNA 2FU4A 2DJIA 2DMQA 4AM3A 4NQWA 1D1CA 3J80Z 5ILUA 1ETQA 1FIPA 1V54H 3OYBA 4II2A 2DI3A 2E7WA 1BC7C 1IRXA 1ZARA 2OV7A 3HGYA 1YS6A 4E7ZA 3CCVI 2IW5A 2H8RA 1RZ4A 1Y8QB 2XUBA 1IZ1A 1M1EB 1U6GA 3DPUA 1N77A 2B7EA 4ZYAA 2BY1A 4D9JA 3NARA 4E7KA 4O6JA 4GYGA 2BXZA 3L1PA 3E0JB 2GQQA 4UVBA 1ACIA 1Z05A 3FBNB 3T0YA 2HQAA 2OAZA 1YW7A 3K0LA 3EYYA 4M73A 1TT0A 2JTVA 5D5WB 4C3IJ 1HW5A 2UV1A 1W0TA 3KIOA 2RGVA 2F4MB 4JK1X 2XHKA 3RPQA 2VKHA 4KA4A 3DKWA 3LSMA 3F22A 3HOVJ 1LUJB 2NVXJ 1YHQI 1WPKA 1TWGJ 4H4KC 1R5ID 1L3LA 2CFXA 4LLLA 5E3MA 1IRFA 4XKBA 1VQNI 4A3BJ 2HQNA 2V6CA 4MIMA 3I56I 2DA3A 4FX4A 2R5YA 4U0VA 3M1CA 5GADJ 1YJ9I 1O3TA 1ZGWA 2GLOA 2PJRB 2JRMA 3KFWX 1E2XA 1OCTC 3U9GA 3VSKA 3A4CA 3CTAA 1TNTA 3FHZA 3TO9A 4V2FA 2HOEA 4UHTA 3NQOA 1UHWA 1X19A 2OUMA 1R4MB 1HLVA 4D0PA 3ZQFA 4BEHB 1W4MA 1XGSA 2MC3A 3F6VA 2XGCA 4MQ9F 3GTJJ 3DTKA 5F6FA 1CQTA 3O3KA 4IHWA 2H6CA 5LGTA 4HX7A 2O3FA 3JRBA 4F3QA 4ZH4F 5KVRA 2G0EA 1FOKA 2M1BA 1BR2A 2MA3A 1DPRA 3CLOA 1MBEA 3ZMTA 1ZG5A 4I98B 1E3OC 1ON1A 4RBOA 1QO0D 1LVKA 4MLOA 3GTPJ 3FM3A 2O61A 1P2FA 2KL4A 3BTJA 3MAJA 1SFEA 4HV5A 3RPUA 3J80K 1FP1D 2ZJQF 1DPUA 4AUXA 2V4JC 5JHFA 4G7HF 2O0YA 1LE8A 1WCMJ 2EWNA 3HSEA 4MNUA 1T38A 4UUTA 4B8XA 2XDVA 2EJRA 4S0HB 2L7KA 1MKMA 3RQ4A 3V8LA 2JRTA 4BQAA 2CYYA 2OC6A 3CJTB 1A6QA 3RYRA 1RUNA 4XLEA 2KZGA 1YRNA 4WCGA 4UXNA 2VKDA 4OIRF 4L0ZB 4BQNA 1DGRM 4D5FA 1ZAOA 3GMEA 2RDPA 2K9NA 4RB1A 3ZN0A 4E7HA 3BJAA 2K3PA 4UB8C 4CCNA 2A68F 5EGOB 3X2QH 2KFDA 4PSXA 5CQGA 4XN0A 3A01B 3LSJA 1IJWC 2E7XA 2CUZA 3M7GA 4G7OF 3E6CC 1ZTRA 2M3AA 5LBQA 2GIZA 3MKZA 1S7EA 5F08A 2O9LA 1MH3A 3GVAA 3OYGA 3CO7C 4HNVA 3WE2A 2XB5A 2KJCA 4A6DA 1KU7A 1RI7A 2DK8A 2H1LA 1E3PA 3CP8A 1MMAA 1MGTA 1B72B 2JA7J 5F1JA 1NG6A 3IKTA 4CCLA 3R0AA 4F91B 3HOWJ 1YLFA 3HZJA 4OAZA 3E1SA 1LDKB 1BA5A 1PVEA 2P7VB 4NNJA 3D1NI 3PNTA 4M3DA 1XB4A 4IEJA 3S1QJ 2MD5A 2M7AA 4B48A 2YUSA 4X0GA 5BNGA 2N8GA 5EG0A 1BIBA 1PUEE 2M30A 1NK3P 1T56A 4JYKA 2BHYA 1AU7A 3DTIA 2LBFB 1MDMB 4XSZF 1JT6A 2OJED 1YIJI 1WJDA 1MBJA 2VBYA 1DU6A 3DU6A 3NAUA 4NC8A 1G3SA 1IN4A 1JJ8C 2LY1A 5GAHJ 1OMIA 3MCZA 2DTRA 1ETYA 3K4BA 2W7NA 2IAIA 2OA4A 3I3LA 3RTRA 4BXFA 3JCUC 4M3GA 1VQOI 1PDNC 2R7QA 1FNNA 4DBQA 3H9QA 2KIUA 5K5QA 2ETHA 2VC1A 2GZWA 1IF1A 1FOXA 3OYHA 1MBHA 2VC0A 3JRHA 4R1HA 3DBLB 1ETKA 3OOUA 4IXAA 4BGDA 3RKQA 3ZQLA 1ETOA 1VNDA 1MNEA 3VFZA 2X1EA 3K4LA 4XICA 5DM7F 1UMQA 4IHYA 2VPLA 3O8GA 3MZYA 1V5EA 3ML6A 1HW1A 1HOMA 4D5CA 1F5TA 1BJAA 2KKOA 4N0BA 3GFMA 3OYLA 1JI8A 2XB0X 2IGNA 1Y8RB 3EUAA 4UVCA 2M45A 2Z1DA 3CMYA 4EJTA 1K4SA 2WA0A 2D45A 3ZQHA 5L3BA 2FUG2 3GYHX 3HXLA 5EDNA 3HKZA 1UJ8A 2A69F 4KN7X 3ROUA 1Z21A 4BDZA 5CVRA 5HDGA 3HOYJ 1SFXA 4I09A 3PJRA 1QZZA 5HS9A 3TOAA 2WWYA 2L5QA 2PX9A 2LFBA 3I53A 3MMYB 1U2WA 5FD5A 2QQ8A 3S17J 2DMNA 3TQNA 2FEZA 4AD9A 4U7BA 1K78A 3HHGA 1MJAA 3TKYA 2QQAA 4AIJA 2CQKA 4Y15A 4QLCU 2QWWA 3K1NA 3BZCA 3B6CA 3P5JA 2YX7A 1OPCA 5CLSA 2LKXA 3JREA 3CLQA 1IXSB 1VQ7I 1YTYA 4C3HJ 1BI0A 5JR3A 4IOCF 1WKMA 2VQCA 3WODF 2XV4S 1TTYA 4FE4A 3SYTA 3CUQB 3N05A 3F6OA 5J40A 4PGHA 2GAUA 5IT3A 1JXSA 2NVQJ 1LVAA 1NTCA 2L9NA 1MJ9A 1Z9CA 4C2TA 1EH8A 4PUSA 2CQXA 5BPDA 2ADUA 1B9NA 4XLNF 4BAYA 1OJLA 5FLXZ 3LQQA 2VOOA 1T8IA 4ZYHA 4FE7A 2C6YA 3LSIA 3C18A 5J6XA 4EGYA 3C2BA 3OYKA 3IRRA 4HF0A 1R49A 3CJRB 5IYDJ 3LA2A 5E8GA 1J59A 1ON2A 3H0GJ 4A0YA 1SC7A 4MEYF 2CGPA 4A3FJ 1WJAA 1HDPA 4OIPF 1OCZH 3BDDA 5GPCA 2F5CA 1B59A 2DJNA 2H6BA 3K2ZA 1DP7P 4XLPF 3GTOJ 1ZG1A 2JSPA 1OCRH 3EQLF 1QNTA 2FRHA 3MEXA 4L18B 3FK7A 1JKOC 1RKTA 5LHIA 5KCMA 1P7JA 1YQAA 4PDKA 4CHUA 4DQ2A 1T2KA 1R58A 3SDBA 2ISZA 2PMUA 1XCVA 3VYRB 2LY9A 2IBDA 4N9IA 1A36A 3S14J 2HOTA 4ZDOA 3OSFA 3IP4B 1POGA 2Y0SN 3I58A 4GXOA 4RM3A 4RLQA 3TO6A 2K9SA 2V9VA 2PQ8A 2FOKA 1WSUA 2VB6A 2NS8A 3WGGA 1RC9A 3F8FA 3O2PE 5ILSA 2IJLA 2XKOA 4RLFA 5BQTA 1IRZA 3SZGA 1SVLA 1TW3A 3HOUJ 5GPAA 4EATA 1V5GA 1CF7A 5BMZA 1WJBA 5J1UA 4RAYA 4BXXJ 3KP3A 1FT9A 5D5UB 3PSFA 5DM6F 1TQIA 1YE9A 2EV5A 2JVHA 4XKWA 1H89C 3H9JA 1MW7A 1QQIA 1WQ2A 1KQ0A 1WVRA 3DWLE 3WHCA 5AIPA 3BTIA 3G3ZA 3BTLA 5GAEJ 2KP6A 1T0FC 3ZMZA 2OPTA 4I0AA 3N97A 1UCRA 5CYVA 3E7LA 3S2HJ 5FLXK 4RGRA 3HPGA 1Y0NA 1S7OA 3G2BA 4QPQA 1Z91A 4KJZA 3S16J 3MKYB 5IY5H 4A6EA 2W57A 5ICFA 4LG0A 5LLQA 1GV2A 2DA4A 3AL0C 1KONA 3KLNA 3IKVA 1BOBA 4IJAA 2FD5A 1ULYA 4GCVA 5K5RA 4S04A 1D0YA 1G8XA 1Z3XA 3DF8A 1R00A 2DOEA 4UVAA 3EYIA 5B1AH 3M4OJ 1I50J 2PLYA 3OYIA 3AL0B 3JTHA 1JKPC 4ZJZA 3Q5FA 4BS9A 2XROA 2W00A 4L9JA 1JGGA 5DTDA 3FZVA 1FSHA 4CCOA 3BR3A 2DBBA 4ESJA 3G1OA 2MFZA 2VBXA 4N9HA 3GX4X 2VXZA 2IS6A 3PNYA 1B8IB 1TZLA 4BNCA 1ETXA 2W4SA 1W5CC 3GBGA 2PMZA 4YFXF 3GTGJ 4C3JJ 3LSPA 3ABLH 1F9NA 2W24A 2P5VA 3CO6C 3SZTA 3ECHA 3JSPA 3KETA 2L0KA 1F1ZA 1GXPA 4BKXA 2EFOA 2R0QC 5TJJA 3EPZA 1ZR4A 2NRAC 1IN5A 3F8NA 2XPUA 3A2KA 3SEQA 1UHSA 3WU2C 2ZNYA 4B4CA 1R23A 2V1DA 3PL8A 4XRFA 5EZHA 2EFWA 3IHUA 1A35A 3I59B 4NB5A 3F8CA 1YX5A 2CW8A 2Y75A 2ZNZA 3QPHA 4A69C 1RPWA 2ZFWA 3OL4A 1USTA 2WV0A 4BQQA 4HYEA 2FX0A 2YU3A 4AYBN 1UG0A 4CYDA 1SVMA 5E79C 2LYCA 3SQNA 5K7FA 3CCEI 5LHGA 2KQRA 3KYLA 4YIFA 3MD2A 2P81A 3FXUA 4RB2C 3PM1A 2DYSH 4BE2A 2MSYA 2PJRA 4WXDA 1L0OC 2DDBA 2DA6A 2XAHA 3I54A 3JTGA 2PBIA 3R4KA 4DNCA 2R4GA 2EK5A 2YSRA 1SEUA 3HTSB 2ZXJA 5IT9K 3RJPA 1QGPA 1MMNA 4IKFA 2EINH 3RIRA 2CUJA 3ASOH 2M4KA 3RDIA 4BEHA 3ASNH 4LD5A 1ZRDA 2DK5A 4HBLA 3JRAA 1RIOH 2OCEA 3LSHA 3W2WA 4BBSJ 1HSJA 3OMYA 4EQQA 1IV6A 4B09A 4GO1A 1WH5A 3ABKH 2VKVA 1OYWA 1MNMC 3W6VA 1WI9A 2CSOA 1IN6A 3E6BA 4DZPA 4G6TB 1FX7A 3BR6A 3PQKA 4HNUA 4ZZLA 3HEFA 1SVOA 2JVGA 4QIWN 2XASA 1BIAA 2XGDA 4BY1J 1H8AC 3HRUA 5TGTA 3H9GA 4GYIA 3OYCA 1ERDA 4W1UA 1WHUA 4RS8A 3ZPLA 5IP6A 3ULQB 2ELKA 1WGXA 3KP4A 5F0CA 3RSNA 1G3TA 5IPAA 3L9FA 2QSGX 4WXCA 2YR2A 2K3FA 1DU0A 3P9IA 3QYFA 2ID3A 3CP2A 2A07F 2IS2A 5B66C 1BJZA 3H5AA 1VQMI 2E1OA 4XL9A 1K7AA 4OU0A 2IP2A 1ITYA 3S3MA 1P6RA 4HDUA 1YFHA 3HYIA 1K4TA 1K83J 4KITB 2OQRA 2Z2SB 3ECOA 3WGHA 4RA2A 1LKXA 2D2WA 1IDYA 2G9WA 4ETSA 4IHXA 1SMYF 3MWMA 5EGOA 2HOAA 1MD0A 4EJUA 4IRGA 3A01A 1DDNA 4OWRB 2X6OA 5LGUA 3WGIA 2VJIA 1FLIA 2MLKA 3DCFA 5FO5A 1IUYA 2GA2A 3D5LA 4L9VA 2BW3B 5C4JJ 1WJEA 2R7DA 4CO8A 1EJ9A 4MO7A 2CV1A 5FKOA 4UV9A 2RC4A 2CJJA 2ELHA 4Y4RA 2VJJA 3CCQI 1XSDA 2AQFA 1U9OA 3DKXA 5LRSA 4BBRJ 4EJWA 4JX6A 5C3EJ 2A3SA 3C3WA 4G94A 4XLAA 3WU0A 5IYCJ 4B47A 5ICEA 2R3SA 1ZREA 4D7NA 2EB7A 1B72A 1E0EA 3FXMA 3BT9A 3HSRA 5KK1A 3RCOA 3FMQA 1V5FA 4HW0A 3RQIA 2DW4A 3G1MA 2LREA 3HOZJ 3PO3J 1I3AA 2V6EA 5AIQA 3J81Z 1JTXA 2EZIA 4CZZA 1YITI 1YX3A 4BL0B 1KA8A 1G2HA 4BU2A 1QU3A 1J9IA 5HS7A 1O4XA 3ISPA 4DW6A 3JSOA 1EKEA 3ZMVA 1MDMA 1TWAJ 1USSA 4CA0A 4IRHA 1ZRCA 1GXQA 1MNDA 2CV2A 3OWTA 3LNQA 2LOOA 2ECBA 3JAMZ 4WX9A 1I6HJ 1DGWY 1TNSA 2IPQX 3K2AA 1JUMA 4BUPA 5FD6A 3NEUA 4ASNA 4EM2A 2AS5F 1Z77A 2Y0MA 1GDTA 1QHHD 3U21A 5EEAA 2HZDA 4BYYA 4I76A 5DYMA 2RNJA 4IHTA 2XSDC 2ZFUA 3ZQ7A 4L5EA 1QBJA 3MFKA 4YIRX 5FJ8J 1VQ8I 4CXFA 5CJ9A 2EH3A 3W6JB 2PI0A 2WV1A 5FLMJ 4ENKA 3DPLC 2M0MA 3CMAI 1TWHJ 4J19A 1S29A 2DOAA 4PJNA 4EEFG 2BYVE 3KCCA 4MQVA 2HDDA 4FETA 1YW9A 2MLGA 1TLHB 2W1OA 3EETA 2P0WA 2X6XA 4KICA 4ENNA 4YEJA 1PUFB 2LTPA 2FA5A 4CZCA 4D7MA 3OYAA 2ESNA 3AKZA 3MZ8A 2NOJB 3BTCA 3MKWB 1K61A 1LEAA 4BY7J 1OR7C 4Y13A 1VQ6I 2IGMA 5KNLA 3NWTA 2DOFA 1WWXA 4ON0A 3HHHA 4XNFA 2IGKA 2KJBA 4Z2YA 3TO7A 3GLXA 1S9HA 4C2MJ 5DV5A 4NDLA 4M6YA 4C2UA 2R93J 3QYEA 1SFOJ 3LWFA 4HOBA 5EEGA 5TISC 3DXJF 2EIJH 3GZNB 3WTYC 2GIVA 1W5SA 4NHJA 2MYSA 2W85A 4N4NB 1E17A 2QENA 3QPLA 1VQ5I 3BJ6A 1P9QC 3J81K 4ITVA 1IW7F 3FISA 5D5XB 3FKJA 2R92J 4KUMA 1MJBA 2MH9A 2RNGA 2ZMEC 2KMUA 3GZ5A 2CMPA 3HGGA 2G7UA 3RZDJ 1KGSA 3GTKJ 4J01A 2JMWA 3CUQA 4PCQA 3HL2A 4J00A 1TQMA 3FM5A 2O8KA 2ZMEB 2GXBA 4FT8A 2DFIA 1X58A 1YIOA 2BVLA 3ZCOA 2IVMA 2M2EA 3T8RA 3OS0A 4HEA2 1A6IA 4R8HA 2HYFA 2XRNA 3ZQGA 3H1CA 2X4HA 2LKSA 2XGXA 4I02A 5F64A 3T5XA 3ZMUA 4HLXA 3KEOA 1XSVA 3TGNA 1P92A 2JSCA 5EYRA 1Q1VA 5FKKA 1IDZA 2CV0A 2DQLA 2AXLA 1F4KA 5FKNA 4FASD 4KNYA 5IP9J 3VB2A 3JR9A 1X2NA 3S32A 5M5WJ 4MGRA 4II3A 4LFUA 2QSFX 2Y30A 4ZYDA 3FWEA 3W6KB 3COAC 2CUEA 4LITA 1ZQ3P 3TDZC 5HLHA 1D3YA 1O7FA 3ZQQA 4HF2A 2WY8Q 3HSFA 1Y1VJ 1FBQA 3E6DA 2A6HF 2HFHA 3GLLA 2KRFA 1JTYA 1D1BA 4XRMA 1NK2P 1NH3A 2V7FA 3GW2A 2DAOA 1UB9A 2GA1A 2JPCA 4H0EA 1KQ9A 3PIOF 3GFIA 3PSIA 3M1EA 2HQ5A 4LIUA 1VI0A 2DA1A 2KPMA 4Y17A 1HA8A 2O8XA 4U88A 2V9KA 2HEOA 3QP6A 2HGCA 4XLCA 2IT0A 3QU3A 2I5UA 1X2MA 3BQYA 3G71I 2KDOA 2E5ZA 2DA5A 4A3KJ 4IF4A 1H88C 1IRGA 2Y0SA 1SD5A 2P6TA 4IX7A 1FOYA 1X1CA 5D8KB 1VQ4I 2TRTA 1SD4A 2F48A 1J09A 1APLC 2HTSA 2X9DA 3CESA 4IPAA 2HPMA 1ZYRF 3WG9A 4NBQA 1AHDP 2LF7A 3CDHA 1XS9A 3V7CA 1BN5A 2V26A 4O5VA 3BJOA 2F5FA 1ONVA 4NC7A 4XMYA 5B1BH 2KZVA 3K4MA 4G9YA 5TRDA 4F93B 4HRIA 4HAMA 2Y2ZA 5EEHA 2RREA 1AWCA 4HF1A 2DU9A 2QQ9A 4A0XA 2PG4A 4BXUA 5JVTA 2NNYA 5HNHA 3F8BA 1W7PB 2QQBA 3CQZJ 4LK1F 2VE9A 2LD5A 2NAZA 2VBZA 2VJ5A 3SFZA 3RI4A 2XAQA 5CPRB 4ZDLA 3T1BA 3CCUI 1K6OA 3DEUA 4CGZA 3OS1A 1X1AA 2Q0OA 3M9AA 4ZYEA 2OBPA 2VODA 1T0FA 2HKXA 1W5TA 4R79A 4Q48A 3L2WA 4ANJA 2LNBA 5KAFC 4ZZDA 1W7PD 2QVOA 4HX4A 4BJTA 2H1KA 3E6MA 2NVYJ 1JJ6C 2Y48A 4BQOA 4JP0A 2HQRA 1I1SA 3L2CA 1GUUA 1XDSA 3PUBA 1AKHB 2R7ZJ 2CO5A 5J47A 3CF5F 1SAXA 3ONQA 2ZO4A 3FXRA 3QRFF 2E2JJ 1I39A 3HBLA 4M6VA 1JKRC 3DBRB 1WRJA 3E5UA 2RQPA 3FK6A 4M6XA 1BBYA 3ZMDA 3GF2A 4M3EA 3ZXSA 4BJ5C 3CMEI 5FRNA 1R71A 3G4SI 3FMSA 4ZC3A 5D8LB 3HC7A 2NS0A 4A2UA 3U2RA 2GXGA 2ELJA 4OAYA 2VLAA 1ZLKA 2OTJI 3HB9A 2BOLA 2A6TA 1LE8B 3M3YJ 3FDYA 2L3DA 1G3YA 2DA2A 3R6SA 4L9TA 4MHGA 5E3LA 3I59A 3ESWB 1U5TC 1PP8F 5L3CA 2K4JA 5IOZA 4XIDA 4RM2A 1XTAA 4XR6A 1YRNB 2ZKZA 3ELKA 2DT7B 3HG9A 1U9NA 2E2HJ 3JRFA 3M8FA 4HQEA 3DLAA 1R5HA 1GVDA 4IQJA 1U5TB 3VWBA 3C2HA 4AU7A 3S1MJ 1IV8A 1XG1A 3KX2A 4KT5C 2XKPA 1S72I 1ZGAA 4AYBA 3WTWC 1RNLA 4EM0B 4B1RA 3IRQA 1OLTA 1R9TJ 2L4AA 2QM3A 4BDYA 3H5RA 3DEEA 2KLOA 3IH3A 2GOXB 1G59A 3A1YA 4AVPA 2K9MA 4F52A 3W3CA 4EJOA 3HOTA 1XGMA 4XKVA 2KIMA 1ZR2A 3DPTA 3UR3C 2L7ZA 3OYDA 1P7IA 5JI6A 2ZSIB 2VASA 4PJJA 1PJRA 2NS7A 2CFOA 1RKWA 2P4WA 3U1DA 1RR8C 1X3ZB 3B73A 4FQGA 2COBA 4YIIA 2VN2A 2R7RA 1FJLA 4CSWA 2D5VA 3MZHA 3DTEA 1SAUA 4E4HA 3OYJA 2NVUB 1TL8A 2QA4I 3S1RJ 2Q1ZB 4XSXF 