1VTNC

Co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
b'HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*GP*AP*CP*TP*AP*AP*GP*TP*CP*AP*AP*CP*C)-3')
molecule tags Transcription/dna
source organism Homo sapiens
publication title Co-Crystal Structure of the HNF-3/Fork Head DNA-Recognition Motif Resembles Histone H5
pubmed doi rcsb
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1vtnC00
4GGGA 3K0LA 2XKPA 2IW5A 4LD5A 2VT2A 3BWGA 3SFZA 2D45A 4ETSA 4QWQA 2EJRA 2M45A 1OPCA 4BAYA 4HF0A 4FT8A 3I59B 2P5VA 2QQAA 4XSXF 4Y15A 2DAOA 2PQ8A 3GXOA 2EFNA 3JAMZ 2D1VA 2ADUA 2XASA 1FYMA 3DF8A 3Q5FA 2JSCA 4ON0A 2RGVA 3F3XA 4AIHA 4RAZA 3K1PA 2L01A 4HX7A 3SZTA 1QZZA 5HDNA 1XMKA 1B59A 3CUQA 1OR7A 1Q1HA 5ICFA 2ZJ2A 4RGSA 2QYOA 5DV5A 4HV5A 3HUGA 4UVCA 1V3FA 1CGPA 4IPAA 2DW4A 3BPXA 3GYHX 4UVAA 2O3FA 5H6RA 1SAXA 4IRHA 4JK1X 5EEHA 4A2UA 3SQNA 2PMHA 2W85A 3HRUA 4IHTA 2ZO4A 5FFXA 2EA4A 5E17F 5HDKA 2HKXA 4LK1F 3G73A 2UXNA 1S8NA 1I27A 3GWZA 3ECOA 3RPUA 1XB4A 4CDGA 5LHIA 4ZH4F 2R7DA 2XAHA 4BHBA 1U5TB 4WWCA 3I4PA 1D5VA 3WGHA 4L9VA 4OIOF 5L3GA 2VBXA 3LA3A 3TOAA 2ELHA 1I1GA 2OAZA 4L9TA 2A6EF 4G7ZF 2GA1A 4XLPF 4L0ZB 2KIUA 5E1WA 4RB2C 1YS6A 5BQTA 1BM9A 1QQIA 1RUOA 3K1MA 3RI4A 3F8BA 3RTRA 2MBFA 4B8XA 1TQIA 3IWZA 1IN5A 1TQMA 1BIBA 2NNNA 3QPHA 5HLHA 2RVCA 4O5VA 4LLGF 2AXLA 1FBQA 1G3YA 2XHKA 1BI1A 5FGMA 4EM1A 3BZ6A 3WTSC 5K5QA 3J80K 3EDPA 3J80Z 1O7LA 4D0PA 2EK5A 2F2EA 2H27A 2IVMA 4EM2A 3MFKA 2HS5A 3ZMZA 1ZYRF 2ZXJA 2DPUA 4EMSA 3RPQA 2DT5A 4G7OF 4HV6A 3TDZC 4S05A 2IT0A 2YR2A 5CVVA 2CWEA 5DYMA 1YIOA 2K86A 2EV5A 2HQRA 2XAFA 3GZ5A 2FXAA 5AIPA 1CF7B 2GA2A 2ISYA 5JVTA 1MZBA 3M9AA 4LJZF 1ZHFA 3HSEA 3L2CA 4EJOA 1MJ9A 4JBAA 2L4MA 3RKYA 4EM0B 2Y75A 1R5HA 2EWNA 3E5QA 5H20A 5CVIA 3CO6C 3KZZA 5D6FA 1S7OA 4U0YA 3J81K 4AIJA 4LG0A 1YS7A 3SZPA 3MEXA 3WTWC 2ISZA 3LQQA 1K78A 3FMRA 1U8RA 1FP2A 3M8EA 1B4AA 1FP1D 3WE3A 4CO8A 3VOEA 4MQ9F 2QQ9A 2M8EA 4WCGA 1KYWA 3GO5A 3GVAA 5JFRA 2XKOA 2FNPA 1VTNC 5ED4A 3TQNA 1L3LA 1HKQA 4A5MA 3TKYA 4PDKA 2FMLA 5LBQA 2XROA 1QPMA 3CUQC 4Q4ZF 1R36A 1IXRC 3WU1B 4RB3C 3D0SA 1QNTA 1J2XA 3Q9VA 3QP5A 3HOSA 5BS6A 4LG0B 4OIRF 2PN6A 3VFZA 4LMYA 2UZKA 4OMYA 4A6DA 2VE8A 4XLNF 1GXPA 2F5EA 2OZUA 2DQLA 2R3SA 2Z99A 3JSPA 1FPQA 2Z5UA 4HF1A 1XCVA 2WTEA 4GCVA 2QM3A 1H9TA 2CQKA 3I58A 1X3UA 1XSXA 2O0YA 1WRJA 5ERIA 5E8GA 5DD4A 4CXFA 4HOBA 5L3DA 1BBYA 2H09A 3M1EA 2IRFG 1D8JA 4Q5SF 3RKWA 1IXSB 3V8KA 2P8TA 4M73A 1RUNA 3R0JA 4RAYA 3SHFA 4ZYHA 2HOEA 1YW7A 2WV0A 1XCBA 3FMQA 1ON2A 1T39A 1LB2A 3I0TA 4UV8A 2P7VB 2VODA 5E8IA 2FSWA 4HDVA 2VBYA 3ZMSA 5H6QA 5HS9A 2E1NA 1YG2A 2DTRA 3FMSA 4PGHA 2YX4A 4PGGA 2EV6A 3KLOA 4ZZLA 2ZKZA 4K2EA 5CVJA 3WTYC 3FHZA 1JE8A 1JHHA 2UXXA 2ESNA 1TLHB 3QU6A 4ASNA 1WI9A 1KQ8A 3ABTA 2ZMEA 1EV7A 3C3WA 3W6KB 3NEUA 1JXSA 3CUOA 1XGSA 2CG4A 2LF7A 1O3TA 3ML6A 1PP7U 1R7JA 1TBXA 2BEOA 1O3QA 3K9TA 2LSOA 2B0LA 4CHUA 1G4DA 1T2KA 3LSTA 3ABUA 3ISPA 3RJPA 1ZG3A 2PI0A 1YTYA 4U7DA 1HBXG 2RQPA 1DP7P 3LA7A 2E7XA 4YG2F 2DLLA 1C0WA 3F22A 2P6TA 1F9NA 1Z6TA 2TDXA 4NB5A 1IN8A 5A2QK 1UFMA 1FWZA 1HKSA 1KYZA 3HYIA 1TTYA 4XRFA 2OQGA 1ZGJA 3P9IA 1SMTA 2JPCA 3VEPA 1U6GA 4P55A 3O3KA 3WGGA 3KP5A 1RI7A 4BHPA 3P9CA 2IA0A 1Z05A 2RDPA 1MDMB 4GO1A 3RIRA 4ESBA 1J75A 2OZ6A 1T38A 1ZH5A 4OOIA 4I09A 5LHHA 1KQ0A 1R23A 4RB0A 4KN4X 2V9VA 2H6BA 1DDNA 4G94A 2BBYA 4HX8A 1BC8C 2R7FA 4ESFA 4O3MA 3NRVA 4ENKA 2EA2A 3CUQB 4KMUX 4HLYA 4RB1A 2ZMEB 1USSA 4IRGA 1S29A 2Z9OA 2GIVA 3IL2A 3K1NA 1WWXA 1LJ9A 4IXAA 4KIGA 4MTDA 3E6MA 3QU3A 3MCZA 1Z9CA 2YPRA 4EGYA 3F6VA 5CYVA 1ZG1A 1J9IA 3U9GA 3F8CA 3REOA 3ZP5A 5EEGA 3F72A 2W57A 2M30A 1ZN2A 3GLXA 1JHFA 5L3FA 4WXDA 3ZMTA 4ENMA 1XN7A 2P5KA 5LGNA 3V4GA 3F6OA 1SFXA 4I7HA 3I5UA 4UHTA 4H0EA 2IP2A 2FE3A 3AAFA 2V1DA 3FXQA 4YIFA 5D4RA 1RIOH 2XGXA 1R1VA 3QPTA 2A68F 4YIIA 4M72A 3BROA 2BGCA 4G6QA 1Z1DA 3ELKA 1IN6A 5ICEA 1YYVA 2CW0F 1WKMA 4WF2A 5J8FA 4M71A 3DP7A 5FB2A 4LFUA 1T0FA 3HOTA 2HDCA 1YLFA 3E5XA 1SD7A 3N4MA 2XIGA 4GYIA 1I6XA 3IRQA 1TQPA 5AIQA 2H94A 3QRFF 3JW4A 1NHAA 3C1DA 3GZ6A 2Z33A 4AD9A 2P5LC 3V7CA 5E1ZB 3WGIA 3MZYA 4EQQA 3KETA 3M8FA 1E17A 3DPTA 1LDDA 3TO6A 4ZYEA 5IT9K 2STWA 1UCRA 5DCFA 1IAWA 2IA2A 4S04A 1QGPA 1S7AA 2LKPA 3DXJF 3SXYA 2HYFA 2PLYA 3O2PE 1Y0UA 2OBPA 2BYVE 1STZA 4CZZA 4OMZA 4GXOA 3HRSA 2W25A 3KP4A 2EFWA 2EFQA 1OYIA 2PFBA 4BH9A 4EV0A 3GFJA 1W5TA 1LEAA 4FX0A 1ZRCA 2J5PA 1MJBA 1UB9A 3BJAA 2IJLA 3RYRA 2A6HF 1LQ1A 3KLNA 2FA5A 1YQAA 2ACJA 4F7ZA 2QWWA 5IT9Z 3ZN0A 3DEUA 3H3UA 1R58A 3KP7A 1TW3A 2K02A 3MZHA 1U2WA 4LB6B 4HF2A 1MJAA 2DO7A 3I53A 4IHSA 2GXGA 1UHWA 3IHUA 1HQCA 4O6JA 3QOPA 4CYDA 2DBBA 2Z3YA 2K27A 3T8RA 1H0MA 2GXBA 4LGWA 3PQKA 5BPIA 5BOXA 2XAJA 4WXCA 1K7AA 4BQAA 1FYKA 1ZAOA 2RV8A 4YFXF 5F1RA 2AS5F 2LNBA 2E1CA 4M9ZA 3BJ6A 2D1HA 4EVIA 1BIAA 2A3SA 3GF2A 4OU0A 2ZCWA 4L0YB 1PUEE 2HYGD 4HZFA 1ZRFA 1YW9A 1W5SA 1UHMA 3I59A 2XAGA 3WODF 2W24A 2XUBA 3KZYA 3U1DA 4MGRA 2HQNA 2NRAC 3HHGA 4U0WA 4HW0A 2LDUA 4MEYF 1F1ZA 5HS7A 1FNNA 1QZYA 1OYWA 5FD6A 1J0RA 2XRNA 2QBYA 1WSUA 4HDUA 3ZMVA 2CFXA 2LF8A 3CTAA 1S3JA 2UWMA 1HKTA 3ZPLA 2VOOA 3F21A 5DCMA 1ZARA 4KIBA 4Q48A 3IKTA 1BOAA 2PG4A 2FOKA 2JT1A 4NQWA 1GHCA 4I02A 1AOYA 1IZ1A 3R61A 4MQVA 5J6XA 3TOBA 2ZFWA 3IC7A 2VC1A 5DD8A 3WG9A 2MC3A 3GFLA 4WX9A 2VC0A 3BPVA 5L3CA 1IXCA 4AVPA 3LAPA 3GW2A 3J81Z 1REPC 1KGSA 1FSHA 3BP8A 3KP6A 4ZZDA 4P96A 1O7FA 4RGRA 4FX4A 3L09A 4L5IA 4G7HF 1W7PB 2M87A 1E2XA 1GXQA 3JTGA 2JTVA 4L5JA 2QUFA 4IVNA 2OA4A 1SD6A 2ZBKA 1EH6A 4UUVA 3GFMA 1P2FA 3V7SA 1PDNC 3L7WA 2NAZA 4U0VA 3JSOA 3H92A 1ZRDA 4LB5A 2FBHA 3R0AA 5D5WB 1T98A 2KRFA 4GYGA 3F8FA 4KUMA 3W6JB 1ZGAA 5K5RA 1SD5A 3L00A 5L3EA 1YO5C 2O03A 3BDDA 4PZJA 4M9XA 1LNWA 2FRHA 2DPDA 1ZLJA 4KYWA 5LRSA 2A61A 4WK8F 2RKHA 3WTUC 1IUYA 3IRRA 4RGUA 5BMZA 1B6AA 5ICGA 4FHTA 1FZPB 4R1HA 2HTSA 1FBUA 1U5TC 4G6DA 5E20A 5DDGA 2G7HA 1SD4A 3GEZA 1R1UA 2J5OA 4UXNA 2P6SA 3HTUA 3WTZA 1K6OA 3DKWA 1U3EM 3ZQ7A 5HDGA 1XDSA 3CDHA 3R60A 1YFHA 5ILUA 3M7GA 3GFIA 1B9MA 1IN7A 3MWMA 4M6XA 4EJUA 1Z7UA 2P4WA 2XV4S 1G3WA 1B1BA 3KE2A 4I2OA 4Z2YA 1HW2A 3KP3A 4OIQF 4UNOA 5D4SA 5LEJA 3F23A 1ZREA 4Y13A 2GWRA 1ZG5A 4YFKF 3WTTC 3S2WA 2O6GE 3HHHA 1F4KA 2RC4A 2JZYA 3DFGA 2QVOA 4N0BA 3CLOA 2IPQX 1I5ZA 2JRTA 2G9WA 4LLLA 5D8LB 4LK0F 3GX4X 5LGTA 1Z6RA 5HS8A 1IRFA 2GQQA 4NHJA 2NNYA 1D3YA 2HGCA 1IRGA 2NS0A 4RS8A 2ESHA 5KVRA 4HA8A 1I1SA 5DCMB 4CICA 3ERED 1KU3A 3IWFA 3WTVC 4HYEA 3H3ZA 1W4MA 1W7PD 2RN7A 4EJWA 2VOPA 1WQ2A 1TNSA 5BPDA 1RNLA 3E6BA 2L02A 3GUDA 1HXDA 1XGNA 2PBIA 2WWYA 5ILVA 3FX3A 5D5XB 4P9UA 1XSDA 2DQRA 2KKOA 5AONA 4KNYA 4KT5C 2CGPA 1LVAA 1XMAA 3FZVA 3ZMUA 2DK5A 1IN4A 3TO9A 1FLIA 3LA2A 1GVJA 1IW7F 4HBLA 3T1BA 5CVRA 3RDIA 2G7UA 3OOPA 4I98B 