4MTEA 1D5YA 2EBIA 1FYLA 2HXIA 2KIQA 3BC8A 2LKPA 1JT0A 5FB2A 1UHMA 1AA7A 2WB1N 2XPWA 1OCOH 2FJ1A 1EF4A 3I71A 2E1NA 4HNTA 1QVUA 2BE5F 3HUGB 5HOOA 5E1ZB 3J7AO 1QPIA 3K4CA 1WFXA 3PIPF 4AVZA 2JA8J 2HR3A 4DIQA 4CCKA 1OKRA 5IP7J 3GO5A 1RETA 2FQ3A 4HQMA 5K7ZA 5H20A 3SEZA 3KEYA 2E35A 2QKMB 2VT2A 2HZTA 1H9TA 4EJVA 1YI2I 4V19K 1GT0C 1FYKA 3E5XA 3CC2I 4PFOA 3S93A 4KN4X 3OOPA 2V79A 2RVCA 2BXYA 2IGOA 3R61A 3EUHC 3BR5A 3TEDA 4QWQA 4CYCB 4I99C 4IO9F 2GXAA 3A0HC 1O57A 2D1VA 5E3NA 2WAEA 5DD8A 2HXOA 5CVVA 3G1LA 3V8KA 4HSRA 1S8NA 3HKZN 5FGMA 1JGSA 3OYFA 2CQQA 5F1RA 4CCMA 3RKYA 3C1DA 1O3RA 2P6SA 2Y9ZA 4RAFA 4CH7A 3ZP5A 4GFBA 2JQ7A 4OMZA 2X51A 3QOEA 2KDZA 3F23A 2STWA 1R22A 4GDFA 1HW2A 3ZN1A 4Q47A 1S3JA 3F0CA 1JUSA 5CVJA 3FXJA 4DZJA 3OV8A 4I0BA 2EFQA 4OIQF 2VL8A 2CH0A 5GTHC 3WTZA 1XC5A 1LDDA 2MABA 4Y3OA 3B6AA 4A5NA 3S3NA 1XMXA 3DFGA 1REPC 1Z6TA 5J8FA 2LK2A 1FBUA 2XAFA 2F4OB 2Y69H 3MKLA 4A3LJ 1P4AA 3HOSA 1KU2A 3MN2A 3TP0A 4LLNA 3ZGKA 4W97A 3BCBA 5D6EA 1FEXA 5HDNA 4A3DJ 3E3VA 2TCTA 3V7RA 3HTUA 1IUFA 4UUVA 1B4AA 2OD5A 1J2XA 3IH2A 1RUOA 2STTA 4DGWB 2ZSHB 4A93J 2OZUA 1HKQA 2IA2A 2IEKA 4RGUA 3ERMA 3UNGC 4LB5A 5JHUA 3CZ6A 2ZJPF 3KP7A 1ZG3A 2UUZA 3IV5A 4PSWA 3V4GA 2DFFA 1T6SA 1IXRC 3CDLA 2P5LC 3L2UA 2LDUA 3OIPA 5DUKA 4A5MA 4FISA 2ESHA 4EMSA 2VONA 4IQ4A 4AWXB 5A2QZ 4U7DA 1VQKI 1BW5A 2XIGA 5H6RA 2VQGA 3A02A 2VQLA 4HA8A 3WG7H 1PUFA 4FHTA 2R7SA 2BY0A 2G7HA 2L9RA 2L01A 2ZJRF 2VT3A 2MG4A 4Z6YA 1U3EM 2PMHA 1BR4A 2FBHA 2BBYA 3BR1A 1ZLJA 2UZKA 3IUOA 1R1TA 2LSOA 3FIWA 3K9TA 3QYBA 5E8IA 3UKGA 1MSEC 2LMDA 5FKMA 4BJ6C 1QZEA 1Y39A 1D0ZA 1JHHA 2L2OA 2XRLA 4DOZA 3DEWA 4KIGA 3PQJA 3M8JA 1MBFA 3DQVC 3C2GA 3S1NJ 2KRHA 2L7FP 1UFMA 1B9MA 2JA2A 3BZKA 5E17F 3KZIC 2QUFA 3NRVA 3CJQB 1A31A 1G4DA 2WADA 2MC4A 3EUKL 4P1WA 1FMWA 3D5RC 4NC6A 3G6EI 2A5WA 4PJ0C 1D8KA 5J4YA 1C0WA 1ZN2A 2EV6A 1K6YA 4XK4A 3AG2H 5LEJA 2WAQN 3LAJA 2QKLB 3J7AY 3LFUA 1CF7B 4HLYA 4KT6A 2DMUA 2F5VA 3GFLA 3OR1C 4FTHA 2COMA 2PFBA 2IS1A 2BVMA 4A3GJ 4C30A 3CCSI 2KT0A 2VOPA 3S2WA 2EFPA 3GWZA 1FY7A 4LK0F 4XLHA 5M5XJ 5KHDA 2IRFG 2HVQA 3KLOA 4XOPA 3VYSB 3V7SA 1PP7U 1QRYA 2M4GA 3K1PA 2BY2A 1BI3A 1KYWA 1U8RA 1I3QJ 3LQRA 2Q2EB 5LEKA 3A0BC 1XGNA 2JPBA 3D5SC 4OIOF 1ZELA 2HYGD 2LR8A 3H92A 4LGWA 4X1EA 2XVCA 3IWZA 1YJNI 4EVIA 1R1UA 3LFKA 1HDDC 2XF5A 2B63J 1IO2A 4U87A 5D6FA 3JRDA 1JHFA 3TP3A 1H9GA 1FBSA 1MBGA 3KYCB 3CF2A 3ERED 2VI6A 3QOPA 5CVUA 4B44A 2H27A 1LJ9A 3BG9A 1LPQA 3HRMA 3OYMA 5H2FC 5LHHA 3BCAA 3G73A 3C7JA 3KE2A 1HKSA 2HWVA 3BG7A 4ZTFA 1KU3A 5L3FA 1RR7A 2H94A 1G6NA 3VDXA 5JVGF 2H09A 3L7WA 2LBFA 2O5RA 3BROA 5C4XJ 2NXNB 1K79A 4AIDA 3M8EA 1D5VA 1V3FA 3ZQCA 5F0FA 1FMVA 2DLLA 4P5OA 3JRGA 2OQGA 2K85A 1LEBA 4IHSA 4M71A 2CWEA 2K9QA 4N4OB 1LFPA 5DD4A 1QVTA 1D1AA 4KIFA 3H36A 2E34A 3VSLA 2DFEA 3OS2A 3Q0UA 2EIMH 4BHPA 1BM9A 3AG4H 1OQYA 4UUSB 3L2VA 1Z67A 4EGZA 4PJMA 3S15J 2AQEA 4E70A 3VYTB 3FXQA 2B9SA 1P4WA 1JKQC 2Q8KA 4PGGA 4F7ZA 4AIKA 4ENJA 4OINF 2M0CA 5DUIA 2BEOA 1Z7LA 2JJ7A 4YG2F 2LF8A 3GTLJ 2ZXWH 3KPHA 3Q3SA 4A3JJ 2VE8A 4M3FA 4CCJA 3PNVA 3T8TA 1ZK8A 4A0ZA 2HS5A 1TT5B 1W7PA 2DMTA 1MBKA 1SFUA 2R7OA 3BOQA 2JUGA 4JQFA 1XMKA 1OCCH 5CVIA 1W36C 3WU1B 1X3WB 3U1KA 2CRGA 1GVJA 2MH2A 3J7YJ 1TP4A 2HNHA 2X6YA 5HDKA 3A03A 3OYNA 1WJFA 2MD0A 1EA3A 1XD7A 3HRTA 2FE3A 5BPIA 4B3AA 2AXTC 1A04A 2M34A 3L00A 2ZXHA 2ISYA 1Z1DA 2E19A 3CCLI 1N78A 2Z9OA 5FFXA 1FYMA 3F3XA 4YELA 2PJPA 3DBHB 2QSHX 2KISA 1TBXA 4M3BA 4IVNA 5J3LA 1AKHA 3HOXJ 4LIVA 1DQUA 1SMTA 2DODA 4I7HA 1W36D 3RKWA 4ZDPA 2E5NA 3QPSA 4RDUA 3BG5A 5ILVA 1LB2A 3CD6I 4U0YA 2HI3A 3MQ0A 3SFIA 2ME0A 1FC3A 2Z33A 1I5ZA 5DCMB 4KMUX 5EZGA 2K5CA 4DYRA 3OIOA 2Z3YA 1T95A 5E20A 1EH6A 2TDXA 1J75A 4M9ZA 2FOWA 3JAMK 2R5ZB 3R60A 4C9YA 3BR0A 4RAZA 3AFHA 2LRDA 1R4NB 2AO9A 4IHVA 3GFJA 3DLLF 4BACA 3IL2A 3V8JA 5HS8A 3TBIA 2CUFA 3VOEA 3S2DJ 2E1MC 1VFCA 2H8WA 5CQEA 4PFPA 1I27A 2M5WA 2KIFA 5HODA 2HTJA 4HSTA 1VQ9I 4G12A 2W82A 4RGXA 2HVSA 2V1UA 4QSHA 2LG4A 5GTIC 5HVQC 1QZYA 3Q9SA 2NOGA 2BY3A 1HBXG 1U5TA 2E1MB 4UB6C 2F5DA 1MIJA 1QHGA 1IN8A 2L54A 4L5JA 1MH4A 2CG4A 2LY2A 5DEQA 1Y1WJ 2WBMA 3GUDA 1EV7A 2F2EA 4P55A 5F0HA 2QBYB 1FOWA 2GBYA 2RAEA 3LSRA 1YO5C 4XORA 1E3HA 1STZA 2LH9A 5B5EC 3SJMA 1OCPA 2XPVA 2ID6A 4L0YB 3PFIA 5GAGJ 5L3EA 2MW8A 4HX8A 1RESA 5EJCA 5JLWA 3CCJI 1G3WA 1B6AA 2J5PA 2EIKH 2K86A 2HPIA 5LD2C 2DMPA 1FIAA 4A12A 2HDWA 1UZCA 4ESBA 3BY6A 2BHZA 2GOMA 2DCEA 4BH9A 3VEPA 2GM4A 4NQWB 1QA6A 4A3EJ 2FSWA 4GRIA 1JE8A 2X85A 2QGUA 1J5YA 4JOMA 2Y31A 3O8HA 2DTZA 3QODA 3VPRA 3ZRGA 1SANA 2CU7A 4YFNF 2UXXA 4XBFA 2F4IA 2O7OA 3SZPA 2EZHA 2VPRA 4BHCA 4Q5SF 3LMMA 5M3MJ 4XRSG 1F36A 2K27A 1MZBA 3OIQA 3HIFA 3F21A 2JZYA 2DT5A 2FNPA 4X6AJ 1I1GA 2DA7A 2F6CA 1BR1A 3P9KA 1UELB 2M87A 5LFAA 3HUGA 5J1YA 2RKHA 2DPUA 3PUFA 4ZTJA 3H5NA 1IN7A 2R7WA 1T98A 6PAXA 1R5GA 4LMYA 1WJCA 5ICCA 1HXDA 1XX5A 1SFKA 1LFUP 3F9KA 1T08B 3DV8A 2WB1A 2Z16A 1YS7A 3S3OA 2EQRA 1ZRFA 1FSEA 4I6ZA 3H0DA 4P96A 4EM1A 1KQ8A 3AAFA 1Y0UA 1DP3A 5E1WA 1NHAA 4F92B 3JRCA 3ZQIA 2I8DA 2V1XA 5CKTA 4RMNA 2R5YB 2Z5UA 3IAS2 3N4MA 4A3CJ 1Z0XA 3K4NA 1FP2A 3BG6A 4CYCA 3SHFA 5HLGA 5ED4A 4LLGF 3I4NJ 2DFHA 3KP5A 2XAJA 5JLXA 1TC3C 4EV0A 4WK8F 2IA0A 1TW2A 1A5JA 3QAHA 2JN6A 1ZHFA 4L5IA 2E2IJ 3EUHA 2DYRH 2HKOA 2Y9YA 3I64A 4IRIA 4Q4ZF 2D1HA 5J1RA 3K69A 4IOAF 2DT6A 3H3ZA 4DJAA 4MTDA 1WH7A 4LG3A 3FHNA 1Z3YA 3AG1H 3F72A 2O6GE 2OCCH 2E1CA 4G6DA 4OMYA 1B8IA 1GHCA 1X1PA 2PN6A 4AIHA 5F27A 4B3XA 3I55I 1BW6A 1XMAA 2E36A 2M8EA 3LAPA 2M7BA 2HOSA 1O3SA 2P5KA 2J5OA 1VTNC 5H6QA 4BE0A 2QZ8A 2ZB9A 3F8MA 4E6KG 1VQLI 2X0LA 2QYOA 2V1NA 2RN7A 1XN7A 3EDPA 1R1VA 1LDJA 3QU6A 2OU2A 4E7SA 5HLTA 4G8XA 5J8CA 3I4MJ 3CUQC 2VJ4A 1EH7A 3IC7A 4NUBA 4Y52J 2NVTJ 3FMRA 1J7KA 4FX0A 4P9FA 2Z99A 4MFDA 3RKXA 2JT1A 3RPUD 2IS4A 3VODA 2B0LA 1D8JA 1FZPB 3HDDA 5D5VB 3NWSA 1YYVA 4YFKF 3CUOA 2KRCA 1HSTA 1IC8A 3LSKA 4RB0A 3K10A 3FXOA 4CUGA 3CCRI 1FTTA 3LA3A 4U0WA 1AOYA 5FFZA 3GTMJ 3BG3A 5C44J 1UAAA 2FBKA 3L2QA 3BLYA 1U78A 2M9HA 3FXLA 1ENHA 1HKTA 3BR2A 1WI3A 5F04A 1Q1HA 1IG7A 2EA4A 1LQ1A 3RYPA 2JK3A 3B02A 1HC8A
chains in the Genus database with same CATH topology
3R0JA 1IAWA 2K4BA 1I6XA 3FF5A 3E5QA 4P9UA 3Q9VA 4I2OA 4CDGA 1S7AA 3QP5A 3REOA 4RGSA 2A6EF 1FWZA 3BZ6A 5DCFA 2BV6A 4KMFA 4KIBA 4HV6A 3QPTA 1O3QA 2YPRA 2ZJ2A 4G7ZF 1BOAA 1YG2A 2NYXA 3TDUC 4PZJA 5JFRA 3BPVA 2GWRA 1XGOA 2OZ6A 4M9XA 4UV8A 2EFNA 3H3UA 3LSTA 3GXOA 2DPDA 2BGCA 1CGPA 4RB3C 3KP6A 4WF2A 2UXNA 3TOBA 4LJZF 1R36A 2ZCWA 3P9CA 3I5UA 4OOIA 4HZFA 5LRRA 4G6QA 4KYWA 3WTTC 3WTSC 1S6LA 2F5EA 3I0TA 4MEXF 4M9SA 1TQPA 4K2EA 1DUXC 1J0RA 2WC2A 2W25A 3CJNA 2Q2EA 1Z6RA 1ZGJA 2FF4A 2RV8A 2YX4A 3KZYA 5DDGA 2XAGA 3K1MA 5IT9Z 3ABUA 3BWGA 5K5OA 1BC8C 2VBWA 4M72A 3FX3A 5BS6A 3WTUC 4WXHA 5L3DA 4I01A 3O6BB 3IWFA 4LB6B 2FMYA 1B1BA 4ESFA 4UNOA 2ZBKA 3LA7A 2W84A 4KFCA 2MBFA 1XSXA 3P7NA 1K78B 3D0SA 3KP2A 1ODDA 1YW8A 2CW0F 2FBIA 5LGNA 2PEXA 5AONA 2FMLA 4BHBA 4JBAA 3HRSA 1FPQA 2A61A 3JW4A 5D4SA 1SD6A 4O3MA 2ACJA 2IA1A 4ENMA 2L02A 2FNAA 2EA2A 3WTVC 1KYZA 3WE3A 4WWCA 4KDPA 2EV0A 5E1XA 5HLIA 3KEQA 5L3GA 1BI2A 3DP7A 5ERIA 4CICA 2A5YB 3SXYA 4S05A 5D4RA 1HQCA 2K02A 4L9NA 1OR7A 1KU9A 5E18F 4ZYGA 1R7JA 1T39A 1LNWA 1V4RA 2HDCA 5DCMA 1H0MA 2WTEA 1QPMA 1SD7A 3KZZA 2ZMEA 2DO7A 1XDUA 2NNNA 3BPXA 3WTXC 2QLZA 2DQRA 2R7FA 3ABTA 4TV7A 1Z7UA 3E97A 1ZH5A 2P8TA 3L09A 5K1YA 1X3UA 1OYYA 2FXAA 5ICGA 2K7LA 4GGGA 1XCBA 2L4MA 3GZ6A 1O7LA 2O03A 2QBYA 1BI1A 3I4PA 5A2QK 4LG0B 1P4XA 5BOXA 1OYIA 3GEZA 4M74A 1IXCA 2UWMA 4HDVA 3ZMSA 3BP8A 2P7CB 2FU4A 4NQWA 3J80Z 5ILUA 2DI3A 2E7WA 1BC7C 1ZARA 1YS6A 2IW5A 1RZ4A 2XUBA 1IZ1A 1U6GA 4O6JA 4GYGA 2GQQA 4UVBA 1Z05A 3T0YA 2OAZA 1YW7A 3K0LA 3EYYA 4M73A 2JTVA 5D5WB 1HW5A 2RGVA 4JK1X 2XHKA 3RPQA 4KA4A 3DKWA 3F22A 1L3LA 2CFXA 4LLLA 1IRFA 2HQNA 2V6CA 4FX4A 4U0VA 1O3TA 3KFWX 1E2XA 3U9GA 3CTAA 1TNTA 3FHZA 3TO9A 2HOEA 4UHTA 3NQOA 1UHWA 4D0PA 1W4MA 1XGSA 2MC3A 3F6VA 4MQ9F 5F6FA 3O3KA 2H6CA 5LGTA 4HX7A 2O3FA 4ZH4F 5KVRA 1FOKA 2M1BA 2MA3A 1DPRA 3CLOA 3ZMTA 1ZG5A 4I98B 1ON1A 1QO0D 3FM3A 2O61A 1P2FA 3MAJA 1SFEA 4HV5A 3RPUA 3J80K 1FP1D 1DPUA 4G7HF 2O0YA 2EWNA 3HSEA 4MNUA 1T38A 4B8XA 2EJRA 1MKMA 3V8LA 2JRTA 4BQAA 2CYYA 3RYRA 1RUNA 4WCGA 4UXNA 4OIRF 4L0ZB 1ZAOA 2RDPA 4RB1A 3ZN0A 3BJAA 2A68F 2E7XA 3M7GA 4G7OF 3E6CC 5LBQA 3GVAA 3CO7C 3WE2A 2KJCA 4A6DA 1KU7A 1RI7A 2DK8A 1MGTA 3IKTA 3R0AA 1YLFA 1LDKB 2P7VB 1XB4A 2MD5A 1BIBA 1PUEE 2M30A 1MDMB 4XSZF 2VBYA 1G3SA 1IN4A 1OMIA 3MCZA 2DTRA 2OA4A 3RTRA 1PDNC 1FNNA 2KIUA 5K5QA 2ETHA 2VC1A 2GZWA 1IF1A 2VC0A 4R1HA 4IXAA 3VFZA 3MZYA 3ML6A 1HW1A 1F5TA 1BJAA 2KKOA 4N0BA 3GFMA 4UVCA 2M45A 4EJTA 2D45A 5L3BA 3GYHX 2A69F 4KN7X 3ROUA 5CVRA 5HDGA 1SFXA 4I09A 1QZZA 5HS9A 3TOAA 2WWYA 3I53A 1U2WA 5FD5A 3TQNA 2FEZA 4AD9A 4U7BA 1K78A 3HHGA 1MJAA 3TKYA 2QQAA 4AIJA 2CQKA 4Y15A 4QLCU 2QWWA 3K1NA 2YX7A 1OPCA 5CLSA 1IXSB 1YTYA 1BI0A 5JR3A 1WKMA 3WODF 2XV4S 1TTYA 3CUQB 3F6OA 4PGHA 2GAUA 5IT3A 1JXSA 1LVAA 1Z9CA 1MJ9A 1EH8A 5BPDA 2ADUA 1B9NA 4XLNF 4BAYA 5FLXZ 3LQQA 2VOOA 4ZYHA 2C6YA 3C18A 5J6XA 4EGYA 3IRRA 4HF0A 3LA2A 5E8GA 1J59A 1ON2A 4A0YA 4MEYF 2CGPA 4OIPF 3BDDA 2F5CA 1B59A 2H6BA 3K2ZA 1DP7P 4XLPF 1ZG1A 3EQLF 1QNTA 2FRHA 3MEXA 4L18B 5LHIA 1YQAA 4PDKA 4CHUA 4DQ2A 1T2KA 1R58A 2ISZA 2PMUA 1XCVA 4N9IA 4GXOA 3TO6A 3I58A 2V9VA 2PQ8A 2FOKA 1WSUA 3WGGA 5ILSA 3F8FA 3O2PE 2IJLA 2XKOA 5BQTA 1TW3A 1CF7A 5BMZA 4RAYA 3KP3A 1FT9A 5D5UB 1TQIA 2EV5A 1QQIA 1WQ2A 1KQ0A 5AIPA 3G3ZA 3ZMZA 4I0AA 3N97A 1UCRA 5CYVA 5FLXK 4RGRA 1S7OA 1Z91A 4A6EA 2W57A 5ICFA 4LG0A 5LLQA 3KLNA 3IKVA 4IJAA 1ULYA 4GCVA 5K5RA 4S04A 3DF8A 1R00A 4UVAA 3EYIA 2PLYA 3JTHA 3Q5FA 2XROA 4L9JA 3FZVA 1FSHA 4ESJA 2DBBA 4N9HA 2VBXA 3GX4X 2VXZA 4BNCA 4YFXF 1F9NA 2W24A 3CO6C 2P5VA 3SZTA 3ECHA 3JSPA 3KETA 1GXPA 1F1ZA 2EFOA 5TJJA 2NRAC 1IN5A 3F8NA 2ZNYA 1R23A 2V1DA 4XRFA 2EFWA 3IHUA 3I59B 4NB5A 3F8CA 2Y75A 2ZNZA 3QPHA 2ZFWA 1USTA 2WV0A 4HYEA 2YU3A 4CYDA 3SQNA 5LHGA 4YIFA 4RB2C 3FXUA 4WXDA 1L0OC 2XAHA 3I54A 3JTGA 2PBIA 3R4KA 4DNCA 3HTSB 2EK5A 2YSRA 2ZXJA 5IT9K 3RJPA 1QGPA 3RIRA 3RDIA 4LD5A 1ZRDA 2DK5A 4HBLA 1RIOH 1HSJA 4EQQA 4B09A 4GO1A 1OYWA 1WI9A 2CSOA 1IN6A 3E6BA 1FX7A 3PQKA 