1P4WA 2K4BA 2KJBA 2V1XA 3LAJA 2HTJA 3DV8A 1U5TA 3QP6A 4ZYGA 1BI3A 3HIFA 2FQ3A 1PP8F 1O3SA 1FX7A 3LQRA 2HZTA 3C7JA 5LGUA 5HLIA 1YW8A 1Z91A 2M5WA 1K79A 2PMUA 3F8NA 5HVQC 4JQFA 3V8LA 4EJTA 4ENNA 1FYLA 1MKMA 3K2ZA 4E70A 5D5UB 3PFIA 3KEQA 5JR3A 2OU2A 4KIFA 2X0LA 4BXUA 1J7KA 4IF4A 2A69F 1KU7A 3RKXA 2EV0A 4HQEA 1LDJA 4KA4A 5TJJA 3TO7A 1DPUA 4G9YA 1HSTA 4UVBA 4M6YA 2O61A 1BN5A 3HSFA 4ZYDA 4A12A 4A0XA 5LHGA 2KIFA 2K7LA 3N97A 4KMFA 2MA3A 2KIMA 3P9KA 1MGTA 1D8KA 4P9FA 1BJAA 2XVCA 4A6EA 3FWEA 3JAMK 3CO7C 3COAC 2HEOA 4AIKA 1KQ9A 2FBIA 1RZ4A 1SFEA 1MDMA 4UV9A 1JGSA 4YFNF 1O3RA 4I0AA 1FBSA 3JTHA 4IRIA 1R00A 2V1UA 2CSOA 4N9IA 3HTSB 3D5LA 2MD5A 1MD0A 4EGZA 3LFKA 3J7AO 4L18B 1HSJA 1XSVA 1R1TA 5F64A 2MLGA 2Q2EA 4QLCU 1H9GA 4PCQA 3E3VA 2MLKA 5FFZA 1R22A 1G6NA 4LLNA 4HAMA 3ULQB 3E6DA 1J5YA 2FNAA 2H6CA 1QBJA 1G3SA 1FOKA 5IT3A 2YSRA 1BI0A 1BC7C 3ZN1A 4XSZF 1ONVA 3T8TA 2VT3A 5LEKA 3I64A 2JPBA 3LWFA 1SFUA 3EQLF 3E5UA 4BHCA 3BOQA 1KA8A 1AWCA 4KFCA 1XD7A 3FXRA 3K69A 2V79A 3FM5A 1FC3A 4AWXB 2E7WA 5TRDA 3KCCA 2L54A 3FF5A 3V7RA 2VXZA 1XGMA 5ICCA 1J59A 4MTEA 2HWVA 4BYYA 3V8JA 1EH7A 1LDKB 2DI3A 4L9NA 4U88A 3ROUA 3B02A 2CYYA 1B9NA 5DUKA 1A04A 3RYPA 2M1BA 5FD5A 2FU4A 5CJ9A 4OIPF 4MNUA 2VBZA 3KFWX 4RGXA 5J8CA 3DPLC 2C6YA 1KU2A 4OINF 1P4AA 2A5YB 5A2QZ 3T0YA 2VBWA 2X4HA 5DUIA 5K5OA 2FMYA 5CLSA 3BJOA 4M74A 4R8HA 4I0BA 4G8XA 5D5VB 4N9HA 4KN7X 4B09A 1O57A 1USTA 2HKOA 1TW2A 1LEBA 2F5DA 5ILSA 1TNTA 2YX7A 2L4AA 3B73A 1FY7A 2FBKA 4EJVA 3HSRA 3HRMA 2W84A 1FT9A 1SMYF 3KEOA 3MQ0A 1T6SA 2O8XA 3DQVC 3CJNA 5HLGA 4IJAA 3WTXC 3OV8A 3BY6A 2WC2A 3E97A 5LLQA 3F8MA 4M9SA 6PAXA 2QQBA 3R4KA 1DUXC 1R5GA 1EH8A 2P7CB 4P5OA 2L3DA 2CO5A 3P7NA 5D6EA 4ESJA 1HW5A 2QBYB 2ZNZA 1CF7A 2DK8A 2GZWA 4XBFA 5KK1A 4WXHA 4MEXF 2BE5F 4HQMA 3E6CC 2QZ8A 1L0OC 4KICA 2EFPA 2K4JA 3TDUC 3I54A 1U78A 2HFHA 4KDPA 4TV7A 4L9JA 4HX4A 1G3TA 1OYYA 5F6FA 2Y0MA 2KJCA 3KP2A 2MH9A 4A5NA 2PJPA 3IKVA 4I01A 4BNCA 4Y17A 2ZNYA 3ZMDA 1DPRA 1ZLKA 5E18F 4A0ZA 2XAQA 3WE2A 5CVUA 1F5TA 3EYIA 3VODA 2RNJA 3MAJA 2EFOA 4CGZA 1ODDA 2BV6A 3NQOA 2OQRA 3QAHA 1V4RA 2F5FA 2STTA 2Q0OA 3TGNA 1OKRA 1P6RA 4R79A 1HW1A 5FLXZ 2IA1A 3C18A 3G3ZA 2FF4A 1ULYA 1BI2A 1IF1A 3I71A 3T5XA 2OD5A 3O6BB 1K78B 2COMA 2PEXA 4MHGA 2QENA 2QLZA 5L3BA 3L9FA 1FSEA 1S6LA 4DNCA 3HRTA 3FXUA 4Q47A 2F5CA 5HOOA 2NYXA 5JI6A 3R6SA 4HLXA 3VB2A 1KU9A 1OMIA 2FEZA 3FM3A 5K1YA 2ETHA 4A0YA 3EYYA 4DQ2A 1XGOA 5FO5A 1W7PA 2A07F 2D2WA 1ON1A 2MH2A 3U2RA 5FLXK 3EETA 2HR3A 5E1XA 2DU9A 2Y48A 3WU0A 1P92A 3PQJA 2DFIA 5DEQA 2VE9A 5JHUA 5D8KB 1P4XA 2VONA 1XDUA 3EUHA 2V6CA 2YU3A 3Q9SA 4U7BA 4ENJA 2VN2A 2GAUA 2EB7A 3ECHA 1QO0D 2Q8KA 5LRRA
chains in the Genus database with same CATH superfamily
2H1KA 4GGGA 4BE0A 1S7EA 3K0LA 2XKPA 2IW5A 4LD5A 2R0QC 2VT2A 3BWGA 3SFZA 5LD2C 4J00A 2D45A 3BZKA 4NDLA 4ETSA 9ANTA 1VQ4I 4IOCF 4QWQA 2EJRA 3AG3H 2M45A 4X0GA 1OPCA 2LFBA 2QA4I 1VQ6I 5EGOA 5HODA 1FTZA 2K3PA 4BAYA 1X58A 1TT0A 4RDUA 2GLOA 4HF0A 5IY5H 3W6VA 2NS8A 2XGCA 4CZCA 3Q3SA 5LFAA 2HI3A 4FT8A 2BVLA 5F08A 2L0KA 2NVXJ 3I59B 1MNMC 2P5VA 2QQAA 4XSXF 4Y15A 2DAOA 2PQ8A 3GXOA 2EFNA 1RC9A 3JAMZ 2D1VA 1KONA 1A6QA 1IDYA 2Z1DA 4M3BA 2ADUA 2XASA 4CSWA 1FYMA 2UV1A 3DF8A 2IXSA 4MFDA 2R7RA 4FQGA 3CQZJ 3Q5FA 2JSCA 3HB9A 2RGVA 4ON0A 1I6HJ 3F3XA 4LITA 4E7LA 2R5YB 4AIHA 2IGNA 4RAZA 3K1PA 2L01A 4FE7A 4HX7A 3SZTA 3OR1C 4CCKA 1QZZA 5KHDA 5HDNA 1ZGWA 4ZDLA 4ITVA 2X51A 1A36A 1XMKA 1B59A 2E2HJ 3BG5A 3CUQA 2Y0SN 1OR7A 1Q1HA 5ICFA 2ZJ2A 3VSLA 5F0FA 3PUBA 1E3PA 4RGSA 4F55A 2XB0X 2QYOA 5DV5A 4HV5A 2EILH 3BTIA 3HXLA 4FTHA 1MMNA 3HUGA 4UVCA 1V3FA 1CGPA 1NG7A 5B5EC 3FISA 4XM3A 4IPAA 2DW4A 3BPXA 3FK7A 2ZSHB 5EF6A 4DZJA 3GYHX 3M1CA 4UVAA 2GM4A 1MBHA 1U9OA 2OCCH 2O3FA 5H6RA 2HPMA 5CQGA 1SAXA 4IRHA 4JK1X 1MBKA 3HOXJ 2R93J 5EEHA 4A2UA 3SQNA 1F43A 2D5VA 3OMYA 2PMHA 4CUGA 2W85A 3HRUA 4IHTA 2ZO4A 1MMAA 1X4OA 2JN6A 5FFXA 2EA4A 3UR3C 5E17F 5HDKA 2HKXA 4LK1F 3G73A 2L2OA 2UXNA 3S15J 1S8NA 1I27A 3GWZA 4J01A 3ECOA 2X6YA 3RPUA 1JKRC 1XB4A 4CDGA 2E36A 5LHIA 5EGOB 4C30A 1B8IA 4AVZA 4ZH4F 3FBNB 1FIAA 4RMNA 1WJ5A 2R7DA 4C2UA 2XAHA 4BHBA 1U5TB 4WWCA 1MMDA 2VJIA 3I4PA 3SJMA 1D5VA 2WAQA 3OYJA 1VQMI 3BG6A 3WGHA 4L9VA 3TW6A 4OIOF 2VQGA 5L3GA 5C4JJ 2VBXA 4ZTFA 3LA3A 3TOAA 2ELHA 1GLNA 1I1GA 2OAZA 4L9TA 5M5WJ 2A6EF 4G7ZF 2GA1A 4XLPF 1UJ8A 1MMGA 4L0ZB 1WHUA 3FKIJ 4HNUA 2KIUA 5E1WA 1JKOC 2FJ1A 1JTXA 3IAS2 1XG1A 4RB2C 1YS6A 5BQTA 1BM9A 1QQIA 1RUOA 3K1MA 2Y69H 3RI4A 1YE9A 3F8BA 4GFBA 4YEJA 3RTRA 3K4MA 2MSYA 4G12A 2X1DA 2QSGX 2MBFA 1D1BA 4B8XA 1K83J 1TQIA 3IWZA 1IN5A 2FX0A 3CF2A 1ZKGA 3TEDA 1TQMA 1BIBA 2NNNA 2X85A 4RBOA 3QPHA 5HLHA 1FOWA 2RVCA 4ZTJA 4O5VA 4LLGF 1LFUP 4XN0A 1VQNI 1H8AC 2AXLA 2GXAA 1FBQA 4JX4A 1G3YA 2XHKA 1BI1A 1U0JA 5FGMA 4A93J 3MKLA 3BR5A 4EM1A 1I50J 4A3IJ 2CMPA 1SVLA 3BZ6A 1NK2P 3WTSC 2E1MC 4BBRJ 5E3OA 5K5QA 4BQQA 2WBMA 4PJMA 3J80K 3EDPA 3J80Z 1O7LA 2ZJRF 3BCBA 4D0PA 2EK5A 2F2EA 3BR1A 1HCRA 2H27A 2IVMA 4EM2A 3MFKA 5F0CA 1ZR4A 4GDFA 5IOZA 2HS5A 3ZMZA 4Y33A 1ZYRF 2ZXJA 2YU9J 5KAFC 2DPUA 4EMSA 2DJIA 3BQZA 1W0TA 3KPHA 1P9QC 3VYSB 4MO7A 3VWBA 3RPQA 2DT5A 4G7OF 4HV6A 3TDZC 2QKMB 4S05A 3ABKH 2NVQJ 2G0EA 2IT0A 1WH7A 2LOOA 2ECBA 2YR2A 1RESA 5CVVA 2CWEA 5DYMA 3ZOBA 2OC6A 1YIOA 2K86A 2EV5A 3SZGA 2HQRA 2HOAA 2ZC2A 2XAFA 2K9LA 2ID6A 3S2DJ 3GZ5A 1LPQA 2PX9A 1XTAA 2FXAA 2VKVA 5AIPA 1R9TJ 1CF7B 3L2UA 2GA2A 2ISYA 5EDNA 5JVTA 1MZBA 4BUPA 3M9AA 2N8GA 1NH3A 4LJZF 3ZQHA 2WAEA 1RR7A 1ZHFA 3HSEA 4Y7NJ 3L2CA 4EJOA 1TWCJ 1MJ9A 4JBAA 4L5EA 5IP9J 2L4MA 1I3QJ 3RKYA 3HKZA 4EM0B 2Y75A 4CCNA 1R5HA 2EWNA 3E5QA 2E2IJ 3K70C 3OYGA 3PSFA 5CVIA 5H20A 2L7ZA 1LFPA 2O7OA 4XQFA 3CO6C 4A3MJ 3KZZA 3CCSI 1B72B 4G6TB 2CUFA 3RCOA 3S3MA 5D6FA 1OQYA 3DLAA 3TW7A 4F52A 1S7OA 2DOAA 2EH3A 3NWSA 4U0YA 3J81K 5K7FA 4AIJA 4A3BJ 4LG0A 3W2WA 1YS7A 4E7ZA 5F0HA 3SZPA 3MEXA 5GTHC 3WTWC 2ISZA 3S3NA 1RR8C 3S1MJ 3ZGKA 2PMZA 1JGGA 3LQQA 3IV5A 1ETXA 1K78A 1D5YA 3FMRA 1U8RA 5M3FJ 2X6XA 1FP2A 1B4AA 1FP1D 3M8EA 5DS9A 2AQFA 3WE3A 4CO8A 3VOEA 4MQ9F 2QQ9A 2M8EA 4WCGA 1KYWA 3GO5A 4A3JJ 2VPLA 2EZHA 3GVAA 4DYRA 1VQ7I 3S2HJ 5JFRA 3ESWB 2XKOA 4AM3A 1FOYA 1ETOA 2FNPA 1JKPC 1APLC 1VTNC 5ED4A 3TQNA 1TL8A 1WJCA 3CD6I 1L3LA 2A6TA 4H4KC 1HKQA 4NNJA 4A5MA 3TKYA 4PDKA 3ASOH 1PJRA 2CW8A 2FMLA 2BOLA 5LBQA 2DFHA 2XROA 1QPMA 1X2MA 3CUQC 4Q4ZF 1F36A 2O5RA 1R36A 1IXRC 5FKKA 2DA5A 3WU1B 4RB3C 3D0SA 2M34A 4I76A 3CCRI 1QNTA 1J2XA 3Q9VA 3QP5A 4YIRX 3HOSA 3BG7A 5BS6A 4LG0B 1FMWA 2XDVA 4OIRF 3CCVI 2DFEA 2PN6A 3VFZA 4LMYA 2QKLB 2UZKA 4OMYA 4A6DA 2VE8A 4XLNF 3H9GA 1GXPA 2F5EA 2OZUA 1ZTRA 3MD2A 2DQLA 2R3SA 1IRZA 2Z99A 5J1RA 3JSPA 1Z0XA 1FPQA 2Z5UA 2EPFA 2LRDA 1D0XA 4HF1A 1XCVA 2K40A 2Z2SB 