4ZZLA 2XASA 1BIAA 3HRUA 4GYIA 4RS8A 3ZPLA 3ULQB 3KP4A 1G3TA 3L9FA 4WXCA 2YR2A 3P9IA 2A07F 1K7AA 4OU0A 2IP2A 1P6RA 4HDUA 1YFHA 3HYIA 2OQRA 3ECOA 3WGHA 2D2WA 2G9WA 4ETSA 1SMYF 3MWMA 1MD0A 4EJUA 4IRGA 1DDNA 5LGUA 1FLIA 3WGIA 2MLKA 5FO5A 1IUYA 2GA2A 3D5LA 4L9VA 2R7DA 4CO8A 4UV9A 2RC4A 2ELHA 1XSDA 5LRSA 4EJWA 2A3SA 3C3WA 4G94A 3WU0A 5ICEA 2R3SA 1ZREA 2EB7A 3HSRA 5KK1A 3FMQA 4HW0A 2DW4A 5AIQA 3J81Z 4CZZA 1KA8A 1J9IA 5HS7A 3ISPA 3JSOA 3ZMVA 1MDMA 1USSA 4IRHA 1ZRCA 1GXQA 3JAMZ 4WX9A 1TNSA 2IPQX 5FD6A 3NEUA 4ASNA 4EM2A 2AS5F 2Y0MA 4BYYA 5DYMA 2RNJA 4IHTA 3ZQ7A 1QBJA 3MFKA 4CXFA 5CJ9A 3W6JB 2PI0A 4ENKA 3DPLC 1S29A 2BYVE 3KCCA 4MQVA 1YW9A 2MLGA 1TLHB 3EETA 4KICA 4ENNA 2FA5A 2ESNA 1LEAA 4Y13A 1WWXA 4ON0A 3HHHA 2KJBA 4Z2YA 3TO7A 3GLXA 5DV5A 4M6YA 3LWFA 4HOBA 5EEGA 3DXJF 3WTYC 2GIVA 1W5SA 4NHJA 2W85A 1E17A 2QENA 3BJ6A 3J81K 1IW7F 5D5XB 4KUMA 1MJBA 2MH9A 3GZ5A 2G7UA 1KGSA 3CUQA 4PCQA 1TQMA 3FM5A 2GXBA 2ZMEB 4FT8A 2DFIA 1YIOA 2IVMA 3T8RA 4R8HA 2HYFA 2XRNA 2X4HA 2XGXA 5F64A 4I02A 3T5XA 3ZMUA 4HLXA 3KEOA 1XSVA 3TGNA 1P92A 2JSCA 2DQLA 2AXLA 1F4KA 4KNYA 3VB2A 4MGRA 4LFUA 4ZYDA 3FWEA 3W6KB 3COAC 3TDZC 5HLHA 1D3YA 1O7FA 4HF2A 3HSFA 1FBQA 3E6DA 2A6HF 2HFHA 2KRFA 3GW2A 2DAOA 1UB9A 2GA1A 2JPCA 4H0EA 1KQ9A 3GFIA 3M1EA 4Y17A 2O8XA 4U88A 2HEOA 3QP6A 2HGCA 2IT0A 3QU3A 4IF4A 1IRGA 1SD5A 2P6TA 5D8KB 1SD4A 2HTSA 4IPAA 1ZYRF 3WG9A 2LF7A 3CDHA 3V7CA 1BN5A 4O5VA 3BJOA 2F5FA 1ONVA 4G9YA 5TRDA 4HAMA 5EEHA 1AWCA 4HF1A 2DU9A 2QQ9A 4A0XA 2PG4A 4BXUA 5JVTA 2NNYA 3F8BA 1W7PB 2QQBA 4LK1F 2VE9A 2NAZA 2VBZA 3SFZA 3RI4A 2XAQA 3T1BA 1K6OA 3DEUA 4CGZA 2Q0OA 3M9AA 4ZYEA 2OBPA 2VODA 1T0FA 2HKXA 1W5TA 4R79A 4Q48A 2LNBA 4ZZDA 1W7PD 2QVOA 4HX4A 3E6MA 2Y48A 2HQRA 1I1SA 3L2CA 1XDSA 2CO5A 1SAXA 2ZO4A 3FXRA 3QRFF 1WRJA 3E5UA 2RQPA 4M6XA 1BBYA 3ZMDA 3GF2A 3FMSA 5D8LB 2NS0A 4A2UA 3U2RA 2GXGA 1ZLKA 2L3DA 1G3YA 3R6SA 4L9TA 4MHGA 3I59A 1U5TC 1PP8F 5L3CA 2K4JA 2ZKZA 3ELKA 3M8FA 4HQEA 1R5HA 1U5TB 4KT5C 2XKPA 1ZGAA 3WTWC 1RNLA 4EM0B 3IRQA 2L4AA 2QM3A 4AVPA 4EJOA 3HOTA 1XGMA 2KIMA 3DPTA 5JI6A 2P4WA 3U1DA 3B73A 4YIIA 2VN2A 3MZHA 4XSXF 4MTEA 1FYLA 2LKPA 5FB2A 1UHMA 3I71A 2E1NA 2BE5F 5HOOA 5E1ZB 3J7AO 2HR3A 1OKRA 3GO5A 2FQ3A 4HQMA 5H20A 2VT2A 2HZTA 1H9TA 4EJVA 1FYKA 3E5XA 4KN4X 3OOPA 2V79A 2RVCA 3R61A 4QWQA 1O57A 2D1VA 5DD8A 5CVVA 3V8KA 1S8NA 5FGMA 1JGSA 5F1RA 3RKYA 3C1DA 1O3RA 2P6SA 3ZP5A 4OMZA 3F23A 2STWA 1R22A 1HW2A 3ZN1A 4Q47A 1S3JA 5CVJA 3OV8A 4I0BA 2EFQA 4OIQF 3WTZA 1LDDA 4A5NA 3DFGA 1REPC 1Z6TA 5J8FA 1FBUA 2XAFA 1P4AA 3HOSA 1KU2A 4LLNA 5D6EA 5HDNA 3E3VA 3V7RA 3HTUA 4UUVA 1B4AA 2OD5A 1J2XA 1RUOA 2STTA 2OZUA 1HKQA 2IA2A 4RGUA 4LB5A 5JHUA 3KP7A 1ZG3A 3V4GA 1T6SA 1IXRC 2P5LC 2LDUA 5DUKA 4A5MA 4EMSA 2ESHA 2VONA 4AWXB 5A2QZ 4U7DA 2XIGA 5H6RA 4HA8A 4FHTA 2G7HA 2L01A 2VT3A 1U3EM 2PMHA 2FBHA 2BBYA 1ZLJA 2UZKA 1R1TA 2LSOA 3K9TA 5E8IA 1JHHA 4KIGA 3PQJA 3DQVC 1UFMA 1B9MA 5E17F 2QUFA 3NRVA 1G4DA 1D8KA 1C0WA 1ZN2A 2EV6A 5LEJA 3LAJA 1CF7B 4HLYA 3GFLA 2COMA 2PFBA 2VOPA 3S2WA 2EFPA 3GWZA 1FY7A 4LK0F 2IRFG 3KLOA 3V7SA 1PP7U 3K1PA 1BI3A 1KYWA 1U8RA 3LQRA 5LEKA 1XGNA 2JPBA 4OIOF 2HYGD 3H92A 4LGWA 2XVCA 3IWZA 4EVIA 1R1UA 3LFKA 5D6FA 1JHFA 1H9GA 1FBSA 3ERED 3QOPA 5CVUA 2H27A 1LJ9A 3HRMA 5LHHA 3G73A 3C7JA 3KE2A 1HKSA 2HWVA 1KU3A 5L3FA 2H94A 1G6NA 2H09A 3L7WA 3BROA 1K79A 3M8EA 1D5VA 1V3FA 2DLLA 4P5OA 2OQGA 1LEBA 4IHSA 4M71A 2CWEA 5DD4A 4KIFA 4BHPA 1BM9A 4EGZA 4E70A 3FXQA 1P4WA 2Q8KA 4PGGA 4F7ZA 4AIKA 4ENJA 4OINF 5DUIA 2BEOA 4YG2F 2LF8A 2VE8A 3T8TA 4A0ZA 2HS5A 1W7PA 1SFUA 3BOQA 4JQFA 1XMKA 5CVIA 3WU1B 1GVJA 2MH2A 5HDKA 1XD7A 3HRTA 2FE3A 5BPIA 1A04A 3L00A 2ISYA 1Z1DA 2Z9OA 5FFXA 1FYMA 3F3XA 2PJPA 1TBXA 4IVNA 1SMTA 4I7HA 3RKWA 1LB2A 5ILVA 4U0YA 3MQ0A 1FC3A 2Z33A 1I5ZA 5DCMB 4KMUX 2Z3YA 5E20A 1EH6A 2TDXA 1J75A 4M9ZA 3JAMK 3R60A 4RAZA 3GFJA 3IL2A 3V8JA 5HS8A 3VOEA 1I27A 2M5WA 2KIFA 2HTJA 4RGXA 2V1UA 5HVQC 1QZYA 3Q9SA 1HBXG 1U5TA 2F5DA 1IN8A 2L54A 4L5JA 2CG4A 5DEQA 2QBYB 3GUDA 1EV7A 2F2EA 4P55A 1YO5C 1STZA 4L0YB 3PFIA 5L3EA 4HX8A 1G3WA 1B6AA 2J5PA 2K86A 4A12A 4ESBA 3BY6A 4BH9A 3VEPA 2FSWA 1JE8A 1J5YA 4YFNF 2UXXA 4XBFA 3SZPA 4BHCA 4Q5SF 2K27A 1MZBA 3HIFA 3F21A 2JZYA 2DT5A 2FNPA 1I1GA 3P9KA 2M87A 3HUGA 2RKHA 2DPUA 1IN7A 6PAXA 1T98A 1R5GA 4LMYA 5ICCA 1HXDA 3DV8A 1YS7A 1ZRFA 1FSEA 4P96A 4EM1A 1KQ8A 3AAFA 1Y0UA 5E1WA 1NHAA 2V1XA 2Z5UA 3N4MA 1FP2A 3SHFA 5HLGA 5ED4A 4LLGF 3KP5A 2XAJA 4EV0A 4WK8F 2IA0A 1TW2A 3QAHA 4L5IA 1ZHFA 3EUHA 3I64A 2HKOA 4IRIA 4Q4ZF 2D1HA 3K69A 4MTDA 3H3ZA 3F72A 2O6GE 2E1CA 4G6DA 4OMYA 1GHCA 2PN6A 4AIHA 1XMAA 2M8EA 3LAPA 1O3SA 2P5KA 2J5OA 1VTNC 5H6QA 2QZ8A 3F8MA 2X0LA 2QYOA 2RN7A 1XN7A 3EDPA 1R1VA 1LDJA 3QU6A 2OU2A 4G8XA 5J8CA 3CUQC 3IC7A 1EH7A 3FMRA 1J7KA 4FX0A 4P9FA 2Z99A 3RKXA 2JT1A 3VODA 2B0LA 1D8JA 1FZPB 5D5VB 1YYVA 4YFKF 3CUOA 1HSTA 4RB0A 3LA3A 4U0WA 1AOYA 5FFZA 2FBKA 1U78A 1HKTA 1Q1HA 2EA4A 1LQ1A 3RYPA 3B02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R0J A;  1IAW A;  2K4B A;  1I6X A;  3FF5 A;  3E5Q A;  4P9U A;  3Q9V A;  4I2O A;  4CDG A;  1S7A A;  3QP5 A;  3REO A;  4RGS A;  2A6E F;  1FWZ A;  3BZ6 A;  5DCF A;  2BV6 A;  4KMF A;  4KIB A;  4HV6 A;  3QPT A;  1O3Q A;  2YPR A;  2ZJ2 A;  4G7Z F;  1BOA A;  1YG2 A;  2NYX A;  3TDU C;  4PZJ A;  5JFR A;  3BPV A;  2GWR A;  1XGO A;  2OZ6 A;  4M9X A;  4UV8 A;  2EFN A;  3H3U A;  3LST A;  3GXO A;  2DPD A;  2BGC A;  1CGP A;  4RB3 C;  3KP6 A;  4WF2 A;  2UXN A;  3TOB A;  4LJZ F;  1R36 A;  2ZCW A;  3P9C A;  3I5U A;  4OOI A;  4HZF A;  5LRR A;  4G6Q A;  4KYW A;  3WTT C;  3WTS C;  1S6L A;  2F5E A;  3I0T A;  4MEX F;  4M9S A;  1TQP A;  4K2E A;  1DUX C;  1J0R A;  2WC2 A;  2W25 A;  3CJN A;  2Q2E A;  1Z6R A;  1ZGJ A;  2FF4 A;  2RV8 A;  2YX4 A;  3KZY A;  5DDG A;  2XAG A;  3K1M A;  5IT9 Z;  3ABU A;  3BWG A;  5K5O A;  1BC8 C;  2VBW A;  4M72 A;  3FX3 A;  5BS6 A;  3WTU C;  4WXH A;  5L3D A;  4I01 A;  3O6B B;  3IWF A;  4LB6 B;  2FMY A;  1B1B A;  4ESF A;  4UNO A;  2ZBK A;  3LA7 A;  2W84 A;  4KFC A;  2MBF A;  1XSX A;  3P7N A;  1K78 B;  3D0S A;  3KP2 A;  1ODD A;  1YW8 A;  2CW0 F;  2FBI A;  5LGN A;  2PEX A;  5AON A;  2FML A;  4BHB A;  4JBA A;  3HRS A;  1FPQ A;  2A61 A;  3JW4 A;  5D4S A;  1SD6 A;  4O3M A;  2ACJ A;  2IA1 A;  4ENM A;  2L02 A;  2FNA A;  2EA2 A;  3WTV C;  1KYZ A;  3WE3 A;  4WWC A;  4KDP A;  2EV0 A;  5E1X A;  5HLI A;  3KEQ A;  5L3G A;  1BI2 A;  3DP7 A;  5ERI A;  4CIC A;  2A5Y B;  3SXY A;  4S05 A;  5D4R A;  1HQC A;  2K02 A;  4L9N A;  1OR7 A;  1KU9 A;  5E18 F;  4ZYG A;  1R7J A;  1T39 A;  1LNW A;  1V4R A;  2HDC A;  5DCM A;  1H0M A;  2WTE A;  1QPM A;  1SD7 A;  3KZZ A;  2ZME A;  2DO7 A;  1XDU A;  2NNN A;  3BPX A;  3WTX C;  2QLZ A;  2DQR A;  2R7F A;  3ABT A;  4TV7 A;  1Z7U A;  3E97 A;  1ZH5 A;  2P8T A;  3L09 A;  5K1Y A;  1X3U A;  1OYY A;  2FXA A;  5ICG A;  2K7L A;  4GGG A;  1XCB A;  2L4M A;  3GZ6 A;  1O7L A;  2O03 A;  2QBY A;  1BI1 A;  3I4P A;  5A2Q K;  4LG0 B;  1P4X A;  5BOX A;  1OYI A;  3GEZ A;  4M74 A;  1IXC A;  2UWM A;  4HDV A;  3ZMS A;  3BP8 A;  2P7C B;  2FU4 A;  4NQW A;  3J80 Z;  5ILU A;  2DI3 A;  2E7W A;  1BC7 C;  1ZAR A;  1YS6 A;  2IW5 A;  1RZ4 A;  2XUB A;  1IZ1 A;  1U6G A;  4O6J A;  4GYG A;  2GQQ A;  4UVB A;  1Z05 A;  3T0Y A;  2OAZ A;  1YW7 A;  3K0L A;  3EYY A;  4M73 A;  2JTV A;  5D5W B;  1HW5 A;  2RGV A;  4JK1 X;  2XHK A;  3RPQ A;  4KA4 A;  3DKW A;  3F22 A;  1L3L A;  2CFX A;  4LLL A;  1IRF A;  2HQN A;  2V6C A;  4FX4 A;  4U0V A;  1O3T A;  3KFW X;  1E2X A;  3U9G A;  3CTA A;  1TNT A;  3FHZ A;  3TO9 A;  2HOE A;  4UHT A;  3NQO A;  1UHW A;  4D0P A;  1W4M A;  1XGS A;  2MC3 A;  3F6V A;  4MQ9 F;  5F6F A;  3O3K A;  2H6C A;  5LGT A;  4HX7 A;  2O3F A;  4ZH4 F;  5KVR A;  1FOK A;  2M1B A;  2MA3 A;  1DPR A;  3CLO A;  3ZMT A;  1ZG5 A;  4I98 B;  1ON1 A;  1QO0 D;  3FM3 A;  2O61 A;  1P2F A;  3MAJ A;  1SFE A;  4HV5 A;  3RPU A;  3J80 K;  1FP1 D;  1DPU A;  4G7H F;  2O0Y A;  2EWN A;  3HSE A;  4MNU A;  1T38 A;  4B8X A;  2EJR A;  1MKM A;  3V8L A;  2JRT A;  4BQA A;  2CYY A;  3RYR A;  1RUN A;  4WCG A;  4UXN A;  4OIR F;  4L0Z B;  1ZAO A;  2RDP A;  4RB1 A;  3ZN0 A;  3BJA A;  2A68 F;  2E7X A;  3M7G A;  4G7O F;  3E6C C;  5LBQ A;  3GVA A;  3CO7 C;  3WE2 A;  2KJC A;  4A6D A;  1KU7 A;  1RI7 A;  2DK8 A;  1MGT A;  3IKT A;  3R0A A;  1YLF A;  1LDK B;  2P7V B;  1XB4 A;  2MD5 A;  1BIB A;  1PUE E;  2M30 A;  1MDM B;  4XSZ F;  2VBY A;  1G3S A;  1IN4 A;  1OMI A;  3MCZ A;  2DTR A;  2OA4 A;  3RTR A;  1PDN C;  1FNN A;  2KIU A;  5K5Q A;  2ETH A;  2VC1 A;  2GZW A;  1IF1 A;  2VC0 A;  4R1H A;  4IXA A;  3VFZ A;  3MZY A;  3ML6 A;  1HW1 A;  1F5T A;  1BJA A;  2KKO A;  4N0B A;  3GFM A;  4UVC A;  2M45 A;  4EJT A;  2D45 A;  5L3B A;  3GYH X;  2A69 F;  4KN7 X;  3ROU A;  5CVR A;  5HDG A;  1SFX A;  4I09 A;  1QZZ A;  5HS9 A;  3TOA A;  2WWY A;  3I53 A;  1U2W A;  5FD5 A;  3TQN A;  2FEZ A;  4AD9 A;  4U7B A;  1K78 A;  3HHG A;  1MJA A;  3TKY A;  2QQA A;  4AIJ A;  2CQK A;  4Y15 A;  4QLC U;  2QWW A;  3K1N A;  2YX7 A;  1OPC A;  5CLS A;  1IXS B;  1YTY A;  1BI0 A;  5JR3 A;  1WKM A;  3WOD F;  2XV4 S;  1TTY A;  3CUQ B;  3F6O A;  4PGH A;  2GAU A;  5IT3 A;  1JXS A;  1LVA A;  1Z9C A;  1MJ9 A;  1EH8 A;  5BPD A;  2ADU A;  1B9N A;  4XLN F;  4BAY A;  5FLX Z;  3LQQ A;  2VOO A;  4ZYH A;  2C6Y A;  3C18 A;  5J6X A;  4EGY A;  3IRR A;  4HF0 A;  3LA2 A;  5E8G A;  1J59 A;  1ON2 A;  4A0Y A;  4MEY F;  2CGP A;  4OIP F;  3BDD A;  2F5C A;  1B59 A;  2H6B A;  3K2Z A;  1DP7 P;  4XLP F;  1ZG1 A;  3EQL F;  1QNT A;  2FRH A;  3MEX A;  4L18 B;  5LHI A;  1YQA A;  4PDK A;  4CHU A;  4DQ2 A;  1T2K A;  1R58 A;  2ISZ A;  2PMU A;  1XCV A;  4N9I A;  4GXO A;  3TO6 A;  3I58 A;  2V9V A;  2PQ8 A;  2FOK A;  1WSU A;  3WGG A;  5ILS A;  3F8F A;  3O2P E;  2IJL A;  2XKO A;  5BQT A;  1TW3 A;  1CF7 A;  5BMZ A;  4RAY A;  3KP3 A;  1FT9 A;  5D5U B;  1TQI A;  2EV5 A;  1QQI A;  1WQ2 A;  1KQ0 A;  5AIP A;  3G3Z A;  3ZMZ A;  4I0A A;  3N97 A;  1UCR A;  5CYV A;  5FLX K;  4RGR A;  1S7O A;  1Z91 A;  4A6E A;  2W57 A;  5ICF A;  4LG0 A;  5LLQ A;  3KLN A;  3IKV A;  4IJA A;  1ULY A;  4GCV A;  5K5R A;  4S04 A;  3DF8 A;  1R00 A;  4UVA A;  3EYI A;  2PLY A;  3JTH A;  3Q5F A;  2XRO A;  4L9J A;  3FZV A;  1FSH A;  4ESJ A;  2DBB A;  4N9H A;  2VBX A;  3GX4 X;  2VXZ A;  4BNC A;  4YFX F;  1F9N A;  2W24 A;  3CO6 C;  2P5V A;  3SZT A;  3ECH A;  3JSP A;  3KET A;  1GXP A;  1F1Z A;  2EFO A;  5TJJ A;  2NRA C;  1IN5 A;  3F8N A;  2ZNY A;  1R23 A;  2V1D A;  4XRF A;  2EFW A;  3IHU A;  3I59 B;  4NB5 A;  3F8C A;  2Y75 A;  2ZNZ A;  3QPH A;  2ZFW A;  1UST A;  2WV0 A;  4HYE A;  2YU3 A;  4CYD A;  3SQN A;  5LHG A;  4YIF A;  4RB2 C;  3FXU A;  4WXD A;  1L0O C;  2XAH A;  3I54 A;  3JTG A;  2PBI A;  3R4K A;  4DNC A;  3HTS B;  2EK5 A;  2YSR A;  2ZXJ A;  5IT9 K;  3RJP A;  1QGP A;  3RIR A;  3RDI A;  4LD5 A;  1ZRD A;  2DK5 A;  4HBL A;  1RIO H;  1HSJ A;  4EQQ A;  4B09 A;  4GO1 A;  1OYW A;  1WI9 A;  2CSO A;  1IN6 A;  3E6B A;  1FX7 A;  3PQK A;  4ZZL A;  2XAS A;  1BIA A;  3HRU A;  4GYI A;  4RS8 A;  3ZPL A;  3ULQ B;  3KP4 A;  1G3T A;  3L9F A;  4WXC A;  2YR2 A;  3P9I A;  2A07 F;  1K7A A;  4OU0 A;  2IP2 A;  1P6R A;  4HDU A;  1YFH A;  3HYI A;  2OQR A;  3ECO A;  3WGH A;  2D2W A;  2G9W A;  4ETS A;  1SMY F;  3MWM A;  1MD0 A;  4EJU A;  4IRG A;  1DDN A;  5LGU A;  1FLI A;  3WGI A;  2MLK A;  5FO5 A;  1IUY A;  2GA2 A;  3D5L A;  4L9V A;  2R7D A;  4CO8 A;  4UV9 A;  2RC4 A;  2ELH A;  1XSD A;  5LRS A;  4EJW A;  2A3S A;  3C3W A;  4G94 A;  3WU0 A;  5ICE A;  2R3S A;  1ZRE A;  2EB7 A;  3HSR A;  5KK1 A;  3FMQ A;  4HW0 A;  2DW4 A;  5AIQ A;  3J81 Z;  4CZZ A;  1KA8 A;  1J9I A;  5HS7 A;  3ISP A;  3JSO A;  3ZMV A;  1MDM A;  1USS A;  4IRH A;  1ZRC A;  1GXQ A;  3JAM Z;  4WX9 A;  1TNS A;  2IPQ X;  5FD6 A;  3NEU A;  4ASN A;  4EM2 A;  2AS5 F;  2Y0M A;  4BYY A;  5DYM A;  2RNJ A;  4IHT A;  3ZQ7 A;  1QBJ A;  3MFK A;  4CXF A;  5CJ9 A;  3W6J B;  2PI0 A;  4ENK A;  3DPL C;  1S29 A;  2BYV E;  3KCC A;  4MQV A;  1YW9 A;  2MLG A;  1TLH B;  3EET A;  4KIC A;  4ENN A;  2FA5 A;  2ESN A;  1LEA A;  4Y13 A;  1WWX A;  4ON0 A;  3HHH A;  2KJB A;  4Z2Y A;  3TO7 A;  3GLX A;  5DV5 A;  4M6Y A;  3LWF A;  4HOB A;  5EEG A;  3DXJ F;  3WTY C;  2GIV A;  1W5S A;  4NHJ A;  2W85 A;  1E17 A;  2QEN A;  3BJ6 A;  3J81 K;  1IW7 F;  5D5X B;  4KUM A;  1MJB A;  2MH9 A;  3GZ5 A;  2G7U A;  1KGS A;  3CUQ A;  4PCQ A;  1TQM A;  3FM5 A;  2GXB A;  2ZME B;  4FT8 A;  2DFI A;  1YIO A;  2IVM A;  3T8R A;  4R8H A;  2HYF A;  2XRN A;  2X4H A;  2XGX A;  5F64 A;  4I02 A;  3T5X A;  3ZMU A;  4HLX A;  3KEO A;  1XSV A;  3TGN A;  1P92 A;  2JSC A;  2DQL A;  2AXL A;  1F4K A;  4KNY A;  3VB2 A;  4MGR A;  4LFU A;  4ZYD A;  3FWE A;  3W6K B;  3COA C;  3TDZ C;  5HLH A;  1D3Y A;  1O7F A;  4HF2 A;  3HSF A;  1FBQ A;  3E6D A;  2A6H F;  2HFH A;  2KRF A;  3GW2 A;  2DAO A;  1UB9 A;  2GA1 A;  2JPC A;  4H0E A;  1KQ9 A;  3GFI A;  3M1E A;  4Y17 A;  2O8X A;  4U88 A;  2HEO A;  3QP6 A;  2HGC A;  2IT0 A;  3QU3 A;  4IF4 A;  1IRG A;  1SD5 A;  2P6T A;  5D8K B;  1SD4 A;  2HTS A;  4IPA A;  1ZYR F;  3WG9 A;  2LF7 A;  3CDH A;  3V7C A;  1BN5 A;  4O5V A;  3BJO A;  2F5F A;  1ONV A;  4G9Y A;  5TRD A;  4HAM A;  5EEH A;  1AWC A;  4HF1 A;  2DU9 A;  2QQ9 A;  4A0X A;  2PG4 A;  4BXU A;  5JVT A;  2NNY A;  3F8B A;  1W7P B;  2QQB A;  4LK1 F;  2VE9 A;  2NAZ A;  2VBZ A;  3SFZ A;  3RI4 A;  2XAQ A;  3T1B A;  1K6O A;  3DEU A;  4CGZ A;  2Q0O A;  3M9A A;  4ZYE A;  2OBP A;  2VOD A;  1T0F A;  2HKX A;  1W5T A;  4R79 A;  4Q48 A;  2LNB A;  4ZZD A;  1W7P D;  2QVO A;  4HX4 A;  3E6M A;  2Y48 A;  2HQR A;  1I1S A;  3L2C A;  1XDS A;  2CO5 A;  1SAX A;  2ZO4 A;  3FXR A;  3QRF F;  1WRJ A;  3E5U A;  2RQP A;  4M6X A;  1BBY A;  3ZMD A;  3GF2 A;  3FMS A;  5D8L B;  2NS0 A;  4A2U A;  3U2R A;  2GXG A;  1ZLK A;  2L3D A;  1G3Y A;  3R6S A;  4L9T A;  4MHG A;  3I59 A;  1U5T C;  1PP8 F;  5L3C A;  2K4J A;  2ZKZ A;  3ELK A;  3M8F A;  4HQE A;  1R5H A;  1U5T B;  4KT5 C;  2XKP A;  1ZGA A;  3WTW C;  1RNL A;  4EM0 B;  3IRQ A;  2L4A A;  2QM3 A;  4AVP A;  4EJO A;  3HOT A;  1XGM A;  2KIM A;  3DPT A;  5JI6 A;  2P4W A;  3U1D A;  3B73 A;  4YII A;  2VN2 A;  3MZH A;  4XSX F;  4MTE A;  1FYL A;  2LKP A;  5FB2 A;  1UHM A;  3I71 A;  2E1N A;  2BE5 F;  5HOO A;  5E1Z B;  3J7A O;  2HR3 A;  1OKR A;  3GO5 A;  2FQ3 A;  4HQM A;  5H20 A;  2VT2 A;  2HZT A;  1H9T A;  4EJV A;  1FYK A;  3E5X A;  4KN4 X;  3OOP A;  2V79 A;  2RVC A;  3R61 A;  4QWQ A;  1O57 A;  2D1V A;  5DD8 A;  5CVV A;  3V8K A;  1S8N A;  5FGM A;  1JGS A;  5F1R A;  3RKY A;  3C1D A;  1O3R A;  2P6S A;  3ZP5 A;  4OMZ A;  3F23 A;  2STW A;  1R22 A;  1HW2 A;  3ZN1 A;  4Q47 A;  1S3J A;  5CVJ A;  3OV8 A;  4I0B A;  2EFQ A;  4OIQ F;  3WTZ A;  1LDD A;  4A5N A;  3DFG A;  1REP C;  1Z6T A;  5J8F A;  1FBU A;  2XAF A;  1P4A A;  3HOS A;  1KU2 A;  4LLN A;  5D6E A;  5HDN A;  3E3V A;  3V7R A;  3HTU A;  4UUV A;  1B4A A;  2OD5 A;  1J2X A;  1RUO A;  2STT A;  2OZU A;  1HKQ A;  2IA2 A;  4RGU A;  4LB5 A;  5JHU A;  3KP7 A;  1ZG3 A;  3V4G A;  1T6S A;  1IXR C;  2P5L C;  2LDU A;  5DUK A;  4A5M A;  4EMS A;  2ESH A;  2VON A;  4AWX B;  5A2Q Z;  4U7D A;  2XIG A;  5H6R A;  4HA8 A;  4FHT A;  2G7H A;  2L01 A;  2VT3 A;  1U3E M;  2PMH A;  2FBH A;  2BBY A;  1ZLJ A;  2UZK A;  1R1T A;  2LSO A;  3K9T A;  5E8I A;  1JHH A;  4KIG A;  3PQJ A;  3DQV C;  1UFM A;  1B9M A;  5E17 F;  2QUF A;  3NRV A;  1G4D A;  1D8K A;  1C0W A;  1ZN2 A;  2EV6 A;  5LEJ A;  3LAJ A;  1CF7 B;  4HLY A;  3GFL A;  2COM A;  2PFB A;  2VOP A;  3S2W A;  2EFP A;  3GWZ A;  1FY7 A;  4LK0 F;  2IRF G;  3KLO A;  3V7S A;  1PP7 U;  3K1P A;  1BI3 A;  1KYW A;  1U8R A;  3LQR A;  5LEK A;  1XGN A;  2JPB A;  4OIO F;  2HYG D;  3H92 A;  4LGW A;  2XVC A;  3IWZ A;  4EVI A;  1R1U A;  3LFK A;  5D6F A;  1JHF A;  1H9G A;  1FBS A;  3ERE D;  3QOP A;  5CVU A;  2H27 A;  1LJ9 A;  3HRM A;  5LHH A;  3G73 A;  3C7J A;  3KE2 A;  1HKS A;  2HWV A;  1KU3 A;  5L3F A;  2H94 A;  1G6N A;  2H09 A;  3L7W A;  3BRO A;  1K79 A;  3M8E A;  1D5V A;  1V3F A;  2DLL A;  4P5O A;  2OQG A;  1LEB A;  4IHS A;  4M71 A;  2CWE A;  5DD4 A;  4KIF A;  4BHP A;  1BM9 A;  4EGZ A;  4E70 A;  3FXQ A;  1P4W A;  2Q8K A;  4PGG A;  4F7Z A;  4AIK A;  4ENJ A;  4OIN F;  5DUI A;  2BEO A;  4YG2 F;  2LF8 A;  2VE8 A;  3T8T A;  4A0Z A;  2HS5 A;  1W7P A;  1SFU A;  3BOQ A;  4JQF A;  1XMK A;  5CVI A;  3WU1 B;  1GVJ A;  2MH2 A;  5HDK A;  1XD7 A;  3HRT A;  2FE3 A;  5BPI A;  1A04 A;  3L00 A;  2ISY A;  1Z1D A;  2Z9O A;  5FFX A;  1FYM A;  3F3X A;  2PJP A;  1TBX A;  4IVN A;  1SMT A;  4I7H A;  3RKW A;  1LB2 A;  5ILV A;  4U0Y A;  3MQ0 A;  1FC3 A;  2Z33 A;  1I5Z A;  5DCM B;  4KMU X;  2Z3Y A;  5E20 A;  1EH6 A;  2TDX A;  1J75 A;  4M9Z A;  3JAM K;  3R60 A;  4RAZ A;  3GFJ A;  3IL2 A;  3V8J A;  5HS8 A;  3VOE A;  1I27 A;  2M5W A;  2KIF A;  2HTJ A;  4RGX A;  2V1U A;  5HVQ C;  1QZY A;  3Q9S A;  1HBX G;  1U5T A;  2F5D A;  1IN8 A;  2L54 A;  4L5J A;  2CG4 A;  5DEQ A;  2QBY B;  3GUD A;  1EV7 A;  2F2E A;  4P55 A;  1YO5 C;  1STZ A;  4L0Y B;  3PFI A;  5L3E A;  4HX8 A;  1G3W A;  1B6A A;  2J5P A;  2K86 A;  4A12 A;  4ESB A;  3BY6 A;  4BH9 A;  3VEP A;  2FSW A;  1JE8 A;  1J5Y A;  4YFN F;  2UXX A;  4XBF A;  3SZP A;  4BHC A;  4Q5S F;  2K27 A;  1MZB A;  3HIF A;  3F21 A;  2JZY A;  2DT5 A;  2FNP A;  1I1G A;  3P9K A;  2M87 A;  3HUG A;  2RKH A;  2DPU A;  1IN7 A;  6PAX A;  1T98 A;  1R5G A;  4LMY A;  5ICC A;  1HXD A;  3DV8 A;  1YS7 A;  1ZRF A;  1FSE A;  4P96 A;  4EM1 A;  1KQ8 A;  3AAF A;  1Y0U A;  5E1W A;  1NHA A;  2V1X A;  2Z5U A;  3N4M A;  1FP2 A;  3SHF A;  5HLG A;  5ED4 A;  4LLG F;  3KP5 A;  2XAJ A;  4EV0 A;  4WK8 F;  2IA0 A;  1TW2 A;  3QAH A;  4L5I A;  1ZHF A;  3EUH A;  3I64 A;  2HKO A;  4IRI A;  4Q4Z F;  2D1H A;  3K69 A;  4MTD A;  3H3Z A;  3F72 A;  2O6G E;  2E1C A;  4G6D A;  4OMY A;  1GHC A;  2PN6 A;  4AIH A;  1XMA A;  2M8E A;  3LAP A;  1O3S A;  2P5K A;  2J5O A;  1VTN C;  5H6Q A;  2QZ8 A;  3F8M A;  2X0L A;  2QYO A;  2RN7 A;  1XN7 A;  3EDP A;  1R1V A;  1LDJ A;  3QU6 A;  2OU2 A;  4G8X A;  5J8C A;  3CUQ C;  3IC7 A;  1EH7 A;  3FMR A;  1J7K A;  4FX0 A;  4P9F A;  2Z99 A;  3RKX A;  2JT1 A;  3VOD A;  2B0L A;  1D8J A;  1FZP B;  5D5V B;  1YYV A;  4YFK F;  3CUO A;  1HST A;  4RB0 A;  3LA3 A;  4U0W A;  1AOY A;  5FFZ A;  2FBK A;  1U78 A;  1HKT A;  1Q1H A;  2EA4 A;  1LQ1 A;  3RYP A;  3B02 A; 
#chains in the Genus database with same CATH topology
 3R0J A;  1IAW A;  2K4B A;  3LL7 A;  3KYD B;  1I6X A;  3K4J A;  3FF5 A;  3E5Q A;  4P9U A;  3Q9V A;  4I2O A;  2HYJ A;  4CDG A;  2VIX A;  1S7A A;  3QP5 A;  3REO A;  4RGS A;  2A6E F;  1FWZ A;  3BZ6 A;  3QWL A;  4XKC A;  5DCF A;  2LLK A;  3S8P A;  3V42 A;  2V9P A;  2BV6 A;  4KMF A;  2ZC2 A;  4KIB A;  1MMD A;  4HV6 A;  3QPT A;  1O3Q A;  4XN3 A;  2YPR A;  4A3M J;  2ZJ2 A;  4G7Z F;  1BOA A;  1YG2 A;  4JX4 A;  2E60 A;  1FTZ A;  2NYX A;  3TDU C;  2L9V A;  2VQH A;  3OL3 A;  4PZJ A;  5JFR A;  5EF6 A;  3W2A A;  3BPV A;  3WHB A;  2GWR A;  1XGO A;  2FQ4 A;  2A05 A;  2OZ6 A;  5EG0 B;  1YJW I;  4M9X A;  2L7M P;  1F43 A;  4UV8 A;  2YS9 A;  2QCO A;  2EFN A;  3H3U A;  3LST A;  3HJE A;  3PFY A;  3GXO A;  2DPD A;  2BGC A;  1CGP A;  4RB3 C;  3KP6 A;  4WF2 A;  4XLF A;  2UXN A;  1VZ0 A;  3TOB A;  2R7U A;  4LJZ F;  1R36 A;  2WY7 Q;  2ZCW A;  3P9C A;  4DYQ A;  1RRJ A;  1IGN A;  2LC2 A;  3I5U A;  3OR2 C;  2JA6 J;  2XC7 A;  4OOI A;  1ETW A;  4IL6 C;  2R7X A;  4HZF A;  5LRR A;  3CDI A;  4V2G A;  4G6Q A;  5M3F J;  4KYW A;  5K7H A;  3WTT C;  3WTS C;  1S6L A;  1MSF C;  2F5E A;  3I0T A;  4MEX F;  4M9S A;  1TQP A;  4K2E A;  1DUX C;  2WAQ A;  3RZO J;  1TWF J;  3OY9 A;  1J0R A;  2DDA A;  2WC2 A;  3H35 A;  2W25 A;  1NG7 A;  2X6W A;  3H3V K;  2E71 A;  1JUP A;  3CJN A;  3DU5 A;  2BW3 A;  1Z6R A;  1ZGJ A;  2FF4 A;  2Q2E A;  2RV8 A;  2YX4 A;  3KZY A;  3K70 C;  3MVP A;  1U8B A;  4LOC A;  2ZXI A;  1VF9 A;  5DDG A;  2XAG A;  2X1C A;  4AC0 A;  1Y6I A;  3K1M A;  1PYV A;  2HU9 A;  5IT9 Z;  2JA5 J;  3ABU A;  3BWG A;  5K5O A;  1BC8 C;  2VBW A;  4M72 A;  3FX3 A;  2LVS A;  5BS6 A;  2XAU A;  3WTU C;  2XGE A;  4B43 A;  3IAM 2;  3IH4 A;  4XOT A;  4WXH A;  1X4P A;  3OSG A;  5L3D A;  5FRM A;  3CCY A;  1V55 H;  4I01 A;  3O6B B;  3IWF A;  