3D1NI 2WTEA 4GCVA 3FXOA 2QM3A 1H9TA 3HOZJ 4D5FA 2H1LA 1BR1A 2CQKA 2I8DA 5E3MA 3I58A 1X3UA 2OF7A 2V1NA 1XSXA 1JUPA 2O0YA 2DDAA 5EJCA 3HJEA 3L2WA 4PK4A 1WRJA 4X6AJ 5ERIA 5EEAA 5E8GA 5DD4A 4CXFA 4HOBA 5L3DA 1X1AA 1BBYA 2H09A 3M1EA 2IRFG 1ETKA 4Q5SF 1D8JA 5J1UA 3RKWA 4EATA 2EZIA 1IXSB 1VF9A 2NOGA 3V8KA 2P8TA 4M73A 1RUNA 1CQTA 3R0JA 4RAYA 2M7BA 4E7IA 3SHFA 4ZYHA 3FDYA 2HOEA 2XSJC 3I4MJ 1YW7A 2WV0A 3FXMA 1XCBA 3FMQA 1ON2A 1OFCX 1E3OC 4CCJA 5E3NA 1T39A 1LB2A 3I0TA 3IH2A 2F5VA 3S17J 3CMYA 1QRYA 4UV8A 2P7VB 2VODA 1S5LC 4DZPA 1OCTC 5E8IA 2FSWA 1AKHA 2YS9A 3QODA 2V7FA 4HDVA 3PO2J 2IS4A 4LOCA 1N77A 2VBYA 2LREA 3ZMSA 2JMWA 5H6QA 1HDPA 2E1NA 5HS9A 3FKJA 1N78A 4IO9F 1YG2A 2DTRA 2H8RA 3FMSA 4PGHA 4XORA 2YX4A 4PGGA 4PJNA 2EV6A 1BW5A 3KLOA 2LR8A 4ZZLA 2MYSA 1EF4A 2ZKZA 4BEHA 4UY8I 3LSIA 4K2EA 5CVJA 3WTYC 3FHZA 1JE8A 1U9NA 1JHHA 2EIKH 2UXXA 2ZXWH 2ESNA 3C2HA 1G2HA 1TLHB 3QU6A 4ASNA 1WI9A 1KQ8A 5HLTA 3ABTA 5EG0B 3CCQI 4B1RA 3HDDA 1SVMA 2ZMEA 2R7ZJ 1EV7A 3C3WA 3ABMH 3W6KB 3RQ4A 3NEUA 1JXSA 1UG0A 3CUOA 3GTOJ 4XLFA 4V19K 1XGSA 2CG4A 2DT6A 2LF7A 1O3TA 3ML6A 3CZ6A 1PP7U 1R7JA 4RLQA 1TBXA 2BEOA 4II3A 1O3QA 2QQ8A 3K9TA 2LSOA 2JA7J 2F4MB 2IEKA 2B0LA 4CHUA 1G4DA 2EQRA 3PIPF 3KX2A 1T95A 3BT9A 1T2KA 2IAIA 1TWFJ 3LSTA 4XR6A 4BACA 2JVHA 3GTKJ 1AKHB 3ABUA 3ISPA 4XKVA 3RJPA 1ZG3A 1YTYA 4N4NB 2PI0A 4U7DA 3J7ZI 1HBXG 2RQPA 1DP7P 3LA7A 2K9NA 3OYCA 2R5ZA 2E7XA 4YG2F 2DLLA 4F93B 1K6YA 4V2FA 1C0WA 1AU7A 5J40A 3F22A 4A3DJ 2P6TA 4BJ6C 3HZJA 2M7AA 4M6VA 1F9NA 1Z6TA 2TDXA 1YRNA 3S1NJ 4NB5A 1IN8A 2W82A 1TWAJ 5A2QK 1UFMA 1FWZA 1VI0A 3IAM2 1HKSA 3K4CA 1KYZA 4LIVA 3HYIA 1TTYA 4XRFA 2OQGA 1OCPA 1ZGJA 3OYKA 2KLOA 2XPWA 3HKZN 2Q1ZB 3P9IA 3RSNA 2R4GA 1SMTA 2JPCA 3VEPA 1U6GA 4P55A 4HPQA 1JUMA 3O3KA 3WGGA 3KP5A 4DYCA 1RI7A 4BHPA 3IH4A 4XNFA 3P9CA 2VPRA 2IA0A 1Z05A 2RDPA 4QSHA 1MDMB 4GO1A 3ZQQA 3RIRA 1X1CA 4ESBA 1J75A 2OZ6A 1T38A 2I10A 1ZH5A 4PFPA 5GAEJ 2CRGA 2I5UA 3KYCB 4OOIA 3AL0B 4XOPA 5GAGJ 4I09A 5LHHA 1KQ0A 1QU3A 3FXJA 4II2A 1R23A 4RB0A 4KN4X 4XKCA 1YJ9I 3S1QJ 2V9VA 1S72I 2H6BA 1DDNA 4G94A 1XX5A 4JOMA 2BBYA 4HX8A 1BC8C 2R7FA 4ESFA 2KIQA 3LSHA 1V5GA 4O3MA 2BW3B 3NRVA 3NARA 4ENKA 2EA2A 1W1WE 3CUQB 1SANA 4KMUX 4HLYA 4RB1A 2ZMEB 1USSA 4IRGA 1S29A 2Z9OA 2GIVA 4E4HA 3LMMA 2TCTA 4IHVA 4XN3A 3IL2A 3K1NA 1WWXA 1LJ9A 4IXAA 2K9MA 4KIGA 4MTDA 3E6MA 3FBIB 3LSKA 2E19A 3MCZA 3QU3A 2YPRA 4FE4A 4NQWB 4EGYA 1Z9CA 2V9KA 3F6VA 3PIOF 5CYVA 1ZG1A 1J9IA 2FD5A 3UNGC 3OSFA 3U9GA 1BW6A 3F8CA 3REOA 3ZP5A 2B9SA 5EEGA 4YRVA 2DMQA 3F72A 5DM7F 2W57A 2NS7A 2M30A 1ZN2A 3E1SA 1V5EA 3GLXA 3MKYB 1JHFA 5L3FA 3OY9A 3JRAA 2O8KA 2PJRB 2GBYA 4WXDA 3ZMTA 1W0UA 3CCYA 2F48A 4ENMA 1XN7A 2P5KA 5LGNA 3V4GA 3F6OA 1SFXA 2HDDA 3PM1A 2E71A 4Y4RA 4I7HA 3GTJJ 2X9DA 3I5UA 2NVTJ 4UHTA 4H0EA 2IP2A 2FE3A 4BS9A 1N25A 3K4NA 1QPIA 3AAFA 2V1DA 2BW3A 3K4JA 3FXQA 4YIFA 5D4RA 4AIDA 1RIOH 4A3KJ 3PO3J 2VI6A 2XGXA 1R1VA 2LLKA 3QPTA 4DIQA 2VLAA 2A68F 4YIIA 4D1QA 2YUSA 4M72A 3K4KA 2WY8Q 2LKSA 3BROA 2BGCA 3LSGA 4FISA 1WGXA 4G6QA 1Z1DA 4XKWA 4Z6YA 3ELKA 1IN6A 3I56I 5ICEA 1YYVA 2CW0F 4J19A 4DYQA 1WKMA 4WF2A 2LH9A 3LOCA 4HNVA 5J8FA 4M71A 3DP7A 5FB2A 4LFUA 1PUFA 1T0FA 3HOTA 2HDCA 1YLFA 3E5XA 1SD7A 3N4MA 2XIGA 4GYIA 2OPTA 1SFOJ 1I6XA 4HG2A 3IRQA 4XRSA 1LKXA 1TQPA 3OYBA 3UKGA 5AIQA 1LUJB 2NVUB 2H94A 3QRFF 3JW4A 3OYNA 1NHAA 2IS6A 2Y30A 3C1DA 3GZ6A 4Y3OA 3DTIA 3HBLA 2Z33A 1ZELA 3W2VA 4AD9A 3VYUB 2P5LC 4XLCA 1A5JA 1A35A 2ME0A 5E1ZB 3V7CA 3WGIA 2XB5A 3CJTB 5EYRA 3MZYA 3HEFA 1GVDA 4EQQA 2E60A 3KETA 2Z16A 1E0EA 5EG0A 3M8FA 1E17A 4DBRA 3DPTA 1LDDA 3X2QH 4C2TA 2JA8J 3S16J 3TO6A 4ZYEA 1YITI 4YELA 5FJ8J 5IT9K 4S0HB 2STWA 1UCRA 5DCFA 3V42A 4XLAA 1IAWA 1RRJA 2E34A 4D7MA 1ZQ3P 2IA2A 1WJAA 2DYSH 2ME6A 4S04A 1JT0A 5C44J 1QGPA 1S7AA 3BCAA 2LKPA 3DXJF 3SXYA 2HYFA 2PLYA 1OLTA 3O2PE 1Y0UA 2JSPA 2OBPA 2BYVE 3O8HA 1STZA 4CZZA 4XRMA 4OMZA 1T8IA 2VQLA 4GXOA 2GOXB 3HRSA 2W25A 5GPCA 1M1EB 2JK3A 3JRCA 1K61A 4RA2A 3KP4A 2EFWA 1IO2A 4IHYA 4LIUA 2EFQA 1OYIA 2PFBA 4BH9A 4EV0A 3LSMA 5FKNA 3GFJA 1W5TA 1LEAA 4FX0A 2WV1A 1W5CC 1ZRCA 2J5PA 1T08B 1MJBA 1UB9A 3BQYA 5GPAA 2WADA 3BJAA 2IJLA 5GTIC 2BXZA 3RYRA 2A6HF 1WZ2A 1LQ1A 3KLNA 4BKXA 2VJJA 2AXTC 2FA5A 4BDZA 1YQAA 2ACJA 5JHFA 5J47A 2KISA 4F7ZA 4IHXA 1O4XA 2QWWA 3S32A 3ZN0A 1TC3C 5IT9Z 3DEUA 3H3UA 4AYBA 3JRIA 1VFCA 1R58A 3AKZA 2IGOA 3KP7A 1TW3A 4EEFG 2B7EA 1MH3A 3QYBA 1DGWY 2OCEA 2K02A 3MZHA 3F9KA 1U2WA 3B6CA 2JRMA 3U21A 4LB6B 2TRTA 1MJAA 2DO7A 3I53A 3PSIA 4HF2A 4IHSA 2GXGA 1UHWA 3SEQA 2B63J 3H35A 1LE8B 4PFOA 3IHUA 1HQCA 1JJ8C 4O6JA 3OL3A 1Z3XA 1T33A 2DA3A 3QOPA 4CYDA 4I99C 4C3JJ 2DBBA 3OS1A 2Z3YA 3AG1H 2JA6J 2M4GA 3LNQA 1KZHA 2K27A 3T8RA 1H0MA 2CQ7A 2GXBA 3CCJI 3GBGA 3PQKA 4LGWA 5GAHJ 3JRHA 5BOXA 5BPIA 2DYRH 1JUSA 1VQKI 4B3AA 5TGTA 2XAJA 4WXCA 4AUXA 4A3EJ 1K7AA 4BQAA 1FYKA 2VJ5A 1ZAOA 2KFDA 2RV8A 4YFXF 5F1RA 3DU5A 2AS5F 2LNBA 2JUGA 2LY9A 2E1CA 1MNDA 2R7XA 4M9ZA 3BJ6A 2KDOA 2D1HA 4XLHA 4EVIA 1BIAA 2LY1A 3SFIA 2A3SA 4IQ4A 3GF2A 4HSRA 1V54H 4OU0A 2ZCWA 2HQ5A 3LSJA 5C3EJ 4L0YB 1PUEE 4ZDOA 2HYGD 4HZFA 1ZRFA 1YW9A 1W5SA 2LK2A 2OTLI 1UHMA 3I59A 3CC4I 4DOZA 2XAGA 3DBLB 3WODF 1BL0A 4A69C 2W24A 2XUBA 3KZYA 4E7KA 4IQJA 3U1DA 1MSEC 4MGRA 2E35A 2X48A 2HQNA 3K4LA 2WB1A 2NRAC 5FLVA 3HHGA 4B43A 1V55H 4XIDA 4IEJA 4U0WA 3DBHB 5B1BH 4HW0A 3DTEA 2LDUA 4RM3A 4MEYF 1F1ZA 2L5QA 5HS7A 2DTZA 3CLQA 2M9HA 1FNNA 1QZYA 3IUOA 2DA7A 1OYWA 5FD6A 3CP8A 2CV2A 1J0RA 2X1EA 4RM2A 3Q0WA 3ZRGA 2XRNA 4GRIA 3HM5A 3M07A 2VQCA 2QBYA 4MFEA 1WSUA 4HDUA 2HZDA 1HF0A 3ZMVA 3CTAA 2CFXA 2LF8A 4C2MJ 1S3JA 2UWMA 1HKTA 3ZPLA 2VOOA 3G6EI 3F21A 1T0FC 3D5SC 2LTPA 1WVRA 5DCMA 1WI3A 1X1DA 1ZARA 4KIBA 4Q48A 3IKTA 1BOAA 2PG4A 4ABZA 1FJLA 2FOKA 2JT1A 4NQWA 2E1OA 3I4NJ 4QPOA 1GHCA 3J7AY 4I02A 1W36D 1AOYA 3VYTB 4IOAF 1IZ1A 3R61A 2JVGA 4MQVA 5J6XA 2E5ZA 3TOBA 2ZFWA 1I3AA 2VC1A 3IC7A 5DD8A 1Z7LA 5M3MJ 3WG9A 3EUKL 1WJFA 2MC3A 3GFLA 3W2AA 4WX9A 2MC4A 2VC0A 3BPVA 5L3CA 4PSWA 1IXCA 4AVPA 4KITB 3GTPJ 3LAPA 3H1CA 2QCOA 2ZSIB 3C2BA 3GW2A 2QSFX 3J81Z 2XGEA 1REPC 3ZCOA 1MNEA 1KGSA 3OSGA 1FSHA 3BP8A 3A0HC 2QF7A 2JUCA 4AC0A 3KP6A 4ZZDA 4P96A 3VPRA 1O7FA 4RGRA 4FX4A 3L09A 3CDLA 1YRNB 4L5IA 4G7HF 4HNTA 1BOBA 1W7PB 2M87A 1E2XA 1XS9A 1GXQA 2XPUA 4HSTA 3I55I 4RAFA 4NC7A 3JTGA 2JTVA 4L5JA 2QUFA 3KYDB 4IVNA 3QWLA 2VASA 2OA4A 2M8GX 5FRMA 3M4OJ 1EKEA 1SD6A 3GCMA 2ZBKA 2NOJB 3CF5F 3TL4X 3L2QA 1EH6A 4UUVA 3GFMA 1QVUA 1P2FA 3V7SA 3RPUD 1PDNC 2K3FA 3L7WA 3OIPA 3OOUA 2NAZA 3OYEA 2DXIA 1BR4A 3ZQCA 1WJDA 4U0VA 5EZHA 3JSOA 1XC5A 3BR6A 2V4JC 5J3LA 3H92A 4BDYA 2HNHA 2JQ7A 1ZRDA 5IYBJ 4LB5A 1IJWC 3HGGA 2ELKA 2FBHA 1J09A 3R0AA 1YHQI 5D5WB 1T98A 1ZK8A 2KRFA 2L9RA 2CQQA 