3K70 D;  4LB6 B;  2FMY A;  1ORK A;  1B1B A;  3TW6 A;  2X1D A;  4E7J A;  4ESF A;  4UNO A;  3LSG A;  2ZBK A;  1N25 A;  3LA7 A;  2DXI A;  2W84 A;  4KFC A;  2MBF A;  1XSX A;  3P7N A;  3K4K A;  3ZOB A;  1K78 B;  2JUC A;  3D0S A;  4XQF A;  2HVR A;  4E7I A;  3KP2 A;  1ODD A;  1YW8 A;  2VUM J;  3GTQ J;  2CW0 F;  2FBI A;  5LGN A;  4KIS A;  4HG2 A;  2PEX A;  5AON A;  1WZ2 A;  2FML A;  1LFB A;  1GV5 A;  2IXS A;  5GP9 A;  1OFC X;  1X4O A;  4BHB A;  4JBA A;  2ECC A;  3HRS A;  1KZH A;  1FPQ A;  2A61 A;  3JW4 A;  2VXD A;  4UUS A;  2DN0 A;  2ME6 A;  5D4S A;  1SD6 A;  1UG2 A;  4O3M A;  3JRI A;  2X48 A;  2ICW G;  4XON A;  2ACJ A;  2IA1 A;  2JWT A;  5IYB J;  4ENM A;  2L02 A;  2FNA A;  2EA2 A;  4YRV A;  4PK4 A;  3HM5 A;  2R7T A;  4QTR A;  3HPH A;  2I10 A;  5J4V A;  3WTV C;  1KYZ A;  3WE3 A;  4WWC A;  2K40 A;  3BQZ A;  4KDP A;  3PO2 J;  2EV0 A;  5E1X A;  5HLI A;  3KEQ A;  3ABM H;  5L3G A;  1BI2 A;  3TW7 A;  3DP7 A;  3CMM A;  5ERI A;  2BZT A;  4CIC A;  5M5Y J;  2A5Y B;  3DKY A;  4FCY A;  3SXY A;  4UY8 I;  4S05 A;  5D4R A;  4Y7N J;  3Q0V A;  1HQC A;  2K02 A;  2EIL H;  2M8G X;  4L9N A;  3L2R A;  4RAG A;  1U0J A;  2W48 A;  3SDG A;  4E7L A;  3CC4 I;  2XF6 A;  3GCM A;  1GLN A;  1N75 A;  1OR7 A;  1KU9 A;  5FKL A;  5E18 F;  2YU9 J;  2CQ7 A;  4PJL A;  2OTL I;  4XRS A;  4ZYG A;  5E3O A;  4F55 A;  3AG3 H;  3I9V 2;  1HF0 A;  4HPQ A;  2AHQ A;  3FXK A;  1R7J A;  1T39 A;  3VYU B;  1Y56 A;  1LNW A;  1ETV A;  2R7V A;  3W2V A;  1V4R A;  1MMS A;  2EZK A;  1YOV B;  1XPX A;  2HDC A;  5DCM A;  3QQA A;  9ANT A;  3TL4 X;  2CS3 A;  1H0M A;  2WTE A;  2MGQ A;  5B3S H;  1QPM A;  1VQP I;  1SD7 A;  3CCM I;  3KZZ A;  2ZME A;  2R5Z A;  2DO7 A;  1OIS A;  1XDU A;  2NNN A;  3K6G A;  3BPX A;  2K9L A;  4D1Q A;  4Y33 A;  3WTX C;  4QPO A;  3FBI B;  5DS9 A;  2QEX I;  5FRO A;  2QLZ A;  2DQR A;  2LP0 A;  2R7F A;  4MFE A;  4XM3 A;  1BL0 A;  3CC7 I;  2XF7 A;  3ABT A;  5HNF A;  4TV7 A;  2EZL A;  1Z7U A;  2OF7 A;  1WJ5 A;  4JX5 A;  3E97 A;  2L9S A;  1ZH5 A;  2P8T A;  1HCR A;  3L09 A;  5K1Y A;  1X3U A;  1S5L C;  1OYY A;  2FXA A;  5ICG A;  1ZKG A;  2K7L A;  1MMG A;  4GGG A;  1W1W E;  1XCB A;  1X1B A;  2L4M A;  4DYC A;  3GZ6 A;  3TMO A;  1O7L A;  2O03 A;  4ABZ A;  1W0U A;  3OYE A;  1BI1 A;  3I4P A;  2QBY A;  1TWC J;  3Q0W A;  1T33 A;  5KAI C;  5A2Q K;  4LG0 B;  1P4X A;  1D0X A;  2VKE A;  5FLV A;  5BOX A;  1OYI A;  3FKI J;  4DBR A;  1X1D A;  2XSJ C;  3J7Z I;  3GEZ A;  2CW7 A;  2KHM A;  3LOC A;  3M07 A;  4M74 A;  1R6R A;  2RQQ A;  2WAF A;  1IXC A;  2QF7 A;  5IOY A;  2UWM A;  2PMZ N;  4HDV A;  2EPF A;  3ZMS A;  4BE1 A;  3ZR8 X;  4A3I J;  3BP8 A;  3K7A J;  2P7C B;  4IZZ A;  2CQN A;  2FU4 A;  2DJI A;  2DMQ A;  4AM3 A;  4NQW A;  1D1C A;  3J80 Z;  5ILU A;  1ETQ A;  1FIP A;  1V54 H;  3OYB A;  4II2 A;  2DI3 A;  2E7W A;  1BC7 C;  1IRX A;  1ZAR A;  2OV7 A;  3HGY A;  1YS6 A;  4E7Z A;  3CCV I;  2IW5 A;  2H8R A;  1RZ4 A;  1Y8Q B;  2XUB A;  1IZ1 A;  1M1E B;  1U6G A;  3DPU A;  1N77 A;  2B7E A;  4ZYA A;  2BY1 A;  4D9J A;  3NAR A;  4E7K A;  4O6J A;  4GYG A;  2BXZ A;  3L1P A;  3E0J B;  2GQQ A;  4UVB A;  1ACI A;  1Z05 A;  3FBN B;  3T0Y A;  2HQA A;  2OAZ A;  1YW7 A;  3K0L A;  3EYY A;  4M73 A;  1TT0 A;  2JTV A;  5D5W B;  4C3I J;  1HW5 A;  2UV1 A;  1W0T A;  3KIO A;  2RGV A;  2F4M B;  4JK1 X;  2XHK A;  3RPQ A;  2VKH A;  4KA4 A;  3DKW A;  3LSM A;  3F22 A;  3HOV J;  1LUJ B;  2NVX J;  1YHQ I;  1WPK A;  1TWG J;  4H4K C;  1R5I D;  1L3L A;  2CFX A;  4LLL A;  5E3M A;  1IRF A;  4XKB A;  1VQN I;  4A3B J;  2HQN A;  2V6C A;  4MIM A;  3I56 I;  2DA3 A;  4FX4 A;  2R5Y A;  4U0V A;  3M1C A;  5GAD J;  1YJ9 I;  1O3T A;  1ZGW A;  2GLO A;  2PJR B;  2JRM A;  3KFW X;  1E2X A;  1OCT C;  3U9G A;  3VSK A;  3A4C A;  3CTA A;  1TNT A;  3FHZ A;  3TO9 A;  4V2F A;  2HOE A;  4UHT A;  3NQO A;  1UHW A;  1X19 A;  2OUM A;  1R4M B;  1HLV A;  4D0P A;  3ZQF A;  4BEH B;  1W4M A;  1XGS A;  2MC3 A;  3F6V A;  2XGC A;  4MQ9 F;  3GTJ J;  3DTK A;  5F6F A;  1CQT A;  3O3K A;  4IHW A;  2H6C A;  5LGT A;  4HX7 A;  2O3F A;  3JRB A;  4F3Q A;  4ZH4 F;  5KVR A;  2G0E A;  1FOK A;  2M1B A;  1BR2 A;  2MA3 A;  1DPR A;  3CLO A;  1MBE A;  3ZMT A;  1ZG5 A;  4I98 B;  1E3O C;  1ON1 A;  4RBO A;  1QO0 D;  1LVK A;  4MLO A;  3GTP J;  3FM3 A;  2O61 A;  1P2F A;  2KL4 A;  3BTJ A;  3MAJ A;  1SFE A;  4HV5 A;  3RPU A;  3J80 K;  1FP1 D;  2ZJQ F;  1DPU A;  4AUX A;  2V4J C;  5JHF A;  4G7H F;  2O0Y A;  1LE8 A;  1WCM J;  2EWN A;  3HSE A;  4MNU A;  1T38 A;  4UUT A;  4B8X A;  2XDV A;  2EJR A;  4S0H B;  2L7K A;  1MKM A;  3RQ4 A;  3V8L A;  2JRT A;  4BQA A;  2CYY A;  2OC6 A;  3CJT B;  1A6Q A;  3RYR A;  1RUN A;  4XLE A;  2KZG A;  1YRN A;  4WCG A;  4UXN A;  2VKD A;  4OIR F;  4L0Z B;  4BQN A;  1DGR M;  4D5F A;  1ZAO A;  3GME A;  2RDP A;  2K9N A;  4RB1 A;  3ZN0 A;  4E7H A;  3BJA A;  2K3P A;  4UB8 C;  4CCN A;  2A68 F;  5EGO B;  3X2Q H;  2KFD A;  4PSX A;  5CQG A;  4XN0 A;  3A01 B;  3LSJ A;  1IJW C;  2E7X A;  2CUZ A;  3M7G A;  4G7O F;  3E6C C;  1ZTR A;  2M3A A;  5LBQ A;  2GIZ A;  3MKZ A;  1S7E A;  5F08 A;  2O9L A;  1MH3 A;  3GVA A;  3OYG A;  3CO7 C;  4HNV A;  3WE2 A;  2XB5 A;  2KJC A;  4A6D A;  1KU7 A;  1RI7 A;  2DK8 A;  2H1L A;  1E3P A;  3CP8 A;  1MMA A;  1MGT A;  1B72 B;  2JA7 J;  5F1J A;  1NG6 A;  3IKT A;  4CCL A;  3R0A A;  4F91 B;  3HOW J;  1YLF A;  3HZJ A;  4OAZ A;  3E1S A;  1LDK B;  1BA5 A;  1PVE A;  2P7V B;  4NNJ A;  3D1N I;  3PNT A;  4M3D A;  1XB4 A;  4IEJ A;  3S1Q J;  2MD5 A;  2M7A A;  4B48 A;  2YUS A;  4X0G A;  5BNG A;  2N8G A;  5EG0 A;  1BIB A;  1PUE E;  2M30 A;  1NK3 P;  1T56 A;  4JYK A;  2BHY A;  1AU7 A;  3DTI A;  2LBF B;  1MDM B;  4XSZ F;  1JT6 A;  2OJE D;  1YIJ I;  1WJD A;  1MBJ A;  2VBY A;  1DU6 A;  3DU6 A;  3NAU A;  4NC8 A;  1G3S A;  1IN4 A;  1JJ8 C;  2LY1 A;  5GAH J;  1OMI A;  3MCZ A;  2DTR A;  1ETY A;  3K4B A;  2W7N A;  2IAI A;  2OA4 A;  3I3L A;  3RTR A;  4BXF A;  3JCU C;  4M3G A;  1VQO I;  1PDN C;  2R7Q A;  1FNN A;  4DBQ A;  3H9Q A;  2KIU A;  5K5Q A;  2ETH A;  2VC1 A;  2GZW A;  1IF1 A;  1FOX A;  3OYH A;  1MBH A;  2VC0 A;  3JRH A;  4R1H A;  3DBL B;  1ETK A;  3OOU A;  4IXA A;  4BGD A;  3RKQ A;  3ZQL A;  1ETO A;  1VND A;  1MNE A;  3VFZ A;  2X1E A;  3K4L A;  4XIC A;  5DM7 F;  1UMQ A;  4IHY A;  2VPL A;  3O8G A;  3MZY A;  1V5E A;  3ML6 A;  1HW1 A;  1HOM A;  4D5C A;  1F5T A;  1BJA A;  2KKO A;  4N0B A;  3GFM A;  3OYL A;  1JI8 A;  2XB0 X;  2IGN A;  1Y8R B;  3EUA A;  4UVC A;  2M45 A;  2Z1D A;  3CMY A;  4EJT A;  1K4S A;  2WA0 A;  2D45 A;  3ZQH A;  5L3B A;  2FUG 2;  3GYH X;  3HXL A;  5EDN A;  3HKZ A;  1UJ8 A;  2A69 F;  4KN7 X;  3ROU A;  1Z21 A;  4BDZ A;  5CVR A;  5HDG A;  3HOY J;  1SFX A;  4I09 A;  3PJR A;  1QZZ A;  5HS9 A;  3TOA A;  2WWY A;  2L5Q A;  2PX9 A;  2LFB A;  3I53 A;  3MMY B;  1U2W A;  5FD5 A;  2QQ8 A;  3S17 J;  2DMN A;  3TQN A;  2FEZ A;  4AD9 A;  4U7B A;  1K78 A;  3HHG A;  1MJA A;  3TKY A;  2QQA A;  4AIJ A;  2CQK A;  4Y15 A;  4QLC U;  2QWW A;  3K1N A;  3BZC A;  3B6C A;  3P5J A;  2YX7 A;  1OPC A;  5CLS A;  2LKX A;  3JRE A;  3CLQ A;  1IXS B;  1VQ7 I;  1YTY A;  4C3H J;  1BI0 A;  5JR3 A;  4IOC F;  1WKM A;  2VQC A;  3WOD F;  2XV4 S;  1TTY A;  4FE4 A;  3SYT A;  3CUQ B;  3N05 A;  3F6O A;  5J40 A;  4PGH A;  2GAU A;  5IT3 A;  1JXS A;  2NVQ J;  1LVA A;  1NTC A;  2L9N A;  1MJ9 A;  1Z9C A;  4C2T A;  1EH8 A;  4PUS A;  2CQX A;  5BPD A;  2ADU A;  1B9N A;  4XLN F;  4BAY A;  1OJL A;  5FLX Z;  3LQQ A;  2VOO A;  1T8I A;  4ZYH A;  4FE7 A;  2C6Y A;  3LSI A;  3C18 A;  5J6X A;  4EGY A;  3C2B A;  3OYK A;  3IRR A;  4HF0 A;  1R49 A;  3CJR B;  5IYD J;  3LA2 A;  5E8G A;  1J59 A;  1ON2 A;  3H0G J;  4A0Y A;  1SC7 A;  4MEY F;  2CGP A;  4A3F J;  1WJA A;  1HDP A;  4OIP F;  1OCZ H;  3BDD A;  5GPC A;  2F5C A;  1B59 A;  2DJN A;  2H6B A;  3K2Z A;  1DP7 P;  4XLP F;  3GTO J;  1ZG1 A;  2JSP A;  1OCR H;  3EQL F;  1QNT A;  2FRH A;  3MEX A;  4L18 B;  3FK7 A;  1JKO C;  1RKT A;  5LHI A;  5KCM A;  1P7J A;  1YQA A;  4PDK A;  4CHU A;  4DQ2 A;  1T2K A;  1R58 A;  3SDB A;  2ISZ A;  2PMU A;  1XCV A;  3VYR B;  2LY9 A;  2IBD A;  4N9I A;  1A36 A;  3S14 J;  2HOT A;  4ZDO A;  3OSF A;  3IP4 B;  1POG A;  2Y0S N;  3I58 A;  4GXO A;  4RM3 A;  4RLQ A;  3TO6 A;  2K9S A;  2V9V A;  2PQ8 A;  2FOK A;  1WSU A;  2VB6 A;  2NS8 A;  3WGG A;  1RC9 A;  3F8F A;  3O2P E;  5ILS A;  2IJL A;  2XKO A;  4RLF A;  5BQT A;  1IRZ A;  3SZG A;  1SVL A;  1TW3 A;  3HOU J;  5GPA A;  4EAT A;  1V5G A;  1CF7 A;  5BMZ A;  1WJB A;  5J1U A;  4RAY A;  4BXX J;  3KP3 A;  1FT9 A;  5D5U B;  3PSF A;  5DM6 F;  1TQI A;  1YE9 A;  2EV5 A;  2JVH A;  4XKW A;  1H89 C;  3H9J A;  1MW7 A;  1QQI A;  1WQ2 A;  1KQ0 A;  1WVR A;  3DWL E;  3WHC A;  5AIP A;  3BTI A;  3G3Z A;  3BTL A;  5GAE J;  2KP6 A;  1T0F C;  3ZMZ A;  2OPT A;  4I0A A;  3N97 A;  1UCR A;  5CYV A;  3E7L A;  3S2H J;  5FLX K;  4RGR A;  3HPG A;  1Y0N A;  1S7O A;  3G2B A;  4QPQ A;  1Z91 A;  4KJZ A;  3S16 J;  3MKY B;  5IY5 H;  4A6E A;  2W57 A;  5ICF A;  4LG0 A;  5LLQ A;  1GV2 A;  2DA4 A;  3AL0 C;  1KON A;  3KLN A;  3IKV A;  1BOB A;  4IJA A;  2FD5 A;  1ULY A;  4GCV A;  5K5R A;  4S04 A;  1D0Y A;  1G8X A;  1Z3X A;  3DF8 A;  1R00 A;  2DOE A;  4UVA A;  3EYI A;  5B1A H;  3M4O J;  1I50 J;  2PLY A;  3OYI A;  3AL0 B;  3JTH A;  1JKP C;  4ZJZ A;  3Q5F A;  4BS9 A;  2XRO A;  2W00 A;  4L9J A;  1JGG A;  5DTD A;  3FZV A;  1FSH A;  4CCO A;  3BR3 A;  2DBB A;  4ESJ A;  3G1O A;  2MFZ A;  2VBX A;  4N9H A;  3GX4 X;  2VXZ A;  2IS6 A;  3PNY A;  1B8I B;  1TZL A;  4BNC A;  1ETX A;  2W4S A;  1W5C C;  3GBG A;  2PMZ A;  4YFX F;  3GTG J;  4C3J J;  3LSP A;  3ABL H;  1F9N A;  2W24 A;  2P5V A;  3CO6 C;  3SZT A;  3ECH A;  3JSP A;  3KET A;  2L0K A;  1F1Z A;  1GXP A;  4BKX A;  2EFO A;  2R0Q C;  5TJJ A;  3EPZ A;  1ZR4 A;  2NRA C;  1IN5 A;  3F8N A;  2XPU A;  3A2K A;  3SEQ A;  1UHS A;  3WU2 C;  2ZNY A;  4B4C A;  1R23 A;  2V1D A;  3PL8 A;  4XRF A;  5EZH A;  2EFW A;  3IHU A;  1A35 A;  3I59 B;  4NB5 A;  3F8C A;  1YX5 A;  2CW8 A;  2Y75 A;  2ZNZ A;  3QPH A;  4A69 C;  1RPW A;  2ZFW A;  3OL4 A;  1UST A;  2WV0 A;  4BQQ A;  4HYE A;  2FX0 A;  2YU3 A;  4AYB N;  1UG0 A;  4CYD A;  1SVM A;  5E79 C;  2LYC A;  3SQN A;  5K7F A;  3CCE I;  5LHG A;  2KQR A;  3KYL A;  4YIF A;  3MD2 A;  2P81 A;  3FXU A;  4RB2 C;  3PM1 A;  2DYS H;  4BE2 A;  2MSY A;  2PJR A;  4WXD A;  1L0O C;  2DDB A;  2DA6 A;  2XAH A;  3I54 A;  3JTG A;  2PBI A;  3R4K A;  4DNC A;  2R4G A;  2EK5 A;  2YSR A;  1SEU A;  3HTS B;  2ZXJ A;  5IT9 K;  3RJP A;  1QGP A;  1MMN A;  4IKF A;  2EIN H;  3RIR A;  2CUJ A;  3ASO H;  2M4K A;  3RDI A;  4BEH A;  3ASN H;  4LD5 A;  1ZRD A;  2DK5 A;  4HBL A;  3JRA A;  1RIO H;  2OCE A;  3LSH A;  3W2W A;  4BBS J;  1HSJ A;  3OMY A;  4EQQ A;  1IV6 A;  4B09 A;  4GO1 A;  1WH5 A;  3ABK H;  2VKV A;  1OYW A;  1MNM C;  3W6V A;  1WI9 A;  2CSO A;  1IN6 A;  3E6B A;  4DZP A;  4G6T B;  1FX7 A;  3BR6 A;  3PQK A;  4HNU A;  4ZZL A;  3HEF A;  1SVO A;  2JVG A;  4QIW N;  2XAS A;  1BIA A;  2XGD A;  4BY1 J;  1H8A C;  3HRU A;  5TGT A;  3H9G A;  4GYI A;  3OYC A;  1ERD A;  4W1U A;  1WHU A;  4RS8 A;  3ZPL A;  5IP6 A;  3ULQ B;  2ELK A;  1WGX A;  3KP4 A;  5F0C A;  3RSN A;  1G3T A;  5IPA A;  3L9F A;  2QSG X;  4WXC A;  2YR2 A;  2K3F A;  1DU0 A;  3P9I A;  3QYF A;  2ID3 A;  3CP2 A;  2A07 F;  2IS2 A;  5B66 C;  1BJZ A;  3H5A A;  1VQM I;  2E1O A;  4XL9 A;  1K7A A;  4OU0 A;  2IP2 A;  1ITY A;  3S3M A;  1P6R A;  4HDU A;  1YFH A;  3HYI A;  1K4T A;  1K83 J;  4KIT B;  2OQR A;  2Z2S B;  3ECO A;  3WGH A;  4RA2 A;  1LKX A;  2D2W A;  1IDY A;  2G9W A;  4ETS A;  4IHX A;  1SMY F;  3MWM A;  5EGO A;  2HOA A;  1MD0 A;  4EJU A;  4IRG A;  3A01 A;  1DDN A;  4OWR B;  2X6O A;  5LGU A;  3WGI A;  2VJI A;  1FLI A;  2MLK A;  3DCF A;  5FO5 A;  1IUY A;  2GA2 A;  3D5L A;  4L9V A;  2BW3 B;  5C4J J;  1WJE A;  2R7D A;  4CO8 A;  1EJ9 A;  4MO7 A;  2CV1 A;  5FKO A;  4UV9 A;  2RC4 A;  2CJJ A;  2ELH A;  4Y4R A;  2VJJ A;  3CCQ I;  1XSD A;  2AQF A;  1U9O A;  3DKX A;  5LRS A;  4BBR J;  4EJW A;  4JX6 A;  5C3E J;  2A3S A;  3C3W A;  4G94 A;  4XLA A;  3WU0 A;  5IYC J;  4B47 A;  5ICE A;  2R3S A;  1ZRE A;  4D7N A;  2EB7 A;  1B72 A;  1E0E A;  3FXM A;  3BT9 A;  3HSR A;  5KK1 A;  3RCO A;  3FMQ A;  1V5F A;  4HW0 A;  3RQI A;  2DW4 A;  3G1M A;  2LRE A;  3HOZ J;  3PO3 J;  1I3A A;  2V6E A;  5AIQ A;  3J81 Z;  1JTX A;  2EZI A;  4CZZ A;  1YIT I;  1YX3 A;  4BL0 B;  1KA8 A;  1G2H A;  4BU2 A;  1QU3 A;  1J9I A;  5HS7 A;  1O4X A;  3ISP A;  4DW6 A;  3JSO A;  1EKE A;  3ZMV A;  1MDM A;  1TWA J;  1USS A;  4CA0 A;  4IRH A;  1ZRC A;  1GXQ A;  1MND A;  2CV2 A;  3OWT A;  3LNQ A;  2LOO A;  2ECB A;  3JAM Z;  4WX9 A;  1I6H J;  1DGW Y;  1TNS A;  2IPQ X;  3K2A A;  1JUM A;  4BUP A;  5FD6 A;  3NEU A;  4ASN A;  4EM2 A;  2AS5 F;  1Z77 A;  2Y0M A;  1GDT A;  1QHH D;  3U21 A;  5EEA A;  2HZD A;  4BYY A;  4I76 A;  5DYM A;  2RNJ A;  4IHT A;  2XSD C;  2ZFU A;  3ZQ7 A;  4L5E A;  1QBJ A;  3MFK A;  4YIR X;  5FJ8 J;  1VQ8 I;  4CXF A;  5CJ9 A;  2EH3 A;  3W6J B;  2PI0 A;  2WV1 A;  5FLM J;  4ENK A;  3DPL C;  2M0M A;  3CMA I;  1TWH J;  4J19 A;  1S29 A;  2DOA A;  4PJN A;  4EEF G;  2BYV E;  3KCC A;  4MQV A;  2HDD A;  4FET A;  1YW9 A;  2MLG A;  1TLH B;  2W1O A;  3EET A;  2P0W A;  2X6X A;  4KIC A;  4ENN A;  4YEJ A;  1PUF B;  2LTP A;  2FA5 A;  4CZC A;  4D7M A;  3OYA A;  2ESN A;  3AKZ A;  3MZ8 A;  2NOJ B;  3BTC A;  3MKW B;  1K61 A;  1LEA A;  4BY7 J;  1OR7 C;  4Y13 A;  1VQ6 I;  2IGM A;  5KNL A;  3NWT A;  2DOF A;  1WWX A;  4ON0 A;  3HHH A;  4XNF A;  2IGK A;  2KJB A;  4Z2Y A;  3TO7 A;  3GLX A;  1S9H A;  4C2M J;  5DV5 A;  4NDL A;  4M6Y A;  4C2U A;  2R93 J;  3QYE A;  1SFO J;  3LWF A;  4HOB A;  5EEG A;  5TIS C;  3DXJ F;  2EIJ H;  3GZN B;  3WTY C;  2GIV A;  1W5S A;  4NHJ A;  2MYS A;  2W85 A;  4N4N B;  1E17 A;  2QEN A;  3QPL A;  1VQ5 I;  3BJ6 A;  1P9Q C;  3J81 K;  4ITV A;  1IW7 F;  3FIS A;  5D5X B;  3FKJ A;  2R92 J;  4KUM A;  1MJB A;  2MH9 A;  2RNG A;  2ZME C;  2KMU A;  3GZ5 A;  2CMP A;  3HGG A;  2G7U A;  3RZD J;  1KGS A;  3GTK J;  4J01 A;  2JMW A;  3CUQ A;  4PCQ A;  3HL2 A;  4J00 A;  1TQM A;  3FM5 A;  2O8K A;  2ZME B;  2GXB A;  4FT8 A;  2DFI A;  1X58 A;  1YIO A;  2BVL A;  3ZCO A;  2IVM A;  2M2E A;  3T8R A;  3OS0 A;  4HEA 2;  1A6I A;  4R8H A;  2HYF A;  2XRN A;  3ZQG A;  3H1C A;  2X4H A;  2LKS A;  2XGX A;  4I02 A;  5F64 A;  3T5X A;  3ZMU A;  4HLX A;  3KEO A;  1XSV A;  3TGN A;  1P92 A;  2JSC A;  5EYR A;  1Q1V A;  5FKK A;  1IDZ A;  2CV0 A;  2DQL A;  2AXL A;  1F4K A;  5FKN A;  4FAS D;  4KNY A;  5IP9 J;  3VB2 A;  3JR9 A;  1X2N A;  3S32 A;  5M5W J;  4MGR A;  4II3 A;  4LFU A;  2QSF X;  2Y30 A;  4ZYD A;  3FWE A;  3W6K B;  3COA C;  2CUE A;  4LIT A;  1ZQ3 P;  3TDZ C;  5HLH A;  1D3Y A;  1O7F A;  3ZQQ A;  4HF2 A;  2WY8 Q;  3HSF A;  1Y1V J;  1FBQ A;  3E6D A;  2A6H F;  2HFH A;  3GLL A;  2KRF A;  1JTY A;  1D1B A;  4XRM A;  1NK2 P;  1NH3 A;  2V7F A;  3GW2 A;  2DAO A;  1UB9 A;  2GA1 A;  2JPC A;  4H0E A;  1KQ9 A;  3PIO F;  3GFI A;  3PSI A;  3M1E A;  2HQ5 A;  4LIU A;  1VI0 A;  2DA1 A;  2KPM A;  4Y17 A;  1HA8 A;  2O8X A;  4U88 A;  2V9K A;  2HEO A;  3QP6 A;  2HGC A;  4XLC A;  2IT0 A;  3QU3 A;  2I5U A;  1X2M A;  3BQY A;  3G71 I;  2KDO A;  2E5Z A;  2DA5 A;  4A3K J;  4IF4 A;  1H88 C;  1IRG A;  2Y0S A;  1SD5 A;  2P6T A;  4IX7 A;  1FOY A;  1X1C A;  5D8K B;  1VQ4 I;  2TRT A;  1SD4 A;  2F48 A;  1J09 A;  1APL C;  2HTS A;  2X9D A;  3CES A;  4IPA A;  2HPM A;  1ZYR F;  3WG9 A;  4NBQ A;  1AHD P;  2LF7 A;  3CDH A;  1XS9 A;  3V7C A;  1BN5 A;  2V26 A;  4O5V A;  3BJO A;  2F5F A;  1ONV A;  4NC7 A;  4XMY A;  5B1B H;  2KZV A;  3K4M A;  4G9Y A;  5TRD A;  4F93 B;  4HRI A;  4HAM A;  2Y2Z A;  5EEH A;  2RRE A;  1AWC A;  4HF1 A;  2DU9 A;  2QQ9 A;  4A0X A;  2PG4 A;  4BXU A;  5JVT A;  2NNY A;  5HNH A;  3F8B A;  1W7P B;  2QQB A;  3CQZ J;  4LK1 F;  2VE9 A;  2LD5 A;  2NAZ A;  2VBZ A;  2VJ5 A;  3SFZ A;  3RI4 A;  2XAQ A;  5CPR B;  4ZDL A;  3T1B A;  3CCU I;  1K6O A;  3DEU A;  4CGZ A;  3OS1 A;  1X1A A;  2Q0O A;  3M9A A;  4ZYE A;  2OBP A;  2VOD A;  1T0F A;  2HKX A;  1W5T A;  4R79 A;  4Q48 A;  3L2W A;  4ANJ A;  2LNB A;  5KAF C;  4ZZD A;  1W7P D;  2QVO A;  4HX4 A;  4BJT A;  2H1K A;  3E6M A;  2NVY J;  1JJ6 C;  2Y48 A;  4BQO A;  4JP0 A;  2HQR A;  1I1S A;  3L2C A;  1GUU A;  1XDS A;  3PUB A;  1AKH B;  2R7Z J;  2CO5 A;  5J47 A;  3CF5 F;  1SAX A;  3ONQ A;  2ZO4 A;  3FXR A;  3QRF F;  2E2J J;  1I39 A;  3HBL A;  4M6V A;  1JKR C;  3DBR B;  1WRJ A;  3E5U A;  2RQP A;  3FK6 A;  4M6X A;  1BBY A;  3ZMD A;  3GF2 A;  4M3E A;  3ZXS A;  4BJ5 C;  3CME I;  5FRN A;  1R71 A;  3G4S I;  3FMS A;  4ZC3 A;  5D8L B;  3HC7 A;  2NS0 A;  4A2U A;  3U2R A;  2GXG A;  2ELJ A;  4OAY A;  2VLA A;  1ZLK A;  2OTJ I;  3HB9 A;  2BOL A;  2A6T A;  1LE8 B;  3M3Y J;  3FDY A;  2L3D A;  1G3Y A;  2DA2 A;  3R6S A;  4L9T A;  4MHG A;  5E3L A;  3I59 A;  3ESW B;  1U5T C;  1PP8 F;  5L3C A;  2K4J A;  5IOZ A;  4XID A;  4RM2 A;  1XTA A;  4XR6 A;  1YRN B;  2ZKZ A;  3ELK A;  2DT7 B;  3HG9 A;  1U9N A;  2E2H J;  3JRF A;  3M8F A;  4HQE A;  3DLA A;  1R5H A;  1GVD A;  4IQJ A;  1U5T B;  3VWB A;  3C2H A;  4AU7 A;  3S1M J;  1IV8 A;  1XG1 A;  3KX2 A;  4KT5 C;  2XKP A;  1S72 I;  1ZGA A;  4AYB A;  3WTW C;  1RNL A;  4EM0 B;  4B1R A;  3IRQ A;  1OLT A;  1R9T J;  2L4A A;  2QM3 A;  4BDY A;  3H5R A;  3DEE A;  2KLO A;  3IH3 A;  2GOX B;  1G59 A;  3A1Y A;  4AVP A;  2K9M A;  4F52 A;  3W3C A;  4EJO A;  3HOT A;  1XGM A;  4XKV A;  2KIM A;  1ZR2 A;  3DPT A;  3UR3 C;  2L7Z A;  3OYD A;  1P7I A;  5JI6 A;  2ZSI B;  2VAS A;  4PJJ A;  1PJR A;  2NS7 A;  2CFO A;  1RKW A;  2P4W A;  3U1D A;  1RR8 C;  1X3Z B;  3B73 A;  4FQG A;  2COB A;  4YII A;  2VN2 A;  2R7R A;  1FJL A;  4CSW A;  2D5V A;  3MZH A;  3DTE A;  1SAU A;  4E4H A;  3OYJ A;  2NVU B;  1TL8 A;  2QA4 I;  3S1R J;  2Q1Z B;  4XSX F;  4MTE A;  1D5Y A;  2EBI A;  1FYL A;  2HXI A;  2KIQ A;  3BC8 A;  2LKP A;  1JT0 A;  5FB2 A;  1UHM A;  1AA7 A;  2WB1 N;  2XPW A;  1OCO H;  2FJ1 A;  1EF4 A;  3I71 A;  2E1N A;  4HNT A;  1QVU A;  2BE5 F;  3HUG B;  5HOO A;  5E1Z B;  3J7A O;  1QPI A;  3K4C A;  1WFX A;  3PIP F;  4AVZ A;  2JA8 J;  2HR3 A;  4DIQ A;  4CCK A;  1OKR A;  5IP7 J;  3GO5 A;  1RET A;  2FQ3 A;  4HQM A;  5K7Z A;  5H20 A;  3SEZ A;  3KEY A;  2E35 A;  2QKM B;  2VT2 A;  2HZT A;  1H9T A;  4EJV A;  1YI2 I;  4V19 K;  1GT0 C;  1FYK A;  3E5X A;  3CC2 I;  4PFO A;  3S93 A;  4KN4 X;  3OOP A;  2V79 A;  2RVC A;  2BXY A;  2IGO A;  3R61 A;  3EUH C;  3BR5 A;  3TED A;  4QWQ A;  4CYC B;  4I99 C;  4IO9 F;  2GXA A;  3A0H C;  1O57 A;  2D1V A;  5E3N A;  2WAE A;  5DD8 A;  2HXO A;  5CVV A;  3G1L A;  3V8K A;  4HSR A;  1S8N A;  3HKZ N;  5FGM A;  1JGS A;  3OYF A;  2CQQ A;  5F1R A;  4CCM A;  3RKY A;  3C1D A;  1O3R A;  2P6S A;  2Y9Z A;  4RAF A;  4CH7 A;  3ZP5 A;  4GFB A;  2JQ7 A;  4OMZ A;  2X51 A;  3QOE A;  2KDZ A;  3F23 A;  2STW A;  1R22 A;  4GDF A;  1HW2 A;  3ZN1 A;  4Q47 A;  1S3J A;  3F0C A;  1JUS A;  5CVJ A;  3FXJ A;  4DZJ A;  3OV8 A;  4I0B A;  2EFQ A;  4OIQ F;  2VL8 A;  2CH0 A;  5GTH C;  3WTZ A;  1XC5 A;  1LDD A;  2MAB A;  4Y3O A;  3B6A A;  4A5N A;  3S3N A;  1XMX A;  3DFG A;  1REP C;  1Z6T A;  5J8F A;  2LK2 A;  1FBU A;  2XAF A;  2F4O B;  2Y69 H;  3MKL A;  4A3L J;  1P4A A;  3HOS A;  1KU2 A;  3MN2 A;  3TP0 A;  4LLN A;  3ZGK A;  4W97 A;  3BCB A;  5D6E A;  1FEX A;  5HDN A;  4A3D J;  3E3V A;  2TCT A;  3V7R A;  3HTU A;  1IUF A;  4UUV A;  1B4A A;  2OD5 A;  1J2X A;  3IH2 A;  1RUO A;  2STT A;  4DGW B;  2ZSH B;  4A93 J;  2OZU A;  1HKQ A;  2IA2 A;  2IEK A;  4RGU A;  3ERM A;  3UNG C;  4LB5 A;  5JHU A;  3CZ6 A;  2ZJP F;  3KP7 A;  1ZG3 A;  2UUZ A;  3IV5 A;  4PSW A;  3V4G A;  2DFF A;  1T6S A;  1IXR C;  3CDL A;  2P5L C;  3L2U A;  2LDU A;  3OIP A;  5DUK A;  4A5M A;  4FIS A;  2ESH A;  4EMS A;  2VON A;  4IQ4 A;  4AWX B;  5A2Q Z;  4U7D A;  1VQK I;  1BW5 A;  2XIG A;  5H6R A;  2VQG A;  3A02 A;  2VQL A;  4HA8 A;  3WG7 H;  1PUF A;  4FHT A;  2R7S A;  2BY0 A;  2G7H A;  2L9R A;  2L01 A;  2ZJR F;  2VT3 A;  2MG4 A;  4Z6Y A;  1U3E M;  2PMH A;  1BR4 A;  2FBH A;  2BBY A;  3BR1 A;  1ZLJ A;  2UZK A;  3IUO A;  1R1T A;  2LSO A;  3FIW A;  3K9T A;  3QYB A;  5E8I A;  