4GYGA 3F8FA 5E79C 1RKTA 2CJJA 4KUMA 5IP6A 3MMYB 5TISC 3HOVJ 3W6JB 4DJAA 2GIZA 3RZOJ 1ZGAA 5K5RA 2DOFA 4HRIA 1SD5A 3HL2A 1Y56A 1P7IA 3L00A 4QIWN 5L3EA 3H9JA 1YO5C 3CC7I 3NWTA 2O03A 4CCOA 3JRGA 3A2KA 1AA7A 2KP6A 2JWTA 3BDDA 4PJ0C 2CS3A 3WHCA 4PZJA 4M9XA 1LNWA 2FRHA 2XGDA 2DPDA 1ZLJA 1R4MB 4KYWA 5LRSA 2M0MA 2A61A 4WK8F 2OV7A 2RKHA 3WTUC 3DWLE 1IUYA 3IRRA 1R49A 1MMSA 4RGUA 1XPXA 3HUGB 4BJ5C 5BMZA 1B6AA 5ICGA 1IUFA 4FHTA 4XICA 1FZPB 4R1HA 2HTSA 1FBUA 1H88C 1U5TC 3DU6A 4G6DA 5E20A 1RETA 2K9SA 3ZR8X 5DDGA 2G7HA 2PMZN 2VL8A 4B47A 1SD4A 4M3GA 2HYJA 3GEZA 1R1UA 5DM6F 3TMOA 1A6IA 2J5OA 4D9JA 4UXNA 2P6SA 2R7VA 3HTUA 3WTZA 3W3CA 2BY3A 1HA8A 1WJBA 3TBIA 1VQLI 4QTRA 1FMVA 1Z77A 1K6OA 3A0BC 3HOWJ 2E2JJ 3DKWA 1U3EM 3BG9A 2CV0A 2R7TA 3ZQ7A 2CQNA 5HDGA 1UG2A 3J7YJ 1XDSA 3CDHA 3R60A 2L9VA 4BQOA 1YFHA 2VUMJ 5ILUA 3M7GA 1VQ9I 3GFIA 1B9MA 1IN7A 4BGDA 4BXFA 3GTQJ 4FASD 3MWMA 4M6XA 4EJUA 1IDZA 3L2RA 1Z7UA 1IV6A 2P4WA 2XV4S 1G3WA 1B1BA 2W00A 3KE2A 5M5YJ 2ID3A 1T56A 2NXNB 4Z2YA 1G59A 4OAYA 3PUFA 4I2OA 4BU2A 1HW2A 3KP3A 4OIQF 3RZDJ 5KAIC 2CUEA 1D0YA 1A31A 3PJRA 4UNOA 3PNVA 5D4SA 2WAFA 1ACIA 4JP0A 3M3YJ 5LEJA 3F23A 1ZREA 3OR2C 4Y13A 2GWRA 2BHZA 1ZG5A 1MW7A 4YFKF 1U8BA 3RKQA 3CCLI 3ZXSA 3WTTC 3S2WA 2CV1A 2O6GE 2LD5A 2HPIA 3HHHA 2DMUA 1F4KA 1X2NA 2K5CA 4BE2A 2ZB9A 2F4OB 2W7NA 1SAUA 2RC4A 3JRDA 2EIJH 2A5WA 2IGKA 3DBRB 2JZYA 3DFGA 2QVOA 4N0BA 4M3DA 2HQAA 3CLOA 3MVPA 1AHDP 2IPQX 1I5ZA 2JRTA 2G9WA 3GLLA 4ZYAA 1D1CA 4LLLA 4DGWB 5D8LB 1WJEA 4LK0F 3GX4X 1LVKA 3DKXA 5LGTA 3WU2C 1Z6RA 3ZQIA 5HS8A 1PVEA 1IRFA 2GQQA 5DTDA 4NHJA 2NNYA 1D3YA 3NAUA 1NTCA 1MBJA 2HGCA 3S8PA 1IRGA 2NS0A 2VQHA 4RS8A 2ESHA 5KVRA 2HDWA 4HA8A 1I1SA 3BR0A 5DCMB 4CICA 5IP7J 3A02A 3ERED 1QA6A 1KU3A 3IWFA 3N05A 3WTVC 4HYEA 2VIXA 3H3ZA 3MZ8A 1W4MA 2AO9A 4NBQA 4PSXA 1MSFC 1W7PD 2RN7A 4EJWA 5IYCJ 4F3QA 3KYLA 2VOPA 1Y8QB 4B44A 3AG2H 3H0GJ 3OIQA 1WQ2A 1TNSA 5BPDA 3ONQA 1RNLA 3E6BA 2QEXI 4A3FJ 5KCMA 2L02A 3GUDA 1HXDA 1XGNA 2PBIA 2WWYA 3SDBA 5ILVA 3GTGJ 3FX3A 5D5XB 4P9UA 1XSDA 2DQRA 2HXIA 2KKOA 3CP2A 2Y0SA 4BEHB 5AONA 4KNYA 4KT5C 1MBFA 1SVOA 4MLOA 3K7AJ 2E5NA 2K85A 2CGPA 4AU7A 1LVAA 2KZGA 3BLYA 1XMAA 3FZVA 1WCMJ 3ZMUA 2DK5A 3FHNA 1IN4A 3TO9A 1FLIA 3LA2A 1GVJA 1IW7F 4HBLA 3T1BA 5CVRA 3RDIA 1TWHJ 1OCZH 2G7UA 3OOPA 5K7ZA 2R7QA 4I98B 4UB6C 1P4WA 2K4BA 2KJBA 2V1XA 3LAJA 1Y39A 4IL6C 4DW6A 2HTJA 3SEZA 3DV8A 4XONA 1U5TA 3QP6A 4ZYGA 1BI3A 3HIFA 2FQ3A 1EA3A 2OUMA 1PP8F 1O3SA 1VQPI 1FX7A 2E1MB 3LQRA 3U1KA 2HZTA 3BTCA 3C7JA 5LGUA 5HLIA 2XC7A 4JYKA 1YW8A 4D5CA 1Z91A 2M4KA 3OS0A 2DA6A 2EBIA 2M5WA 1K79A 2PMUA 3DEWA 1ETWA 3F8NA 5HVQC 1LFBA 4F91B 1YJNI 4JQFA 3EUAA 3EPZA 3V8LA 4EJTA 3K2ZA 4ENNA 1MKMA 1FYLA 1POGA 4E70A 5D5UB 1E3HA 3PFIA 3KEQA 5JR3A 4NC8A 2IBDA 2CFOA 1R6RA 2OU2A 1Z3YA 4KIFA 2X0LA 3GMEA 4BXUA 1GDTA 1J7KA 4IF4A 2ZFUA 2A69F 4UUSA 1KU7A 3RKXA 2LMDA 2BY2A 1ETQA 2EV0A 5K7HA 2CUZA 1GT0C 3A03A 4HQEA 1LDJA 1YX5A 2RREA 5E3LA 3H36A 4KA4A 1X1PA 3RQIA 5TJJA 5F27A 3QOEA 3GZNB 2COBA 4XOTA 3TO7A 2WA0A 1VQ8I 3DKYA 3OYHA 2RNGA 4G9YA 1DPUA 2DMTA 3CMEI 4I6ZA 1HSTA 3JCUC 4UVBA 3TP3A 2VXDA 4W1UA 3OYAA 2BVMA 4M6YA 2O61A 3CJQB 3K4BA 1VNDA 1UAAA 1BN5A 2LY2A 1UELB 3E7LA 3HSFA 3QPSA 4B4CA 4ZYDA 1BA5A 2ECCA 2XRLA 2JJ7A 1OCOH 1IG7A 2JA5J 2MGQA 4E7HA 4A12A 4A0XA 5LHGA 2KIFA 4KJZA 2K7LA 3AFHA 3N97A 4KMFA 4E7SA 2MA3A 2KIMA 4XLEA 2XPVA 1WPKA 3P9KA 2MD0A 1MGTA 4OAZA 4E6KG 1X19A 5JVGF 4UB8C 1Y8RB 2DA2A 4KT6A 1D8KA 4P9FA 1Y0NA 3PNTA 1BJAA 2XVCA 2DFFA 5BNGA 1TP4A 1GV2A 2Q2EB 4A6EA 3DPUA 2KRCA 3FWEA 3JAMK 3CO7C 4UUTA 1ERDA 2RQQA 3H5AA 3CESA 1RPWA 3COAC 3CCEI 3PNYA 3D5RC 4B3XA 2HEOA 4C3HJ 2LC2A 1R5ID 4AIKA 1KQ9A 2BXYA 2FBIA 1RZ4A 1SFEA 1MDMA 4UV9A 1JGSA 4YFNF 2AQEA 2KT0A 2P0WA 2LP0A 4I0AA 1O3RA 1FBSA 3JTHA 4BQNA 4IRIA 1NG6A 2XAUA 2IS1A 3FXLA 4IX7A 4A3CJ 1R00A 2V1UA 3I3LA 2DA1A 5J4YA 2CSOA 2DODA 4N9IA 2XSDC 3HTSB 1HOMA 1YX3A 1DQUA 3D5LA 1Y1WJ 1R71A 2R5ZB 5GADJ 4XRSG 4JX5A 2MD5A 4BY1J 1DP3A 4HEA2 2MG4A 1MD0A 3WHBA 4EGZA 3CCUI 3LFKA 3J7AO 2L9NA 5EZGA 4P1WA 4L18B 1HSJA 2DDBA 1XSVA 4ANJA 2XF7A 1R1TA 3BR3A 3KEYA 3OL4A 4PJLA 2DA4A 1UZCA 5F64A 2MLGA 2R7SA 2Q2EA 4QLCU 3OS2A 1H9GA 2CQXA 4PCQA 3E3VA 3QYFA 2MLKA 5FFZA 5J1YA 2W4SA 4ZDPA 1R22A 1G6NA 4LLNA 4HAMA 1DGRM 3ULQB 3E6DA 5CQEA 2ZXIA 2V9PA 1J5YA 3K6GA 2DOEA 2FNAA 2R7OA 2H6CA 2X6WA 4IZZA 1QBJA 1G3SA 3LL7A 1FOKA 4IKFA 2EINH 5IT3A 3C2GA 2YSRA 2FUG2 4FETA 1BI0A 3QPLA 1BC7C 1K4SA 3ZN1A 5J4VA 2KPMA 4XSZF 1ONVA 5IPAA 3T8TA 1QVTA 1YOVB 2A05A 4ZJZA 3ERMA 2VT3A 1WH5A 5LEKA 1IGNA 3I64A 3BTJA 2JPBA 2WAQN 1NK3P 3LWFA 3OYMA 1SFUA 3EQLF 2L7KA 3DEEA 3IP4B 4XMYA 3E5UA 4BHCA 3BOQA 1KA8A 1AWCA 5C4XJ 4KFCA 2M3AA 1OCRH 2EZKA 1N75A 3BZCA 1XD7A 3FXRA 5FLMJ 3K69A 2V79A 3FM5A 1FC3A 2L7FP 4AWXB 5HNFA 2V6EA 2E7WA 5TRDA 1GUUA 1Z67A 3KCCA 2HXOA 2L54A 2H8WA 3ASNH 1VZ0A 3FF5A 3V7RA 1OISA 2IGMA 2VXZA 4CH7A 3A01A 1XGMA 2L7MP 5ICCA 3ZQLA 1J59A 2M0CA 3HOUJ 1R4NB 4MTEA 1VQ5I 2HWVA 2HOTA 2DJNA 3O8GA 1QZEA 1TZLA 2CW7A 4BYYA 2VKEA 3G1MA 3V8JA 1EH7A 1LDKB 2DI3A 2R92J 4L9NA 1I39A 4JX6A 4B48A 4U88A 5F1JA 3A4CA 4BY7J 2HVSA 4FCYA 2VKDA 1ORKA 3ROUA 4PJJA 4NC6A 1FTTA 3B02A 2CYYA 3ZQGA 2V26A 1B9NA 2LYCA 5DUKA 3JRBA 2GOMA 1A04A 2KDZA 3RYPA 2O9LA 5FKMA 5FRNA 2M1BA 5FD5A 2FU4A 1Q1VA 5FKOA 5CJ9A 3CMAI 4OIPF 2EIMH 4MNUA 2VBZA 4N4OB 3KFWX 2ZJPF 4RGXA 1D0ZA 2Y2ZA 2XF5A 5J8CA 1MIJA 3DPLC 3SDGA 1H89C 1KU2A 3K2AA 4NUBA 1P4AA 2A5YB 3CJRB 4OINF 3HC7A 5A2QZ 3T0YA 2R7UA 1OR7C 2IS2A 3K10A 2VBWA 2X4HA 3VSKA 2DT7B 5DUIA 3OYLA 2PJRA 5K5OA 2BY0A 4CA0A 2CH0A 3FXKA 2FMYA 3CMMA 3BJOA 5CLSA 4AYBN 2HVQA 4M74A 2W48A 4R8HA 4I0BA 4G8XA 5FROA 5D5VB 2BZTA 4N9HA 4V2GA 2LG4A 2ZMEC 2UUZA 4C9YA 4KN7X 2ICWG 4CYCB 3FK6A 4B09A 1O57A 1USTA 1YI2I 2DN0A 2HKOA 1TW2A 1LEBA 4MIMA 2KMUA 4XL9A 2F5DA 5ILSA 1TNTA 1S9HA 2L4AA 2YX7A 4CCLA 3B73A 1FY7A 2F4IA 2FBKA 4EJVA 2X1CA 3HSRA 2FOWA 2DMPA 3HRMA 2W84A 3DLLF 1VQOI 3HG9A 1FT9A 3HGYA 1SMYF 3A01B 5CPRB 3VYRB 3BR2A 2KQRA 3KEOA 3MQ0A 3JR9A 3G71I 1YJWI 1JI8A 1T6SA 4U87A 1TWGJ 2O8XA 5KNLA 3DQVC 3CJNA 3G1OA 5HLGA 3MKZA 1SEUA 4IJAA 1HLVA 1X3WB 3ABLH 3WTXC 3OV8A 3BY6A 4M3EA 4A3GJ 3F0CA 1RKWA 2WC2A 1ETYA 3E97A 3LSPA 5LLQA 3F8MA 3BG3A 4M9SA 5GP9A 3OWTA 2L9SA 4BL0B 2X6OA 3E0JB 6PAXA 4OWRB 4DBQA 1FOXA 1HDDC 3OYDA 2QQBA 3R4KA 3JRFA 3CDIA 2DCEA 1DUXC 1R5GA 1EH8A 2P7CB 3S14J 4P5OA 3CCMI 2WB1N 2L3DA 1OJLA 2CO5A 3BC8A 3P7NA 2MABA 1EJ9A 5D6EA 4ESJA 3LFUA 1HW5A 2QBYB 2ZNZA 1CF7A 2DK8A 2GZWA 4KISA 4XBFA 2BY1A 2F6CA 2W1OA 5KK1A 2R7WA 2MFZA 4WXHA 2HU9A 4MEXF 2P81A 2BE5F 4HQMA 4IHWA 5F04A 3E6CC 2QZ8A 3G4SI 1L0OC 4KICA 2EFPA 3GTMJ 1UMQA 2DMNA 2K4JA 5FKLA 1UHSA 3TDUC 5IYDJ 3I54A 1ETVA 3TP0A 3QQAA 1U78A 2CU7A 