3UKG A;  1MSE C;  2LMD A;  5FKM A;  4BJ6 C;  1QZE A;  1Y39 A;  1D0Z A;  1JHH A;  2L2O A;  2XRL A;  4DOZ A;  3DEW A;  4KIG A;  3PQJ A;  3M8J A;  1MBF A;  3DQV C;  3C2G A;  3S1N J;  2KRH A;  2L7F P;  1UFM A;  1B9M A;  2JA2 A;  3BZK A;  5E17 F;  3KZI C;  2QUF A;  3NRV A;  3CJQ B;  1A31 A;  1G4D A;  2WAD A;  2MC4 A;  3EUK L;  4P1W A;  1FMW A;  3D5R C;  4NC6 A;  3G6E I;  2A5W A;  4PJ0 C;  1D8K A;  5J4Y A;  1C0W A;  1ZN2 A;  2EV6 A;  1K6Y A;  4XK4 A;  3AG2 H;  5LEJ A;  2WAQ N;  3LAJ A;  2QKL B;  3J7A Y;  3LFU A;  1CF7 B;  4HLY A;  4KT6 A;  2DMU A;  2F5V A;  3GFL A;  3OR1 C;  4FTH A;  2COM A;  2PFB A;  2IS1 A;  2BVM A;  4A3G J;  4C30 A;  3CCS I;  2KT0 A;  2VOP A;  3S2W A;  2EFP A;  3GWZ A;  1FY7 A;  4LK0 F;  4XLH A;  5M5X J;  5KHD A;  2IRF G;  2HVQ A;  3KLO A;  4XOP A;  3VYS B;  3V7S A;  1PP7 U;  1QRY A;  2M4G A;  3K1P A;  2BY2 A;  1BI3 A;  1KYW A;  1U8R A;  1I3Q J;  3LQR A;  2Q2E B;  5LEK A;  3A0B C;  1XGN A;  2JPB A;  3D5S C;  4OIO F;  1ZEL A;  2HYG D;  2LR8 A;  3H92 A;  4LGW A;  4X1E A;  2XVC A;  3IWZ A;  1YJN I;  4EVI A;  1R1U A;  3LFK A;  1HDD C;  2XF5 A;  2B63 J;  1IO2 A;  4U87 A;  5D6F A;  3JRD A;  1JHF A;  3TP3 A;  1H9G A;  1FBS A;  1MBG A;  3KYC B;  3CF2 A;  3ERE D;  2VI6 A;  3QOP A;  5CVU A;  4B44 A;  2H27 A;  1LJ9 A;  3BG9 A;  1LPQ A;  3HRM A;  3OYM A;  5H2F C;  5LHH A;  3BCA A;  3G73 A;  3C7J A;  3KE2 A;  1HKS A;  2HWV A;  3BG7 A;  4ZTF A;  1KU3 A;  5L3F A;  1RR7 A;  2H94 A;  1G6N A;  3VDX A;  5JVG F;  2H09 A;  3L7W A;  2LBF A;  2O5R A;  3BRO A;  5C4X J;  2NXN B;  1K79 A;  4AID A;  3M8E A;  1D5V A;  1V3F A;  3ZQC A;  5F0F A;  1FMV A;  2DLL A;  4P5O A;  3JRG A;  2OQG A;  2K85 A;  1LEB A;  4IHS A;  4M71 A;  2CWE A;  2K9Q A;  4N4O B;  1LFP A;  5DD4 A;  1QVT A;  1D1A A;  4KIF A;  3H36 A;  2E34 A;  3VSL A;  2DFE A;  3OS2 A;  3Q0U A;  2EIM H;  4BHP A;  1BM9 A;  3AG4 H;  1OQY A;  4UUS B;  3L2V A;  1Z67 A;  4EGZ A;  4PJM A;  3S15 J;  2AQE A;  4E70 A;  3VYT B;  3FXQ A;  2B9S A;  1P4W A;  1JKQ C;  2Q8K A;  4PGG A;  4F7Z A;  4AIK A;  4ENJ A;  4OIN F;  2M0C A;  5DUI A;  2BEO A;  1Z7L A;  2JJ7 A;  4YG2 F;  2LF8 A;  3GTL J;  2ZXW H;  3KPH A;  3Q3S A;  4A3J J;  2VE8 A;  4M3F A;  4CCJ A;  3PNV A;  3T8T A;  1ZK8 A;  4A0Z A;  2HS5 A;  1TT5 B;  1W7P A;  2DMT A;  1MBK A;  1SFU A;  2R7O A;  3BOQ A;  2JUG A;  4JQF A;  1XMK A;  1OCC H;  5CVI A;  1W36 C;  3WU1 B;  1X3W B;  3U1K A;  2CRG A;  1GVJ A;  2MH2 A;  3J7Y J;  1TP4 A;  2HNH A;  2X6Y A;  5HDK A;  3A03 A;  3OYN A;  1WJF A;  2MD0 A;  1EA3 A;  1XD7 A;  3HRT A;  2FE3 A;  5BPI A;  4B3A A;  2AXT C;  1A04 A;  2M34 A;  3L00 A;  2ZXH A;  2ISY A;  1Z1D A;  2E19 A;  3CCL I;  1N78 A;  2Z9O A;  5FFX A;  1FYM A;  3F3X A;  4YEL A;  2PJP A;  3DBH B;  2QSH X;  2KIS A;  1TBX A;  4M3B A;  4IVN A;  5J3L A;  1AKH A;  3HOX J;  4LIV A;  1DQU A;  1SMT A;  2DOD A;  4I7H A;  1W36 D;  3RKW A;  4ZDP A;  2E5N A;  3QPS A;  4RDU A;  3BG5 A;  5ILV A;  1LB2 A;  3CD6 I;  4U0Y A;  2HI3 A;  3MQ0 A;  3SFI A;  2ME0 A;  1FC3 A;  2Z33 A;  1I5Z A;  5DCM B;  4KMU X;  5EZG A;  2K5C A;  4DYR A;  3OIO A;  2Z3Y A;  1T95 A;  5E20 A;  1EH6 A;  2TDX A;  1J75 A;  4M9Z A;  2FOW A;  3JAM K;  2R5Z B;  3R60 A;  4C9Y A;  3BR0 A;  4RAZ A;  3AFH A;  2LRD A;  1R4N B;  2AO9 A;  4IHV A;  3GFJ A;  3DLL F;  4BAC A;  3IL2 A;  3V8J A;  5HS8 A;  3TBI A;  2CUF A;  3VOE A;  3S2D J;  2E1M C;  1VFC A;  2H8W A;  5CQE A;  4PFP A;  1I27 A;  2M5W A;  2KIF A;  5HOD A;  2HTJ A;  4HST A;  1VQ9 I;  4G12 A;  2W82 A;  4RGX A;  2HVS A;  2V1U A;  4QSH A;  2LG4 A;  5GTI C;  5HVQ C;  1QZY A;  3Q9S A;  2NOG A;  2BY3 A;  1HBX G;  1U5T A;  2E1M B;  4UB6 C;  2F5D A;  1MIJ A;  1QHG A;  1IN8 A;  2L54 A;  4L5J A;  1MH4 A;  2CG4 A;  2LY2 A;  5DEQ A;  1Y1W J;  2WBM A;  3GUD A;  1EV7 A;  2F2E A;  4P55 A;  5F0H A;  2QBY B;  1FOW A;  2GBY A;  2RAE A;  3LSR A;  1YO5 C;  4XOR A;  1E3H A;  1STZ A;  2LH9 A;  5B5E C;  3SJM A;  1OCP A;  2XPV A;  2ID6 A;  4L0Y B;  3PFI A;  5GAG J;  5L3E A;  2MW8 A;  4HX8 A;  1RES A;  5EJC A;  5JLW A;  3CCJ I;  1G3W A;  1B6A A;  2J5P A;  2EIK H;  2K86 A;  2HPI A;  5LD2 C;  2DMP A;  1FIA A;  4A12 A;  2HDW A;  1UZC A;  4ESB A;  3BY6 A;  2BHZ A;  2GOM A;  2DCE A;  4BH9 A;  3VEP A;  2GM4 A;  4NQW B;  1QA6 A;  4A3E J;  2FSW A;  4GRI A;  1JE8 A;  2X85 A;  2QGU A;  1J5Y A;  4JOM A;  2Y31 A;  3O8H A;  2DTZ A;  3QOD A;  3VPR A;  3ZRG A;  1SAN A;  2CU7 A;  4YFN F;  2UXX A;  4XBF A;  2F4I A;  2O7O A;  3SZP A;  2EZH A;  2VPR A;  4BHC A;  4Q5S F;  3LMM A;  5M3M J;  4XRS G;  1F36 A;  2K27 A;  1MZB A;  3OIQ A;  3HIF A;  3F21 A;  2JZY A;  2DT5 A;  2FNP A;  4X6A J;  1I1G A;  2DA7 A;  2F6C A;  1BR1 A;  3P9K A;  1UEL B;  2M87 A;  5LFA A;  3HUG A;  5J1Y A;  2RKH A;  2DPU A;  3PUF A;  4ZTJ A;  3H5N A;  1IN7 A;  2R7W A;  1T98 A;  6PAX A;  1R5G A;  4LMY A;  1WJC A;  5ICC A;  1HXD A;  1XX5 A;  1SFK A;  1LFU P;  3F9K A;  1T08 B;  3DV8 A;  2WB1 A;  2Z16 A;  1YS7 A;  3S3O A;  2EQR A;  1ZRF A;  1FSE A;  4I6Z A;  3H0D A;  4P96 A;  4EM1 A;  1KQ8 A;  3AAF A;  1Y0U A;  1DP3 A;  5E1W A;  1NHA A;  4F92 B;  3JRC A;  3ZQI A;  2I8D A;  2V1X A;  5CKT A;  4RMN A;  2R5Y B;  2Z5U A;  3IAS 2;  3N4M A;  4A3C J;  1Z0X A;  3K4N A;  1FP2 A;  3BG6 A;  4CYC A;  3SHF A;  5HLG A;  5ED4 A;  4LLG F;  3I4N J;  2DFH A;  3KP5 A;  2XAJ A;  5JLX A;  1TC3 C;  4EV0 A;  4WK8 F;  2IA0 A;  1TW2 A;  1A5J A;  3QAH A;  2JN6 A;  1ZHF A;  4L5I A;  2E2I J;  3EUH A;  2DYR H;  2HKO A;  2Y9Y A;  3I64 A;  4IRI A;  4Q4Z F;  2D1H A;  5J1R A;  3K69 A;  4IOA F;  2DT6 A;  3H3Z A;  4DJA A;  4MTD A;  1WH7 A;  4LG3 A;  3FHN A;  1Z3Y A;  3AG1 H;  3F72 A;  2O6G E;  2OCC H;  2E1C A;  4G6D A;  4OMY A;  1B8I A;  1GHC A;  1X1P A;  2PN6 A;  4AIH A;  5F27 A;  4B3X A;  3I55 I;  1BW6 A;  1XMA A;  2E36 A;  2M8E A;  3LAP A;  2M7B A;  2HOS A;  1O3S A;  2P5K A;  2J5O A;  1VTN C;  5H6Q A;  4BE0 A;  2QZ8 A;  2ZB9 A;  3F8M A;  4E6K G;  1VQL I;  2X0L A;  2QYO A;  2V1N A;  2RN7 A;  1XN7 A;  3EDP A;  1R1V A;  1LDJ A;  3QU6 A;  2OU2 A;  4E7S A;  5HLT A;  4G8X A;  5J8C A;  3I4M J;  3CUQ C;  2VJ4 A;  1EH7 A;  3IC7 A;  4NUB A;  4Y52 J;  2NVT J;  3FMR A;  1J7K A;  4FX0 A;  4P9F A;  2Z99 A;  4MFD A;  3RKX A;  2JT1 A;  3RPU D;  2IS4 A;  3VOD A;  2B0L A;  1D8J A;  1FZP B;  3HDD A;  5D5V B;  3NWS A;  1YYV A;  4YFK F;  3CUO A;  2KRC A;  1HST A;  1IC8 A;  3LSK A;  4RB0 A;  3K10 A;  3FXO A;  4CUG A;  3CCR I;  1FTT A;  3LA3 A;  4U0W A;  1AOY A;  5FFZ A;  3GTM J;  3BG3 A;  5C44 J;  1UAA A;  2FBK A;  3L2Q A;  3BLY A;  1U78 A;  2M9H A;  3FXL A;  1ENH A;  1HKT A;  3BR2 A;  1WI3 A;  5F04 A;  1Q1H A;  1IG7 A;  2EA4 A;  1LQ1 A;  3RYP A;  2JK3 A;  3B02 A;  1HC8 A; 
#chains in the Genus database with same CATH homology
 3R0J A;  1IAW A;  2K4B A;  1I6X A;  3FF5 A;  3E5Q A;  4P9U A;  3Q9V A;  4I2O A;  4CDG A;  1S7A A;  3QP5 A;  3REO A;  4RGS A;  2A6E F;  1FWZ A;  3BZ6 A;  5DCF A;  2BV6 A;  4KMF A;  4KIB A;  4HV6 A;  3QPT A;  1O3Q A;  2YPR A;  2ZJ2 A;  4G7Z F;  1BOA A;  1YG2 A;  2NYX A;  3TDU C;  4PZJ A;  5JFR A;  3BPV A;  2GWR A;  1XGO A;  2OZ6 A;  4M9X A;  4UV8 A;  2EFN A;  3H3U A;  3LST A;  3GXO A;  2DPD A;  2BGC A;  1CGP A;  4RB3 C;  3KP6 A;  4WF2 A;  2UXN A;  3TOB A;  4LJZ F;  1R36 A;  2ZCW A;  3P9C A;  3I5U A;  4OOI A;  4HZF A;  5LRR A;  4G6Q A;  4KYW A;  3WTT C;  3WTS C;  1S6L A;  2F5E A;  3I0T A;  4MEX F;  4M9S A;  1TQP A;  4K2E A;  1DUX C;  1J0R A;  2WC2 A;  2W25 A;  3CJN A;  2Q2E A;  1Z6R A;  1ZGJ A;  2FF4 A;  2RV8 A;  2YX4 A;  3KZY A;  5DDG A;  2XAG A;  3K1M A;  5IT9 Z;  3ABU A;  3BWG A;  5K5O A;  1BC8 C;  2VBW A;  4M72 A;  3FX3 A;  5BS6 A;  3WTU C;  4WXH A;  5L3D A;  4I01 A;  3O6B B;  3IWF A;  4LB6 B;  2FMY A;  1B1B A;  4ESF A;  4UNO A;  2ZBK A;  3LA7 A;  2W84 A;  4KFC A;  2MBF A;  1XSX A;  3P7N A;  1K78 B;  3D0S A;  3KP2 A;  1ODD A;  1YW8 A;  2CW0 F;  2FBI A;  5LGN A;  2PEX A;  5AON A;  2FML A;  4BHB A;  4JBA A;  3HRS A;  1FPQ A;  2A61 A;  3JW4 A;  5D4S A;  1SD6 A;  4O3M A;  2ACJ A;  2IA1 A;  4ENM A;  2L02 A;  2FNA A;  2EA2 A;  3WTV C;  1KYZ A;  3WE3 A;  4WWC A;  4KDP A;  2EV0 A;  5E1X A;  5HLI A;  3KEQ A;  5L3G A;  1BI2 A;  3DP7 A;  5ERI A;  4CIC A;  2A5Y B;  3SXY A;  4S05 A;  5D4R A;  1HQC A;  2K02 A;  4L9N A;  1OR7 A;  1KU9 A;  5E18 F;  4ZYG A;  1R7J A;  1T39 A;  1LNW A;  1V4R A;  2HDC A;  5DCM A;  1H0M A;  2WTE A;  1QPM A;  1SD7 A;  3KZZ A;  2ZME A;  2DO7 A;  1XDU A;  2NNN A;  3BPX A;  3WTX C;  2QLZ A;  2DQR A;  2R7F A;  3ABT A;  4TV7 A;  1Z7U A;  3E97 A;  1ZH5 A;  2P8T A;  3L09 A;  5K1Y A;  1X3U A;  1OYY A;  2FXA A;  5ICG A;  2K7L A;  4GGG A;  1XCB A;  2L4M A;  3GZ6 A;  1O7L A;  2O03 A;  2QBY A;  1BI1 A;  3I4P A;  5A2Q K;  4LG0 B;  1P4X A;  5BOX A;  1OYI A;  3GEZ A;  4M74 A;  1IXC A;  2UWM A;  4HDV A;  3ZMS A;  3BP8 A;  2P7C B;  2FU4 A;  4NQW A;  3J80 Z;  5ILU A;  2DI3 A;  2E7W A;  1BC7 C;  1ZAR A;  1YS6 A;  2IW5 A;  1RZ4 A;  2XUB A;  1IZ1 A;  1U6G A;  4O6J A;  4GYG A;  2GQQ A;  4UVB A;  1Z05 A;  3T0Y A;  2OAZ A;  1YW7 A;  3K0L A;  3EYY A;  4M73 A;  2JTV A;  5D5W B;  1HW5 A;  2RGV A;  4JK1 X;  2XHK A;  3RPQ A;  4KA4 A;  3DKW A;  3F22 A;  1L3L A;  2CFX A;  4LLL A;  1IRF A;  2HQN A;  2V6C A;  4FX4 A;  4U0V A;  1O3T A;  3KFW X;  1E2X A;  3U9G A;  3CTA A;  1TNT A;  3FHZ A;  3TO9 A;  2HOE A;  4UHT A;  3NQO A;  1UHW A;  4D0P A;  1W4M A;  1XGS A;  2MC3 A;  3F6V A;  4MQ9 F;  5F6F A;  3O3K A;  2H6C A;  5LGT A;  4HX7 A;  2O3F A;  4ZH4 F;  5KVR A;  1FOK A;  2M1B A;  2MA3 A;  1DPR A;  3CLO A;  3ZMT A;  1ZG5 A;  4I98 B;  1ON1 A;  1QO0 D;  3FM3 A;  2O61 A;  1P2F A;  3MAJ A;  1SFE A;  4HV5 A;  3RPU A;  3J80 K;  1FP1 D;  1DPU A;  4G7H F;  2O0Y A;  2EWN A;  3HSE A;  4MNU A;  1T38 A;  4B8X A;  2EJR A;  1MKM A;  3V8L A;  2JRT A;  4BQA A;  2CYY A;  3RYR A;  1RUN A;  4WCG A;  4UXN A;  4OIR F;  4L0Z B;  1ZAO A;  2RDP A;  4RB1 A;  3ZN0 A;  3BJA A;  2A68 F;  2E7X A;  3M7G A;  4G7O F;  3E6C C;  5LBQ A;  3GVA A;  3CO7 C;  3WE2 A;  2KJC A;  4A6D A;  1KU7 A;  1RI7 A;  2DK8 A;  1MGT A;  3IKT A;  3R0A A;  1YLF A;  1LDK B;  2P7V B;  1XB4 A;  2MD5 A;  1BIB A;  1PUE E;  2M30 A;  1MDM B;  4XSZ F;  2VBY A;  1G3S A;  1IN4 A;  1OMI A;  3MCZ A;  2DTR A;  2OA4 A;  3RTR A;  1PDN C;  1FNN A;  2KIU A;  5K5Q A;  2ETH A;  2VC1 A;  2GZW A;  1IF1 A;  2VC0 A;  4R1H A;  4IXA A;  3VFZ A;  3MZY A;  3ML6 A;  1HW1 A;  1F5T A;  1BJA A;  2KKO A;  4N0B A;  3GFM A;  4UVC A;  2M45 A;  4EJT A;  2D45 A;  5L3B A;  3GYH X;  2A69 F;  4KN7 X;  3ROU A;  5CVR A;  5HDG A;  1SFX A;  4I09 A;  1QZZ A;  5HS9 A;  3TOA A;  2WWY A;  3I53 A;  1U2W A;  5FD5 A;  3TQN A;  2FEZ A;  4AD9 A;  4U7B A;  1K78 A;  3HHG A;  1MJA A;  3TKY A;  2QQA A;  4AIJ A;  2CQK A;  4Y15 A;  4QLC U;  2QWW A;  3K1N A;  2YX7 A;  1OPC A;  5CLS A;  1IXS B;  1YTY A;  1BI0 A;  5JR3 A;  1WKM A;  3WOD F;  2XV4 S;  1TTY A;  3CUQ B;  3F6O A;  4PGH A;  2GAU A;  5IT3 A;  1JXS A;  1LVA A;  1Z9C A;  1MJ9 A;  1EH8 A;  5BPD A;  2ADU A;  1B9N A;  4XLN F;  4BAY A;  5FLX Z;  3LQQ A;  2VOO A;  4ZYH A;  2C6Y A;  3C18 A;  5J6X A;  4EGY A;  3IRR A;  4HF0 A;  3LA2 A;  5E8G A;  1J59 A;  1ON2 A;  4A0Y A;  4MEY F;  2CGP A;  4OIP F;  3BDD A;  2F5C A;  1B59 A;  2H6B A;  3K2Z A;  1DP7 P;  4XLP F;  1ZG1 A;  3EQL F;  1QNT A;  2FRH A;  3MEX A;  4L18 B;  5LHI A;  1YQA A;  4PDK A;  4CHU A;  4DQ2 A;  1T2K A;  1R58 A;  2ISZ A;  2PMU A;  1XCV A;  4N9I A;  4GXO A;  3TO6 A;  3I58 A;  2V9V A;  2PQ8 A;  2FOK A;  1WSU A;  3WGG A;  5ILS A;  3F8F A;  3O2P E;  2IJL A;  2XKO A;  5BQT A;  1TW3 A;  1CF7 A;  5BMZ A;  4RAY A;  3KP3 A;  1FT9 A;  5D5U B;  1TQI A;  2EV5 A;  1QQI A;  1WQ2 A;  1KQ0 A;  5AIP A;  3G3Z A;  3ZMZ A;  4I0A A;  3N97 A;  1UCR A;  5CYV A;  5FLX K;  4RGR A;  1S7O A;  1Z91 A;  4A6E A;  2W57 A;  5ICF A;  4LG0 A;  5LLQ A;  3KLN A;  3IKV A;  4IJA A;  1ULY A;  4GCV A;  5K5R A;  4S04 A;  3DF8 A;  1R00 A;  4UVA A;  3EYI A;  2PLY A;  3JTH A;  3Q5F A;  2XRO A;  4L9J A;  3FZV A;  1FSH A;  4ESJ A;  2DBB A;  4N9H A;  2VBX A;  3GX4 X;  2VXZ A;  4BNC A;  4YFX F;  1F9N A;  2W24 A;  3CO6 C;  2P5V A;  3SZT A;  3ECH A;  3JSP A;  3KET A;  1GXP A;  1F1Z A;  2EFO A;  5TJJ A;  2NRA C;  1IN5 A;  3F8N A;  2ZNY A;  1R23 A;  2V1D A;  4XRF A;  2EFW A;  3IHU A;  3I59 B;  4NB5 A;  3F8C A;  2Y75 A;  2ZNZ A;  3QPH A;  2ZFW A;  1UST A;  2WV0 A;  4HYE A;  2YU3 A;  4CYD A;  3SQN A;  5LHG A;  4YIF A;  4RB2 C;  3FXU A;  4WXD A;  1L0O C;  2XAH A;  3I54 A;  3JTG A;  2PBI A;  3R4K A;  4DNC A;  3HTS B;  2EK5 A;  2YSR A;  2ZXJ A;  5IT9 K;  3RJP A;  1QGP A;  3RIR A;  3RDI A;  4LD5 A;  1ZRD A;  2DK5 A;  4HBL A;  1RIO H;  1HSJ A;  4EQQ A;  4B09 A;  4GO1 A;  1OYW A;  1WI9 A;  2CSO A;  1IN6 A;  3E6B A;  1FX7 A;  3PQK A;  4ZZL A;  2XAS A;  1BIA A;  3HRU A;  4GYI A;  4RS8 A;  3ZPL A;  3ULQ B;  3KP4 A;  1G3T A;  3L9F A;  4WXC A;  2YR2 A;  3P9I A;  2A07 F;  1K7A A;  4OU0 A;  2IP2 A;  1P6R A;  4HDU A;  1YFH A;  3HYI A;  2OQR A;  3ECO A;  3WGH A;  2D2W A;  2G9W A;  4ETS A;  1SMY F;  3MWM A;  1MD0 A;  4EJU A;  4IRG A;  1DDN A;  5LGU A;  1FLI A;  3WGI A;  2MLK A;  5FO5 A;  1IUY A;  2GA2 A;  3D5L A;  4L9V A;  2R7D A;  4CO8 A;  4UV9 A;  2RC4 A;  2ELH A;  1XSD A;  5LRS A;  4EJW A;  2A3S A;  3C3W A;  4G94 A;  3WU0 A;  5ICE A;  2R3S A;  1ZRE A;  2EB7 A;  3HSR A;  5KK1 A;  3FMQ A;  4HW0 A;  2DW4 A;  5AIQ A;  3J81 Z;  4CZZ A;  1KA8 A;  1J9I A;  5HS7 A;  3ISP A;  3JSO A;  3ZMV A;  1MDM A;  1USS A;  4IRH A;  1ZRC A;  1GXQ A;  3JAM Z;  4WX9 A;  1TNS A;  2IPQ X;  5FD6 A;  3NEU A;  4ASN A;  4EM2 A;  2AS5 F;  2Y0M A;  4BYY A;  5DYM A;  2RNJ A;  4IHT A;  3ZQ7 A;  1QBJ A;  3MFK A;  4CXF A;  5CJ9 A;  3W6J B;  2PI0 A;  4ENK A;  3DPL C;  1S29 A;  2BYV E;  3KCC A;  4MQV A;  1YW9 A;  2MLG A;  1TLH B;  3EET A;  4KIC A;  4ENN A;  2FA5 A;  2ESN A;  1LEA A;  4Y13 A;  1WWX A;  4ON0 A;  3HHH A;  2KJB A;  4Z2Y A;  3TO7 A;  3GLX A;  5DV5 A;  4M6Y A;  3LWF A;  4HOB A;  5EEG A;  3DXJ F;  3WTY C;  2GIV A;  1W5S A;  4NHJ A;  2W85 A;  1E17 A;  2QEN A;  3BJ6 A;  3J81 K;  1IW7 F;  5D5X B;  4KUM A;  1MJB A;  2MH9 A;  3GZ5 A;  2G7U A;  1KGS A;  3CUQ A;  4PCQ A;  1TQM A;  3FM5 A;  2GXB A;  2ZME B;  4FT8 A;  2DFI A;  1YIO A;  2IVM A;  3T8R A;  4R8H A;  2HYF A;  2XRN A;  2X4H A;  2XGX A;  5F64 A;  4I02 A;  3T5X A;  3ZMU A;  4HLX A;  3KEO A;  1XSV A;  3TGN A;  1P92 A;  2JSC A;  2DQL A;  2AXL A;  1F4K A;  4KNY A;  3VB2 A;  4MGR A;  4LFU A;  4ZYD A;  3FWE A;  3W6K B;  3COA C;  3TDZ C;  5HLH A;  1D3Y A;  1O7F A;  4HF2 A;  3HSF A;  1FBQ A;  3E6D A;  2A6H F;  2HFH A;  2KRF A;  3GW2 A;  2DAO A;  1UB9 A;  2GA1 A;  2JPC A;  4H0E A;  1KQ9 A;  3GFI A;  3M1E A;  4Y17 A;  2O8X A;  4U88 A;  2HEO A;  3QP6 A;  2HGC A;  2IT0 A;  3QU3 A;  4IF4 A;  1IRG A;  1SD5 A;  2P6T A;  5D8K B;  1SD4 A;  2HTS A;  4IPA A;  1ZYR F;  3WG9 A;  2LF7 A;  3CDH A;  3V7C A;  1BN5 A;  4O5V A;  3BJO A;  2F5F A;  1ONV A;  4G9Y A;  5TRD A;  4HAM A;  5EEH A;  1AWC A;  4HF1 A;  2DU9 A;  2QQ9 A;  4A0X A;  2PG4 A;  4BXU A;  5JVT A;  2NNY A;  3F8B A;  1W7P B;  2QQB A;  4LK1 F;  2VE9 A;  2NAZ A;  2VBZ A;  3SFZ A;  3RI4 A;  2XAQ A;  3T1B A;  1K6O A;  3DEU A;  4CGZ A;  2Q0O A;  3M9A A;  4ZYE A;  2OBP A;  2VOD A;  1T0F A;  2HKX A;  1W5T A;  4R79 A;  4Q48 A;  2LNB A;  4ZZD A;  1W7P D;  2QVO A;  4HX4 A;  3E6M A;  2Y48 A;  2HQR A;  1I1S A;  3L2C A;  1XDS A;  2CO5 A;  1SAX A;  2ZO4 A;  3FXR A;  3QRF F;  1WRJ A;  3E5U A;  2RQP A;  4M6X A;  1BBY A;  3ZMD A;  3GF2 A;  3FMS A;  5D8L B;  2NS0 A;  4A2U A;  3U2R A;  2GXG A;  1ZLK A;  2L3D A;  1G3Y A;  3R6S A;  4L9T A;  4MHG A;  3I59 A;  1U5T C;  1PP8 F;  5L3C A;  2K4J A;  2ZKZ A;  3ELK A;  3M8F A;  4HQE A;  1R5H A;  1U5T B;  4KT5 C;  2XKP A;  1ZGA A;  3WTW C;  1RNL A;  4EM0 B;  3IRQ A;  2L4A A;  2QM3 A;  4AVP A;  4EJO A;  3HOT A;  1XGM A;  2KIM A;  3DPT A;  5JI6 A;  2P4W A;  3U1D A;  3B73 A;  4YII A;  2VN2 A;  3MZH A;  4XSX F;  4MTE A;  1FYL A;  2LKP A;  5FB2 A;  1UHM A;  3I71 A;  2E1N A;  2BE5 F;  5HOO A;  5E1Z B;  3J7A O;  2HR3 A;  1OKR A;  3GO5 A;  2FQ3 A;  4HQM A;  5H20 A;  2VT2 A;  2HZT A;  1H9T A;  4EJV A;  1FYK A;  3E5X A;  4KN4 X;  3OOP A;  2V79 A;  2RVC A;  3R61 A;  4QWQ A;  1O57 A;  2D1V A;  5DD8 A;  5CVV A;  3V8K A;  1S8N A;  5FGM A;  1JGS A;  5F1R A;  3RKY A;  3C1D A;  1O3R A;  2P6S A;  3ZP5 A;  4OMZ A;  3F23 A;  2STW A;  1R22 A;  1HW2 A;  3ZN1 A;  4Q47 A;  1S3J A;  5CVJ A;  3OV8 A;  4I0B A;  2EFQ A;  4OIQ F;  3WTZ A;  1LDD A;  4A5N A;  3DFG A;  1REP C;  1Z6T A;  5J8F A;  1FBU A;  2XAF A;  1P4A A;  3HOS A;  1KU2 A;  4LLN A;  5D6E A;  5HDN A;  3E3V A;  3V7R A;  3HTU A;  4UUV A;  1B4A A;  2OD5 A;  1J2X A;  1RUO A;  2STT A;  2OZU A;  1HKQ A;  2IA2 A;  4RGU A;  4LB5 A;  5JHU A;  3KP7 A;  1ZG3 A;  3V4G A;  1T6S A;  1IXR C;  2P5L C;  2LDU A;  5DUK A;  4A5M A;  4EMS A;  2ESH A;  2VON A;  4AWX B;  5A2Q Z;  4U7D A;  2XIG A;  5H6R A;  4HA8 A;  4FHT A;  2G7H A;  2L01 A;  2VT3 A;  1U3E M;  2PMH A;  2FBH A;  2BBY A;  1ZLJ A;  2UZK A;  1R1T A;  2LSO A;  3K9T A;  5E8I A;  1JHH A;  4KIG A;  3PQJ A;  3DQV C;  1UFM A;  1B9M A;  5E17 F;  2QUF A;  3NRV A;  1G4D A;  1D8K A;  1C0W A;  1ZN2 A;  2EV6 A;  5LEJ A;  3LAJ A;  1CF7 B;  4HLY A;  3GFL A;  2COM A;  2PFB A;  2VOP A;  3S2W A;  2EFP A;  3GWZ A;  1FY7 A;  4LK0 F;  2IRF G;  3KLO A;  3V7S A;  1PP7 U;  3K1P A;  1BI3 A;  1KYW A;  1U8R A;  3LQR A;  5LEK A;  1XGN A;  2JPB A;  4OIO F;  2HYG D;  3H92 A;  4LGW A;  2XVC A;  3IWZ A;  4EVI A;  1R1U A;  3LFK A;  5D6F A;  1JHF A;  1H9G A;  1FBS A;  3ERE D;  3QOP A;  5CVU A;  2H27 A;  1LJ9 A;  3HRM A;  5LHH A;  3G73 A;  3C7J A;  3KE2 A;  1HKS A;  2HWV A;  1KU3 A;  5L3F A;  2H94 A;  1G6N A;  2H09 A;  3L7W A;  3BRO A;  1K79 A;  3M8E A;  1D5V A;  1V3F A;  2DLL A;  4P5O A;  2OQG A;  1LEB A;  4IHS A;  4M71 A;  2CWE A;  5DD4 A;  4KIF A;  4BHP A;  1BM9 A;  4EGZ A;  4E70 A;  3FXQ A;  1P4W A;  2Q8K A;  4PGG A;  4F7Z A;  4AIK A;  4ENJ A;  4OIN F;  5DUI A;  2BEO A;  4YG2 F;  2LF8 A;  2VE8 A;  3T8T A;  4A0Z A;  2HS5 A;  1W7P A;  1SFU A;  3BOQ A;  4JQF A;  1XMK A;  5CVI A;  3WU1 B;  1GVJ A;  2MH2 A;  5HDK A;  1XD7 A;  3HRT A;  2FE3 A;  5BPI A;  1A04 A;  3L00 A;  2ISY A;  1Z1D A;  2Z9O A;  5FFX A;  1FYM A;  3F3X A;  2PJP A;  1TBX A;  4IVN A;  1SMT A;  4I7H A;  3RKW A;  1LB2 A;  5ILV A;  4U0Y A;  3MQ0 A;  1FC3 A;  2Z33 A;  1I5Z A;  5DCM B;  4KMU X;  2Z3Y A;  5E20 A;  1EH6 A;  2TDX A;  1J75 A;  4M9Z A;  3JAM K;  3R60 A;  4RAZ A;  3GFJ A;  3IL2 A;  3V8J A;  5HS8 A;  3VOE A;  1I27 A;  2M5W A;  2KIF A;  2HTJ A;  4RGX A;  2V1U A;  5HVQ C;  1QZY A;  3Q9S A;  1HBX G;  1U5T A;  2F5D A;  1IN8 A;  2L54 A;  4L5J A;  2CG4 A;  5DEQ A;  2QBY B;  3GUD A;  1EV7 A;  2F2E A;  4P55 A;  1YO5 C;  1STZ A;  4L0Y B;  3PFI A;  5L3E A;  4HX8 A;  1G3W A;  1B6A A;  2J5P A;  2K86 A;  4A12 A;  4ESB A;  3BY6 A;  4BH9 A;  3VEP A;  2FSW A;  1JE8 A;  1J5Y A;  4YFN F;  2UXX A;  4XBF A;  3SZP A;  4BHC A;  4Q5S F;  2K27 A;  1MZB A;  3HIF A;  3F21 A;  2JZY A;  2DT5 A;  2FNP A;  1I1G A;  3P9K A;  2M87 A;  3HUG A;  2RKH A;  2DPU A;  1IN7 A;  6PAX A;  1T98 A;  1R5G A;  4LMY A;  5ICC A;  1HXD A;  3DV8 A;  1YS7 A;  1ZRF A;  1FSE A;  4P96 A;  4EM1 A;  1KQ8 A;  3AAF A;  1Y0U A;  5E1W A;  1NHA A;  2V1X A;  2Z5U A;  3N4M A;  1FP2 A;  3SHF A;  5HLG A;  5ED4 A;  4LLG F;  3KP5 A;  2XAJ A;  4EV0 A;  4WK8 F;  2IA0 A;  1TW2 A;  3QAH A;  4L5I A;  1ZHF A;  3EUH A;  3I64 A;  2HKO A;  4IRI A;  4Q4Z F;  2D1H A;  3K69 A;  4MTD A;  3H3Z A;  3F72 A;  2O6G E;  2E1C A;  4G6D A;  4OMY A;  1GHC A;  2PN6 A;  4AIH A;  1XMA A;  2M8E A;  3LAP A;  1O3S A;  2P5K A;  2J5O A;  1VTN C;  5H6Q A;  2QZ8 A;  3F8M A;  2X0L A;  2QYO A;  2RN7 A;  1XN7 A;  3EDP A;  1R1V A;  1LDJ A;  3QU6 A;  2OU2 A;  4G8X A;  5J8C A;  3CUQ C;  3IC7 A;  1EH7 A;  3FMR A;  1J7K A;  4FX0 A;  4P9F A;  2Z99 A;  3RKX A;  2JT1 A;  3VOD A;  2B0L A;  1D8J A;  1FZP B;  5D5V B;  1YYV A;  4YFK F;  3CUO A;  1HST A;  4RB0 A;  3LA3 A;  4U0W A;  1AOY A;  5FFZ A;  2FBK A;  1U78 A;  1HKT A;  1Q1H A;  2EA4 A;  1LQ1 A;  3RYP A;  3B02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...