3BTLA 2HFHA 4KDPA 1DU6A 4TV7A 4L9JA 4HX4A 1G8XA 1PYVA 5H2FC 2LBFA 3QYEA 3WG7H 5HNHA 1G3TA 1OCCH 1OYYA 5F6FA 1IV8A 2Y0MA 5IOYA 3S93A 4CYCA 2KJCA 3G2BA 3HPGA 3KP2A 2MH9A 4A5NA 3G1LA 2PJPA 1BJZA 3IKVA 4I01A 1IC8A 1MH4A 2Y31A 4F92B 4BNCA 4Y17A 1P7JA 2ZNYA 3ZMDA 4M3FA 3H5NA 2NVYJ 1IRXA 1D1AA 1DPRA 1X4PA 1ZLKA 5E18F 4W97A 5B3SH 1B8IB 4A0ZA 2XAQA 4LG3A 3WE2A 2EZLA 3JREA 5CVUA 3B6AA 1F5TA 2WY7Q 4PUSA 3KIOA 1X3ZB 1YIJI 3EYIA 3VODA 4CCMA 1ZR2A 1BR2A 2RNJA 4BBSJ 3GTLJ 2CUJA 3MAJA 1JT6A 3EUHC 2EFOA 2M2EA 1K4TA 4CGZA 1ODDA 2BV6A 2ZXHA 3SYTA 3NQOA 2ZJQF 2OQRA 3QAHA 4BXXJ 5M5XJ 2KZVA 1V4RA 2F5FA 2VKHA 2HOSA 2XF6A 2ELJA 3H3VK 2FQ4A 2STTA 2Q0OA 3TGNA 1OKRA 3H9QA 1JJ6C 1GV5A 3H5RA 1P6RA 2KHMA 3DCFA 4R79A 2VJ4A 3S3OA 1HW1A 5B1AH 1TT5B 2AHQA 4UUSB 1HC8A 5FLXZ 1SFKA 2IA1A 2RAEA 3C18A 3G3ZA 2FF4A 1ULYA 3A1YA 1BI2A 4C3IJ 3I9V2 3I71A 3L2VA 2LKXA 1IF1A 3FIWA 4BJTA 3T5XA 3AL0C 2OD5A 4X1EA 3O6BB 2COMA 4QPQA 1K78B 2PEXA 4MHGA 2QENA 2QLZA 5B66C 2KL4A 4D7NA 5L3BA 1JKQC 1DU0A 3L9FA 3LSRA 1FSEA 3IH3A 1S6LA 1WFXA 5CKTA 4DNCA 3HRTA 4BE1A 1JTYA 1Y1VJ 2JA2A 3K70D 3FXUA 3L1PA 4Q47A 4Y52J 1V5FA 4XK4A 1Z21A 5JLWA 2F5CA 5HOOA 3HPHA 2NYXA 1FIPA 3MKWB 2Y9YA 3Q0VA 5JI6A 1ITYA 1QHGA 2LBFB 2HVRA 3R6SA 2K9QA 4HLXA 3DTKA 3VB2A 1KU9A 3AG4H 2QGUA 1OMIA 3KZIC 2FEZA 1FEXA 3FM3A 5K1YA 2ETHA 4A0YA 3EYYA 3OYIA 4RLFA 3HOYJ 4DQ2A 1XGOA 3M8JA 5FO5A 1W7PA 1XMXA 2VB6A 2A07F 4ZC3A 3VDXA 2D2WA 3Q0UA 3S1RJ 1ON1A 2QSHX 2KRHA 2MH2A 4RAGA 3U2RA 5FLXK 1Y6IA 3EETA 3PFYA 1ENHA 2HR3A 5E1XA 3P5JA 2DU9A 2Y48A 2MW8A 3MN2A 1P92A 3PL8A 3WU0A 4A3LJ 3PQJA 2OTJI 5JLXA 2DFIA 5DEQA 2VE9A 3ZQFA 5JHUA 5D8KB 1PUFB 4E7JA 1P4XA 2BHYA 1SC7A 1MBGA 1B72A 2VONA 1XDUA 3EUHA 2V6CA 1QHHD 2YU3A 3Q9SA 4XKBA 4U7BA 4ENJA 1LE8A 2Y9ZA 2LVSA 3H0DA 1X1BA 2VN2A 2C6YA 3OYFA 2GAUA 3OIOA 2EB7A 3ECHA 2R5YA 2OJED 1QO0D 2Q8KA 1MBEA 1W36C 5LRRA 3CC2I
chains in the Genus database with same CATH topology
4GGGA 3K0LA 2XKPA 2IW5A 4LD5A 2VT2A 3BWGA 3SFZA 2D45A 4ETSA 4QWQA 2EJRA 2M45A 1OPCA 4BAYA 4HF0A 4FT8A 3I59B 2P5VA 2QQAA 4XSXF 4Y15A 2DAOA 2PQ8A 3GXOA 2EFNA 3JAMZ 2D1VA 2ADUA 2XASA 1FYMA 3DF8A 3Q5FA 2JSCA 4ON0A 2RGVA 3F3XA 4AIHA 4RAZA 3K1PA 2L01A 4HX7A 3SZTA 1QZZA 5HDNA 1XMKA 1B59A 3CUQA 1OR7A 1Q1HA 5ICFA 2ZJ2A 4RGSA 2QYOA 5DV5A 4HV5A 3HUGA 4UVCA 1V3FA 1CGPA 4IPAA 2DW4A 3BPXA 3GYHX 4UVAA 2O3FA 5H6RA 1SAXA 4IRHA 4JK1X 5EEHA 4A2UA 3SQNA 2PMHA 2W85A 3HRUA 4IHTA 2ZO4A 5FFXA 2EA4A 5E17F 5HDKA 2HKXA 4LK1F 3G73A 2UXNA 1S8NA 1I27A 3GWZA 3ECOA 3RPUA 1XB4A 4CDGA 5LHIA 4ZH4F 2R7DA 2XAHA 4BHBA 1U5TB 4WWCA 3I4PA 1D5VA 3WGHA 4L9VA 4OIOF 5L3GA 2VBXA 3LA3A 3TOAA 2ELHA 1I1GA 2OAZA 4L9TA 2A6EF 4G7ZF 2GA1A 4XLPF 4L0ZB 2KIUA 5E1WA 4RB2C 1YS6A 5BQTA 1BM9A 1QQIA 1RUOA 3K1MA 3RI4A 3F8BA 3RTRA 2MBFA 4B8XA 1TQIA 3IWZA 1IN5A 1TQMA 1BIBA 2NNNA 3QPHA 5HLHA 2RVCA 4O5VA 4LLGF 2AXLA 1FBQA 1G3YA 2XHKA 1BI1A 5FGMA 4EM1A 3BZ6A 3WTSC 5K5QA 3J80K 3EDPA 3J80Z 1O7LA 4D0PA 2EK5A 2F2EA 2H27A 2IVMA 4EM2A 3MFKA 2HS5A 3ZMZA 1ZYRF 2ZXJA 2DPUA 4EMSA 3RPQA 2DT5A 4G7OF 4HV6A 3TDZC 4S05A 2IT0A 2YR2A 5CVVA 2CWEA 5DYMA 1YIOA 2K86A 2EV5A 2HQRA 2XAFA 3GZ5A 2FXAA 5AIPA 1CF7B 2GA2A 2ISYA 5JVTA 1MZBA 3M9AA 4LJZF 1ZHFA 3HSEA 3L2CA 4EJOA 1MJ9A 4JBAA 2L4MA 3RKYA 4EM0B 2Y75A 1R5HA 2EWNA 3E5QA 5H20A 5CVIA 3CO6C 3KZZA 5D6FA 1S7OA 4U0YA 3J81K 4AIJA 4LG0A 1YS7A 3SZPA 3MEXA 3WTWC 2ISZA 3LQQA 1K78A 3FMRA 1U8RA 1FP2A 3M8EA 1B4AA 1FP1D 3WE3A 4CO8A 3VOEA 4MQ9F 2QQ9A 2M8EA 4WCGA 1KYWA 3GO5A 3GVAA 5JFRA 2XKOA 2FNPA 1VTNC 5ED4A 3TQNA 1L3LA 1HKQA 4A5MA 3TKYA 4PDKA 2FMLA 5LBQA 2XROA 1QPMA 3CUQC 4Q4ZF 1R36A 1IXRC 3WU1B 4RB3C 3D0SA 1QNTA 1J2XA 3Q9VA 3QP5A 3HOSA 5BS6A 4LG0B 4OIRF 2PN6A 3VFZA 4LMYA 2UZKA 4OMYA 4A6DA 2VE8A 4XLNF 1GXPA 2F5EA 2OZUA 2DQLA 2R3SA 2Z99A 3JSPA 1FPQA 2Z5UA 4HF1A 1XCVA 2WTEA 4GCVA 2QM3A 1H9TA 2CQKA 3I58A 1X3UA 1XSXA 2O0YA 1WRJA 5ERIA 5E8GA 5DD4A 4CXFA 4HOBA 5L3DA 1BBYA 2H09A 3M1EA 2IRFG 1D8JA 4Q5SF 3RKWA 1IXSB 3V8KA 2P8TA 4M73A 1RUNA 3R0JA 4RAYA 3SHFA 4ZYHA 2HOEA 1YW7A 2WV0A 1XCBA 3FMQA 1ON2A 1T39A 1LB2A 3I0TA 4UV8A 2P7VB 2VODA 5E8IA 2FSWA 4HDVA 2VBYA 3ZMSA 5H6QA 5HS9A 2E1NA 1YG2A 2DTRA 3FMSA 4PGHA 2YX4A 4PGGA 2EV6A 3KLOA 4ZZLA 2ZKZA 4K2EA 5CVJA 3WTYC 3FHZA 1JE8A 1JHHA 2UXXA 2ESNA 1TLHB 3QU6A 4ASNA 1WI9A 1KQ8A 3ABTA 2ZMEA 1EV7A 3C3WA 3W6KB 3NEUA 1JXSA 3CUOA 1XGSA 2CG4A 2LF7A 1O3TA 3ML6A 1PP7U 1R7JA 1TBXA 2BEOA 1O3QA 3K9TA 2LSOA 2B0LA 4CHUA 1G4DA 1T2KA 3LSTA 3ABUA 3ISPA 3RJPA 1ZG3A 2PI0A 1YTYA 4U7DA 1HBXG 2RQPA 1DP7P 3LA7A 2E7XA 4YG2F 2DLLA 1C0WA 3F22A 2P6TA 1F9NA 1Z6TA 2TDXA 4NB5A 1IN8A 5A2QK 1UFMA 1FWZA 1HKSA 1KYZA 3HYIA 1TTYA 4XRFA 2OQGA 1ZGJA 3P9IA 1SMTA 2JPCA 3VEPA 1U6GA 4P55A 3O3KA 3WGGA 3KP5A 1RI7A 4BHPA 3P9CA 2IA0A 1Z05A 2RDPA 1MDMB 4GO1A 3RIRA 4ESBA 1J75A 2OZ6A 1T38A 1ZH5A 4OOIA 4I09A 5LHHA 1KQ0A 1R23A 4RB0A 4KN4X 2V9VA 2H6BA 1DDNA 4G94A 2BBYA 4HX8A 1BC8C 2R7FA 4ESFA 4O3MA 3NRVA 4ENKA 2EA2A 3CUQB 4KMUX 4HLYA 4RB1A 2ZMEB 1USSA 4IRGA 1S29A 2Z9OA 2GIVA 3IL2A 3K1NA 1WWXA 1LJ9A 4IXAA 4KIGA 4MTDA 3E6MA 3QU3A 3MCZA 1Z9CA 2YPRA 4EGYA 3F6VA 5CYVA 1ZG1A 1J9IA 3U9GA 3F8CA 3REOA 3ZP5A 5EEGA 3F72A 2W57A 2M30A 1ZN2A 3GLXA 1JHFA 5L3FA 4WXDA 3ZMTA 4ENMA 1XN7A 2P5KA 5LGNA 3V4GA 3F6OA 1SFXA 4I7HA 3I5UA 4UHTA 4H0EA 2IP2A 2FE3A 3AAFA 2V1DA 3FXQA 4YIFA 5D4RA 1RIOH 2XGXA 1R1VA 3QPTA 2A68F 4YIIA 4M72A 3BROA 2BGCA 4G6QA 1Z1DA 3ELKA 1IN6A 5ICEA 1YYVA 2CW0F 1WKMA 4WF2A 5J8FA 4M71A 3DP7A 5FB2A 4LFUA 1T0FA 3HOTA 2HDCA 1YLFA 3E5XA 1SD7A 3N4MA 2XIGA 4GYIA 1I6XA 3IRQA 1TQPA 5AIQA 2H94A 3QRFF 3JW4A 1NHAA 3C1DA 3GZ6A 2Z33A 4AD9A 2P5LC 3V7CA 5E1ZB 3WGIA 3MZYA 4EQQA 3KETA 3M8FA 1E17A 3DPTA 1LDDA 3TO6A 4ZYEA 5IT9K 2STWA 1UCRA 5DCFA 1IAWA 2IA2A 4S04A 1QGPA 1S7AA 2LKPA 3DXJF 3SXYA 2HYFA 2PLYA 3O2PE 1Y0UA 2OBPA 2BYVE 1STZA 4CZZA 4OMZA 4GXOA 3HRSA 2W25A 3KP4A 2EFWA 2EFQA 1OYIA 2PFBA 4BH9A 4EV0A 3GFJA 1W5TA 1LEAA 4FX0A 1ZRCA 2J5PA 1MJBA 1UB9A 3BJAA 2IJLA 3RYRA 2A6HF 1LQ1A 3KLNA 2FA5A 1YQAA 2ACJA 4F7ZA 2QWWA 5IT9Z 3ZN0A 3DEUA 3H3UA 1R58A 3KP7A 1TW3A 2K02A 3MZHA 1U2WA 4LB6B 4HF2A 1MJAA 2DO7A 3I53A 4IHSA 2GXGA 1UHWA 3IHUA 1HQCA 4O6JA 3QOPA 4CYDA 2DBBA 2Z3YA 2K27A 3T8RA 1H0MA 2GXBA 4LGWA 3PQKA 5BPIA 5BOXA 2XAJA 4WXCA 1K7AA 4BQAA 1FYKA 1ZAOA 2RV8A 4YFXF 5F1RA 2AS5F 2LNBA 2E1CA 4M9ZA 3BJ6A 2D1HA 4EVIA 1BIAA 2A3SA 3GF2A 4OU0A 2ZCWA 4L0YB 1PUEE 2HYGD 4HZFA 1ZRFA 1YW9A 1W5SA 1UHMA 3I59A 2XAGA 3WODF 2W24A 2XUBA 3KZYA 3U1DA 4MGRA 2HQNA 2NRAC 3HHGA 4U0WA 4HW0A 2LDUA 4MEYF 1F1ZA 5HS7A 1FNNA 1QZYA 1OYWA 5FD6A 1J0RA 2XRNA 2QBYA 1WSUA 4HDUA 3ZMVA 2CFXA 2LF8A 3CTAA 1S3JA 2UWMA 1HKTA 3ZPLA 2VOOA 3F21A 5DCMA 1ZARA 4KIBA 4Q48A 3IKTA 1BOAA 2PG4A 2FOKA 2JT1A 4NQWA 1GHCA 4I02A 1AOYA 1IZ1A 3R61A 4MQVA 5J6XA 3TOBA 2ZFWA 3IC7A 2VC1A 5DD8A 3WG9A 2MC3A 3GFLA 4WX9A 2VC0A 3BPVA 5L3CA 1IXCA 4AVPA 3LAPA 3GW2A 3J81Z 1REPC 1KGSA 1FSHA 3BP8A 3KP6A 4ZZDA 4P96A 1O7FA 4RGRA 4FX4A 3L09A 4L5IA 4G7HF 1W7PB 2M87A 1E2XA 1GXQA 3JTGA 2JTVA 4L5JA 2QUFA 4IVNA 2OA4A 1SD6A 2ZBKA 1EH6A 4UUVA 3GFMA 1P2FA 3V7SA 1PDNC 3L7WA 2NAZA 4U0VA 3JSOA 3H92A 1ZRDA 4LB5A 2FBHA 3R0AA 5D5WB 1T98A 2KRFA 4GYGA 3F8FA 4KUMA 3W6JB 1ZGAA 5K5RA 1SD5A 3L00A 5L3EA 1YO5C 2O03A 3BDDA 4PZJA 4M9XA 1LNWA 2FRHA 2DPDA 1ZLJA 4KYWA 5LRSA 2A61A 4WK8F 2RKHA 3WTUC 1IUYA 3IRRA 4RGUA 5BMZA 1B6AA 5ICGA 4FHTA 1FZPB 4R1HA 2HTSA 1FBUA 1U5TC 4G6DA 5E20A 5DDGA 2G7HA 1SD4A 3GEZA 1R1UA 2J5OA 4UXNA 2P6SA 3HTUA 3WTZA 1K6OA 3DKWA 1U3EM 3ZQ7A 5HDGA 1XDSA 3CDHA 3R60A 1YFHA 5ILUA 3M7GA 3GFIA 1B9MA 1IN7A 3MWMA 4M6XA 4EJUA 1Z7UA 2P4WA 2XV4S 1G3WA 1B1BA 3KE2A 4I2OA 4Z2YA 1HW2A 3KP3A 4OIQF 4UNOA 5D4SA 5LEJA 3F23A 1ZREA 4Y13A 2GWRA 1ZG5A 4YFKF 3WTTC 3S2WA 2O6GE 3HHHA 1F4KA 2RC4A 2JZYA 3DFGA 2QVOA 4N0BA 3CLOA 2IPQX 1I5ZA 2JRTA 2G9WA 4LLLA 5D8LB 4LK0F 3GX4X 5LGTA 1Z6RA 5HS8A 1IRFA 2GQQA 4NHJA 2NNYA 1D3YA 2HGCA 1IRGA 2NS0A 4RS8A 2ESHA 5KVRA 4HA8A 1I1SA 5DCMB 4CICA 3ERED 1KU3A 3IWFA 3WTVC 4HYEA 3H3ZA 1W4MA 1W7PD 2RN7A 4EJWA 2VOPA 1WQ2A 1TNSA 5BPDA 1RNLA 3E6BA 2L02A 3GUDA 1HXDA 1XGNA 2PBIA 2WWYA 5ILVA 3FX3A 5D5XB 4P9UA 1XSDA 2DQRA 2KKOA 5AONA 4KNYA 4KT5C 2CGPA 1LVAA 1XMAA 3FZVA 3ZMUA 2DK5A 1IN4A 3TO9A 1FLIA 3LA2A 1GVJA 1IW7F 4HBLA 3T1BA 5CVRA 3RDIA 2G7UA 3OOPA 4I98B 1P4WA 2K4BA 2KJBA 2V1XA 3LAJA 2HTJA 3DV8A 1U5TA 3QP6A 4ZYGA 1BI3A 3HIFA 2FQ3A 1PP8F 1O3SA 1FX7A 3LQRA 2HZTA 3C7JA 5LGUA 5HLIA 1YW8A 1Z91A 2M5WA 1K79A 2PMUA 3F8NA 5HVQC 4JQFA 3V8LA 4EJTA 4ENNA 1FYLA 1MKMA 3K2ZA 4E70A 5D5UB 3PFIA 3KEQA 5JR3A 2OU2A 4KIFA 2X0LA 4BXUA 1J7KA 4IF4A 2A69F 1KU7A 3RKXA 2EV0A 4HQEA 1LDJA 4KA4A 5TJJA 3TO7A 1DPUA 4G9YA 1HSTA 4UVBA 4M6YA 2O61A 1BN5A 3HSFA 4ZYDA 4A12A 4A0XA 5LHGA 2KIFA 2K7LA 3N97A 4KMFA 2MA3A 2KIMA 3P9KA 1MGTA 1D8KA 4P9FA 1BJAA 2XVCA 4A6EA 3FWEA 3JAMK 3CO7C 3COAC 2HEOA 4AIKA 1KQ9A 2FBIA 1RZ4A 1SFEA 1MDMA 4UV9A 1JGSA 4YFNF 1O3RA 4I0AA 1FBSA 3JTHA 4IRIA 1R00A 2V1UA 2CSOA 4N9IA 3HTSB 3D5LA 2MD5A 1MD0A 4EGZA 3LFKA 3J7AO 4L18B 1HSJA 1XSVA 1R1TA 5F64A 2MLGA 2Q2EA 4QLCU 1H9GA 4PCQA 3E3VA 2MLKA 5FFZA 1R22A 1G6NA 4LLNA 4HAMA 3ULQB 3E6DA 1J5YA 2FNAA 2H6CA 1QBJA 1G3SA 1FOKA 5IT3A 2YSRA 1BI0A 1BC7C 3ZN1A 4XSZF 1ONVA 3T8TA 2VT3A 5LEKA 3I64A 2JPBA 3LWFA 1SFUA 3EQLF 3E5UA 4BHCA 3BOQA 1KA8A 1AWCA 4KFCA 1XD7A 3FXRA 3K69A 2V79A 3FM5A 1FC3A 4AWXB 2E7WA 5TRDA 3KCCA 2L54A 3FF5A 3V7RA 2VXZA 1XGMA 5ICCA 1J59A 4MTEA 2HWVA 4BYYA 3V8JA 1EH7A 1LDKB 2DI3A 4L9NA 4U88A 3ROUA 3B02A 2CYYA 1B9NA 5DUKA 1A04A 3RYPA 2M1BA 5FD5A 2FU4A 5CJ9A 4OIPF 4MNUA 2VBZA 3KFWX 4RGXA 5J8CA 3DPLC 2C6YA 1KU2A 4OINF 1P4AA 2A5YB 5A2QZ 3T0YA 2VBWA 2X4HA 5DUIA 5K5OA 2FMYA 5CLSA 3BJOA 4M74A 4R8HA 4I0BA 4G8XA 5D5VB 4N9HA 4KN7X 4B09A 1O57A 1USTA 2HKOA 1TW2A 1LEBA 2F5DA 5ILSA 1TNTA 2YX7A 2L4AA 3B73A 1FY7A 2FBKA 4EJVA 3HSRA 3HRMA 2W84A 1FT9A 1SMYF 3KEOA 3MQ0A 1T6SA 2O8XA 3DQVC 3CJNA 5HLGA 4IJAA 3WTXC 3OV8A 3BY6A 2WC2A 3E97A 5LLQA 3F8MA 4M9SA 6PAXA 2QQBA 3R4KA 1DUXC 1R5GA 1EH8A 2P7CB 4P5OA 2L3DA 2CO5A 3P7NA 5D6EA 4ESJA 1HW5A 2QBYB 2ZNZA 1CF7A 2DK8A 2GZWA 4XBFA 5KK1A 4WXHA 4MEXF 2BE5F 4HQMA 3E6CC 2QZ8A 1L0OC 4KICA 2EFPA 2K4JA 3TDUC 3I54A 1U78A 2HFHA 4KDPA 4TV7A 4L9JA 4HX4A 1G3TA 1OYYA 5F6FA 2Y0MA 2KJCA 3KP2A 2MH9A 4A5NA 2PJPA 3IKVA 4I01A 4BNCA 4Y17A 2ZNYA 3ZMDA 1DPRA 1ZLKA 5E18F 4A0ZA 2XAQA 3WE2A 5CVUA 1F5TA 3EYIA 3VODA 2RNJA 3MAJA 2EFOA 4CGZA 1ODDA 2BV6A 3NQOA 2OQRA 3QAHA 1V4RA 2F5FA 2STTA 2Q0OA 3TGNA 1OKRA 1P6RA 4R79A 1HW1A 5FLXZ 2IA1A 3C18A 3G3ZA 2FF4A 1ULYA 1BI2A 1IF1A 3I71A 3T5XA 2OD5A 3O6BB 1K78B 2COMA 2PEXA 4MHGA 2QENA 2QLZA 5L3BA 3L9FA 1FSEA 1S6LA 4DNCA 3HRTA 3FXUA 4Q47A 2F5CA 5HOOA 2NYXA 5JI6A 3R6SA 4HLXA 3VB2A 1KU9A 1OMIA 2FEZA 3FM3A 5K1YA 2ETHA 4A0YA 3EYYA 4DQ2A 1XGOA 5FO5A 1W7PA 2A07F 2D2WA 1ON1A 2MH2A 3U2RA 5FLXK 3EETA 2HR3A 5E1XA 2DU9A 2Y48A 3WU0A 1P92A 3PQJA 2DFIA 5DEQA 2VE9A 5JHUA 5D8KB 1P4XA 2VONA 1XDUA 3EUHA 2V6CA 2YU3A 3Q9SA 4U7BA 4ENJA 2VN2A 2GAUA 2EB7A 3ECHA 1QO0D 2Q8KA 5LRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGG A;  3K0L A;  2XKP A;  2IW5 A;  4LD5 A;  2VT2 A;  3BWG A;  3SFZ A;  2D45 A;  4ETS A;  4QWQ A;  2EJR A;  2M45 A;  1OPC A;  4BAY A;  4HF0 A;  4FT8 A;  3I59 B;  2P5V A;  2QQA A;  4XSX F;  4Y15 A;  2DAO A;  2PQ8 A;  3GXO A;  2EFN A;  3JAM Z;  2D1V A;  2ADU A;  2XAS A;  1FYM A;  3DF8 A;  3Q5F A;  2JSC A;  4ON0 A;  2RGV A;  3F3X A;  4AIH A;  4RAZ A;  3K1P A;  2L01 A;  4HX7 A;  3SZT A;  1QZZ A;  5HDN A;  1XMK A;  1B59 A;  3CUQ A;  1OR7 A;  1Q1H A;  5ICF A;  2ZJ2 A;  4RGS A;  2QYO A;  5DV5 A;  4HV5 A;  3HUG A;  4UVC A;  1V3F A;  1CGP A;  4IPA A;  2DW4 A;  3BPX A;  3GYH X;  4UVA A;  2O3F A;  5H6R A;  1SAX A;  4IRH A;  4JK1 X;  5EEH A;  4A2U A;  3SQN A;  2PMH A;  2W85 A;  3HRU A;  4IHT A;  2ZO4 A;  5FFX A;  2EA4 A;  5E17 F;  5HDK A;  2HKX A;  4LK1 F;  3G73 A;  2UXN A;  1S8N A;  1I27 A;  3GWZ A;  3ECO A;  3RPU A;  1XB4 A;  4CDG A;  5LHI A;  4ZH4 F;  2R7D A;  2XAH A;  4BHB A;  1U5T B;  4WWC A;  3I4P A;  1D5V A;  3WGH A;  4L9V A;  4OIO F;  5L3G A;  2VBX A;  3LA3 A;  3TOA A;  2ELH A;  1I1G A;  2OAZ A;  4L9T A;  2A6E F;  4G7Z F;  2GA1 A;  4XLP F;  4L0Z B;  2KIU A;  5E1W A;  4RB2 C;  1YS6 A;  5BQT A;  1BM9 A;  1QQI A;  1RUO A;  3K1M A;  3RI4 A;  3F8B A;  3RTR A;  2MBF A;  4B8X A;  1TQI A;  3IWZ A;  1IN5 A;  1TQM A;  1BIB A;  2NNN A;  3QPH A;  5HLH A;  2RVC A;  4O5V A;  4LLG F;  2AXL A;  1FBQ A;  1G3Y A;  2XHK A;  1BI1 A;  5FGM A;  4EM1 A;  3BZ6 A;  3WTS C;  5K5Q A;  3J80 K;  3EDP A;  3J80 Z;  1O7L A;  4D0P A;  2EK5 A;  2F2E A;  2H27 A;  2IVM A;  4EM2 A;  3MFK A;  2HS5 A;  3ZMZ A;  1ZYR F;  2ZXJ A;  2DPU A;  4EMS A;  3RPQ A;  2DT5 A;  4G7O F;  4HV6 A;  3TDZ C;  4S05 A;  2IT0 A;  2YR2 A;  5CVV A;  2CWE A;  5DYM A;  1YIO A;  2K86 A;  2EV5 A;  2HQR A;  2XAF A;  3GZ5 A;  2FXA A;  5AIP A;  1CF7 B;  2GA2 A;  2ISY A;  5JVT A;  1MZB A;  3M9A A;  4LJZ F;  1ZHF A;  3HSE A;  3L2C A;  4EJO A;  1MJ9 A;  4JBA A;  2L4M A;  3RKY A;  4EM0 B;  2Y75 A;  1R5H A;  2EWN A;  3E5Q A;  5H20 A;  5CVI A;  3CO6 C;  3KZZ A;  5D6F A;  1S7O A;  4U0Y A;  3J81 K;  4AIJ A;  4LG0 A;  1YS7 A;  3SZP A;  3MEX A;  3WTW C;  2ISZ A;  3LQQ A;  1K78 A;  3FMR A;  1U8R A;  1FP2 A;  3M8E A;  1B4A A;  1FP1 D;  3WE3 A;  4CO8 A;  3VOE A;  4MQ9 F;  2QQ9 A;  2M8E A;  4WCG A;  1KYW A;  3GO5 A;  3GVA A;  5JFR A;  2XKO A;  2FNP A;  1VTN C;  5ED4 A;  3TQN A;  1L3L A;  1HKQ A;  4A5M A;  3TKY A;  4PDK A;  2FML A;  5LBQ A;  2XRO A;  1QPM A;  3CUQ C;  4Q4Z F;  1R36 A;  1IXR C;  3WU1 B;  4RB3 C;  3D0S A;  1QNT A;  1J2X A;  3Q9V A;  3QP5 A;  3HOS A;  5BS6 A;  4LG0 B;  4OIR F;  2PN6 A;  3VFZ A;  4LMY A;  2UZK A;  4OMY A;  4A6D A;  2VE8 A;  4XLN F;  1GXP A;  2F5E A;  2OZU A;  2DQL A;  2R3S A;  2Z99 A;  3JSP A;  1FPQ A;  2Z5U A;  4HF1 A;  1XCV A;  2WTE A;  4GCV A;  2QM3 A;  1H9T A;  2CQK A;  3I58 A;  1X3U A;  1XSX A;  2O0Y A;  1WRJ A;  5ERI A;  5E8G A;  5DD4 A;  4CXF A;  4HOB A;  5L3D A;  1BBY A;  2H09 A;  3M1E A;  2IRF G;  1D8J A;  4Q5S F;  3RKW A;  1IXS B;  3V8K A;  2P8T A;  4M73 A;  1RUN A;  3R0J A;  4RAY A;  3SHF A;  4ZYH A;  2HOE A;  1YW7 A;  2WV0 A;  1XCB A;  3FMQ A;  1ON2 A;  1T39 A;  1LB2 A;  3I0T A;  4UV8 A;  2P7V B;  2VOD A;  5E8I A;  2FSW A;  4HDV A;  2VBY A;  3ZMS A;  5H6Q A;  5HS9 A;  2E1N A;  1YG2 A;  2DTR A;  3FMS A;  4PGH A;  2YX4 A;  4PGG A;  2EV6 A;  3KLO A;  4ZZL A;  2ZKZ A;  4K2E A;  5CVJ A;  3WTY C;  3FHZ A;  1JE8 A;  1JHH A;  2UXX A;  2ESN A;  1TLH B;  3QU6 A;  4ASN A;  1WI9 A;  1KQ8 A;  3ABT A;  2ZME A;  1EV7 A;  3C3W A;  3W6K B;  3NEU A;  1JXS A;  3CUO A;  1XGS A;  2CG4 A;  2LF7 A;  1O3T A;  3ML6 A;  1PP7 U;  1R7J A;  1TBX A;  2BEO A;  1O3Q A;  3K9T A;  2LSO A;  2B0L A;  4CHU A;  1G4D A;  1T2K A;  3LST A;  3ABU A;  3ISP A;  3RJP A;  1ZG3 A;  2PI0 A;  1YTY A;  4U7D A;  1HBX G;  2RQP A;  1DP7 P;  3LA7 A;  2E7X A;  4YG2 F;  2DLL A;  1C0W A;  3F22 A;  2P6T A;  1F9N A;  1Z6T A;  2TDX A;  4NB5 A;  1IN8 A;  5A2Q K;  1UFM A;  1FWZ A;  1HKS A;  1KYZ A;  3HYI A;  1TTY A;  4XRF A;  2OQG A;  1ZGJ A;  3P9I A;  1SMT A;  2JPC A;  3VEP A;  1U6G A;  4P55 A;  3O3K A;  3WGG A;  3KP5 A;  1RI7 A;  4BHP A;  3P9C A;  2IA0 A;  1Z05 A;  2RDP A;  1MDM B;  4GO1 A;  3RIR A;  4ESB A;  1J75 A;  2OZ6 A;  1T38 A;  1ZH5 A;  4OOI A;  4I09 A;  5LHH A;  1KQ0 A;  1R23 A;  4RB0 A;  4KN4 X;  2V9V A;  2H6B A;  1DDN A;  4G94 A;  2BBY A;  4HX8 A;  1BC8 C;  2R7F A;  4ESF A;  4O3M A;  3NRV A;  4ENK A;  2EA2 A;  3CUQ B;  4KMU X;  4HLY A;  4RB1 A;  2ZME B;  1USS A;  4IRG A;  1S29 A;  2Z9O A;  2GIV A;  3IL2 A;  3K1N A;  1WWX A;  1LJ9 A;  4IXA A;  4KIG A;  4MTD A;  3E6M A;  3QU3 A;  3MCZ A;  1Z9C A;  2YPR A;  4EGY A;  3F6V A;  5CYV A;  1ZG1 A;  1J9I A;  3U9G A;  3F8C A;  3REO A;  3ZP5 A;  5EEG A;  3F72 A;  2W57 A;  2M30 A;  1ZN2 A;  3GLX A;  1JHF A;  5L3F A;  4WXD A;  3ZMT A;  4ENM A;  1XN7 A;  2P5K A;  5LGN A;  3V4G A;  3F6O A;  1SFX A;  4I7H A;  3I5U A;  4UHT A;  4H0E A;  2IP2 A;  2FE3 A;  3AAF A;  2V1D A;  3FXQ A;  4YIF A;  5D4R A;  1RIO H;  2XGX A;  1R1V A;  3QPT A;  2A68 F;  4YII A;  4M72 A;  3BRO A;  2BGC A;  4G6Q A;  1Z1D A;  3ELK A;  1IN6 A;  5ICE A;  1YYV A;  2CW0 F;  1WKM A;  4WF2 A;  5J8F A;  4M71 A;  3DP7 A;  5FB2 A;  4LFU A;  1T0F A;  3HOT A;  2HDC A;  1YLF A;  3E5X A;  1SD7 A;  3N4M A;  2XIG A;  4GYI A;  1I6X A;  3IRQ A;  1TQP A;  5AIQ A;  2H94 A;  3QRF F;  3JW4 A;  1NHA A;  3C1D A;  3GZ6 A;  2Z33 A;  4AD9 A;  2P5L C;  3V7C A;  5E1Z B;  3WGI A;  3MZY A;  4EQQ A;  3KET A;  3M8F A;  1E17 A;  3DPT A;  1LDD A;  3TO6 A;  4ZYE A;  5IT9 K;  2STW A;  1UCR A;  5DCF A;  1IAW A;  2IA2 A;  4S04 A;  1QGP A;  1S7A A;  2LKP A;  3DXJ F;  3SXY A;  2HYF A;  2PLY A;  3O2P E;  1Y0U A;  2OBP A;  2BYV E;  1STZ A;  4CZZ A;  4OMZ A;  4GXO A;  3HRS A;  2W25 A;  3KP4 A;  2EFW A;  2EFQ A;  1OYI A;  2PFB A;  4BH9 A;  4EV0 A;  3GFJ A;  1W5T A;  1LEA A;  4FX0 A;  1ZRC A;  2J5P A;  1MJB A;  1UB9 A;  3BJA A;  2IJL A;  3RYR A;  2A6H F;  1LQ1 A;  3KLN A;  2FA5 A;  1YQA A;  2ACJ A;  4F7Z A;  2QWW A;  5IT9 Z;  3ZN0 A;  3DEU A;  3H3U A;  1R58 A;  3KP7 A;  1TW3 A;  2K02 A;  3MZH A;  1U2W A;  4LB6 B;  4HF2 A;  1MJA A;  2DO7 A;  3I53 A;  4IHS A;  2GXG A;  1UHW A;  3IHU A;  1HQC A;  4O6J A;  3QOP A;  4CYD A;  2DBB A;  2Z3Y A;  2K27 A;  3T8R A;  1H0M A;  2GXB A;  4LGW A;  3PQK A;  5BPI A;  5BOX A;  2XAJ A;  4WXC A;  1K7A A;  4BQA A;  1FYK A;  1ZAO A;  2RV8 A;  4YFX F;  5F1R A;  2AS5 F;  2LNB A;  2E1C A;  4M9Z A;  3BJ6 A;  2D1H A;  4EVI A;  1BIA A;  2A3S A;  3GF2 A;  4OU0 A;  2ZCW A;  4L0Y B;  1PUE E;  2HYG D;  4HZF A;  1ZRF A;  1YW9 A;  1W5S A;  1UHM A;  3I59 A;  2XAG A;  3WOD F;  2W24 A;  2XUB A;  3KZY A;  3U1D A;  4MGR A;  2HQN A;  2NRA C;  3HHG A;  4U0W A;  4HW0 A;  2LDU A;  4MEY F;  1F1Z A;  5HS7 A;  1FNN A;  1QZY A;  1OYW A;  5FD6 A;  1J0R A;  2XRN A;  2QBY A;  1WSU A;  4HDU A;  3ZMV A;  2CFX A;  2LF8 A;  3CTA A;  1S3J A;  2UWM A;  1HKT A;  3ZPL A;  2VOO A;  3F21 A;  5DCM A;  1ZAR A;  4KIB A;  4Q48 A;  3IKT A;  1BOA A;  2PG4 A;  2FOK A;  2JT1 A;  4NQW A;  1GHC A;  4I02 A;  1AOY A;  1IZ1 A;  3R61 A;  4MQV A;  5J6X A;  3TOB A;  2ZFW A;  3IC7 A;  2VC1 A;  5DD8 A;  3WG9 A;  2MC3 A;  3GFL A;  4WX9 A;  2VC0 A;  3BPV A;  5L3C A;  1IXC A;  4AVP A;  3LAP A;  3GW2 A;  3J81 Z;  1REP C;  1KGS A;  1FSH A;  3BP8 A;  3KP6 A;  4ZZD A;  4P96 A;  1O7F A;  4RGR A;  4FX4 A;  3L09 A;  4L5I A;  4G7H F;  1W7P B;  2M87 A;  1E2X A;  1GXQ A;  3JTG A;  2JTV A;  4L5J A;  2QUF A;  4IVN A;  2OA4 A;  1SD6 A;  2ZBK A;  1EH6 A;  4UUV A;  3GFM A;  1P2F A;  3V7S A;  1PDN C;  3L7W A;  2NAZ A;  4U0V A;  3JSO A;  3H92 A;  1ZRD A;  4LB5 A;  2FBH A;  3R0A A;  5D5W B;  1T98 A;  2KRF A;  4GYG A;  3F8F A;  4KUM A;  3W6J B;  1ZGA A;  5K5R A;  1SD5 A;  3L00 A;  5L3E A;  1YO5 C;  2O03 A;  3BDD A;  4PZJ A;  4M9X A;  1LNW A;  2FRH A;  2DPD A;  1ZLJ A;  4KYW A;  5LRS A;  2A61 A;  4WK8 F;  2RKH A;  3WTU C;  1IUY A;  3IRR A;  4RGU A;  5BMZ A;  1B6A A;  5ICG A;  4FHT A;  1FZP B;  4R1H A;  2HTS A;  1FBU A;  1U5T C;  4G6D A;  5E20 A;  5DDG A;  2G7H A;  1SD4 A;  3GEZ A;  1R1U A;  2J5O A;  4UXN A;  2P6S A;  3HTU A;  3WTZ A;  1K6O A;  3DKW A;  1U3E M;  3ZQ7 A;  5HDG A;  1XDS A;  3CDH A;  3R60 A;  1YFH A;  5ILU A;  3M7G A;  3GFI A;  1B9M A;  1IN7 A;  3MWM A;  4M6X A;  4EJU A;  1Z7U A;  2P4W A;  2XV4 S;  1G3W A;  1B1B A;  3KE2 A;  4I2O A;  4Z2Y A;  1HW2 A;  3KP3 A;  4OIQ F;  4UNO A;  5D4S A;  5LEJ A;  3F23 A;  1ZRE A;  4Y13 A;  2GWR A;  1ZG5 A;  4YFK F;  3WTT C;  3S2W A;  2O6G E;  3HHH A;  1F4K A;  2RC4 A;  2JZY A;  3DFG A;  2QVO A;  4N0B A;  3CLO A;  2IPQ X;  1I5Z A;  2JRT A;  2G9W A;  4LLL A;  5D8L B;  4LK0 F;  3GX4 X;  5LGT A;  1Z6R A;  5HS8 A;  1IRF A;  2GQQ A;  4NHJ A;  2NNY A;  1D3Y A;  2HGC A;  1IRG A;  2NS0 A;  4RS8 A;  2ESH A;  5KVR A;  4HA8 A;  1I1S A;  5DCM B;  4CIC A;  3ERE D;  1KU3 A;  3IWF A;  3WTV C;  4HYE A;  3H3Z A;  1W4M A;  1W7P D;  2RN7 A;  4EJW A;  2VOP A;  1WQ2 A;  1TNS A;  5BPD A;  1RNL A;  3E6B A;  2L02 A;  3GUD A;  1HXD A;  1XGN A;  2PBI A;  2WWY A;  5ILV A;  3FX3 A;  5D5X B;  4P9U A;  1XSD A;  2DQR A;  2KKO A;  5AON A;  4KNY A;  4KT5 C;  2CGP A;  1LVA A;  1XMA A;  3FZV A;  3ZMU A;  2DK5 A;  1IN4 A;  3TO9 A;  1FLI A;  3LA2 A;  1GVJ A;  1IW7 F;  4HBL A;  3T1B A;  5CVR A;  3RDI A;  2G7U A;  3OOP A;  4I98 B;  1P4W A;  2K4B A;  2KJB A;  2V1X A;  3LAJ A;  2HTJ A;  3DV8 A;  1U5T A;  3QP6 A;  4ZYG A;  1BI3 A;  3HIF A;  2FQ3 A;  1PP8 F;  1O3S A;  1FX7 A;  3LQR A;  2HZT A;  3C7J A;  5LGU A;  5HLI A;  1YW8 A;  1Z91 A;  2M5W A;  1K79 A;  2PMU A;  3F8N A;  5HVQ C;  4JQF A;  3V8L A;  4EJT A;  4ENN A;  1FYL A;  1MKM A;  3K2Z A;  4E70 A;  5D5U B;  3PFI A;  3KEQ A;  5JR3 A;  2OU2 A;  4KIF A;  2X0L A;  4BXU A;  1J7K A;  4IF4 A;  2A69 F;  1KU7 A;  3RKX A;  2EV0 A;  4HQE A;  1LDJ A;  4KA4 A;  5TJJ A;  3TO7 A;  1DPU A;  4G9Y A;  1HST A;  4UVB A;  4M6Y A;  2O61 A;  1BN5 A;  3HSF A;  4ZYD A;  4A12 A;  4A0X A;  5LHG A;  2KIF A;  2K7L A;  3N97 A;  4KMF A;  2MA3 A;  2KIM A;  3P9K A;  1MGT A;  1D8K A;  4P9F A;  1BJA A;  2XVC A;  4A6E A;  3FWE A;  3JAM K;  3CO7 C;  3COA C;  2HEO A;  4AIK A;  1KQ9 A;  2FBI A;  1RZ4 A;  1SFE A;  1MDM A;  4UV9 A;  1JGS A;  4YFN F;  1O3R A;  4I0A A;  1FBS A;  3JTH A;  4IRI A;  1R00 A;  2V1U A;  2CSO A;  4N9I A;  3HTS B;  3D5L A;  2MD5 A;  1MD0 A;  4EGZ A;  3LFK A;  3J7A O;  4L18 B;  1HSJ A;  1XSV A;  1R1T A;  5F64 A;  2MLG A;  2Q2E A;  4QLC U;  1H9G A;  4PCQ A;  3E3V A;  2MLK A;  5FFZ A;  1R22 A;  1G6N A;  4LLN A;  4HAM A;  3ULQ B;  3E6D A;  1J5Y A;  2FNA A;  2H6C A;  1QBJ A;  1G3S A;  1FOK A;  5IT3 A;  2YSR A;  1BI0 A;  1BC7 C;  3ZN1 A;  4XSZ F;  1ONV A;  3T8T A;  2VT3 A;  5LEK A;  3I64 A;  2JPB A;  3LWF A;  1SFU A;  3EQL F;  3E5U A;  4BHC A;  3BOQ A;  1KA8 A;  1AWC A;  4KFC A;  1XD7 A;  3FXR A;  3K69 A;  2V79 A;  3FM5 A;  1FC3 A;  4AWX B;  2E7W A;  5TRD A;  3KCC A;  2L54 A;  3FF5 A;  3V7R A;  2VXZ A;  1XGM A;  5ICC A;  1J59 A;  4MTE A;  2HWV A;  4BYY A;  3V8J A;  1EH7 A;  1LDK B;  2DI3 A;  4L9N A;  4U88 A;  3ROU A;  3B02 A;  2CYY A;  1B9N A;  5DUK A;  1A04 A;  3RYP A;  2M1B A;  5FD5 A;  2FU4 A;  5CJ9 A;  4OIP F;  4MNU A;  2VBZ A;  3KFW X;  4RGX A;  5J8C A;  3DPL C;  2C6Y A;  1KU2 A;  4OIN F;  1P4A A;  2A5Y B;  5A2Q Z;  3T0Y A;  2VBW A;  2X4H A;  5DUI A;  5K5O A;  2FMY A;  5CLS A;  3BJO A;  4M74 A;  4R8H A;  4I0B A;  4G8X A;  5D5V B;  4N9H A;  4KN7 X;  4B09 A;  1O57 A;  1UST A;  2HKO A;  1TW2 A;  1LEB A;  2F5D A;  5ILS A;  1TNT A;  2YX7 A;  2L4A A;  3B73 A;  1FY7 A;  2FBK A;  4EJV A;  3HSR A;  3HRM A;  2W84 A;  1FT9 A;  1SMY F;  3KEO A;  3MQ0 A;  1T6S A;  2O8X A;  3DQV C;  3CJN A;  5HLG A;  4IJA A;  3WTX C;  3OV8 A;  3BY6 A;  2WC2 A;  3E97 A;  5LLQ A;  3F8M A;  4M9S A;  6PAX A;  2QQB A;  3R4K A;  1DUX C;  1R5G A;  1EH8 A;  2P7C B;  4P5O A;  2L3D A;  2CO5 A;  3P7N A;  5D6E A;  4ESJ A;  1HW5 A;  2QBY B;  2ZNZ A;  1CF7 A;  2DK8 A;  2GZW A;  4XBF A;  5KK1 A;  4WXH A;  4MEX F;  2BE5 F;  4HQM A;  3E6C C;  2QZ8 A;  1L0O C;  4KIC A;  2EFP A;  2K4J A;  3TDU C;  3I54 A;  1U78 A;  2HFH A;  4KDP A;  4TV7 A;  4L9J A;  4HX4 A;  1G3T A;  1OYY A;  5F6F A;  2Y0M A;  2KJC A;  3KP2 A;  2MH9 A;  4A5N A;  2PJP A;  3IKV A;  4I01 A;  4BNC A;  4Y17 A;  2ZNY A;  3ZMD A;  1DPR A;  1ZLK A;  5E18 F;  4A0Z A;  2XAQ A;  3WE2 A;  5CVU A;  1F5T A;  3EYI A;  3VOD A;  2RNJ A;  3MAJ A;  2EFO A;  4CGZ A;  1ODD A;  2BV6 A;  3NQO A;  2OQR A;  3QAH A;  1V4R A;  2F5F A;  2STT A;  2Q0O A;  3TGN A;  1OKR A;  1P6R A;  4R79 A;  1HW1 A;  5FLX Z;  2IA1 A;  3C18 A;  3G3Z A;  2FF4 A;  1ULY A;  1BI2 A;  1IF1 A;  3I71 A;  3T5X A;  2OD5 A;  3O6B B;  1K78 B;  2COM A;  2PEX A;  4MHG A;  2QEN A;  2QLZ A;  5L3B A;  3L9F A;  1FSE A;  1S6L A;  4DNC A;  3HRT A;  3FXU A;  4Q47 A;  2F5C A;  5HOO A;  2NYX A;  5JI6 A;  3R6S A;  4HLX A;  3VB2 A;  1KU9 A;  1OMI A;  2FEZ A;  3FM3 A;  5K1Y A;  2ETH A;  4A0Y A;  3EYY A;  4DQ2 A;  1XGO A;  5FO5 A;  1W7P A;  2A07 F;  2D2W A;  1ON1 A;  2MH2 A;  3U2R A;  5FLX K;  3EET A;  2HR3 A;  5E1X A;  2DU9 A;  2Y48 A;  3WU0 A;  1P92 A;  3PQJ A;  2DFI A;  5DEQ A;  2VE9 A;  5JHU A;  5D8K B;  1P4X A;  2VON A;  1XDU A;  3EUH A;  2V6C A;  2YU3 A;  3Q9S A;  4U7B A;  4ENJ A;  2VN2 A;  2GAU A;  2EB7 A;  3ECH A;  1QO0 D;  2Q8K A;  5LRR A; 
#chains in the Genus database with same CATH topology
 2H1K A;  4GGG A;  4BE0 A;  1S7E A;  3K0L A;  2XKP A;  2IW5 A;  4LD5 A;  2R0Q C;  2VT2 A;  3BWG A;  3SFZ A;  5LD2 C;  4J00 A;  2D45 A;  3BZK A;  4NDL A;  4ETS A;  9ANT A;  1VQ4 I;  4IOC F;  4QWQ A;  2EJR A;  3AG3 H;  2M45 A;  4X0G A;  1OPC A;  2LFB A;  2QA4 I;  1VQ6 I;  5EGO A;  5HOD A;  1FTZ A;  2K3P A;  4BAY A;  1X58 A;  1TT0 A;  4RDU A;  2GLO A;  4HF0 A;  5IY5 H;  3W6V A;  2NS8 A;  2XGC A;  4CZC A;  3Q3S A;  5LFA A;  2HI3 A;  4FT8 A;  2BVL A;  5F08 A;  2L0K A;  2NVX J;  3I59 B;  1MNM C;  2P5V A;  2QQA A;  4XSX F;  4Y15 A;  2DAO A;  2PQ8 A;  3GXO A;  2EFN A;  1RC9 A;  3JAM Z;  2D1V A;  1KON A;  1A6Q A;  1IDY A;  2Z1D A;  4M3B A;  2ADU A;  2XAS A;  4CSW A;  1FYM A;  2UV1 A;  3DF8 A;  2IXS A;  4MFD A;  2R7R A;  4FQG A;  3CQZ J;  3Q5F A;  2JSC A;  3HB9 A;  2RGV A;  4ON0 A;  1I6H J;  3F3X A;  4LIT A;  4E7L A;  2R5Y B;  4AIH A;  2IGN A;  4RAZ A;  3K1P A;  2L01 A;  4FE7 A;  4HX7 A;  3SZT A;  3OR1 C;  4CCK A;  1QZZ A;  5KHD A;  5HDN A;  1ZGW A;  4ZDL A;  4ITV A;  2X51 A;  1A36 A;  1XMK A;  1B59 A;  2E2H J;  3BG5 A;  3CUQ A;  2Y0S N;  1OR7 A;  1Q1H A;  5ICF A;  2ZJ2 A;  3VSL A;  5F0F A;  3PUB A;  1E3P A;  4RGS A;  4F55 A;  2XB0 X;  2QYO A;  5DV5 A;  4HV5 A;  2EIL H;  3BTI A;  3HXL A;  4FTH A;  1MMN A;  3HUG A;  4UVC A;  1V3F A;  1CGP A;  1NG7 A;  5B5E C;  3FIS A;  4XM3 A;  4IPA A;  2DW4 A;  3BPX A;  3FK7 A;  2ZSH B;  5EF6 A;  4DZJ A;  3GYH X;  3M1C A;  4UVA A;  2GM4 A;  1MBH A;  1U9O A;  2OCC H;  2O3F A;  5H6R A;  2HPM A;  5CQG A;  1SAX A;  4IRH A;  4JK1 X;  1MBK A;  3HOX J;  2R93 J;  5EEH A;  4A2U A;  3SQN A;  1F43 A;  2D5V A;  3OMY A;  2PMH A;  4CUG A;  2W85 A;  3HRU A;  4IHT A;  2ZO4 A;  1MMA A;  1X4O A;  2JN6 A;  5FFX A;  2EA4 A;  3UR3 C;  5E17 F;  5HDK A;  2HKX A;  4LK1 F;  3G73 A;  2L2O A;  2UXN A;  3S15 J;  1S8N A;  1I27 A;  3GWZ A;  4J01 A;  3ECO A;  2X6Y A;  3RPU A;  1JKR C;  1XB4 A;  4CDG A;  2E36 A;  5LHI A;  5EGO B;  4C30 A;  1B8I A;  4AVZ A;  4ZH4 F;  3FBN B;  1FIA A;  4RMN A;  1WJ5 A;  2R7D A;  4C2U A;  2XAH A;  4BHB A;  1U5T B;  4WWC A;  1MMD A;  2VJI A;  3I4P A;  3SJM A;  1D5V A;  2WAQ A;  3OYJ A;  1VQM I;  3BG6 A;  3WGH A;  4L9V A;  3TW6 A;  4OIO F;  2VQG A;  5L3G A;  5C4J J;  2VBX A;  4ZTF A;  3LA3 A;  3TOA A;  2ELH A;  1GLN A;  1I1G A;  2OAZ A;  4L9T A;  5M5W J;  2A6E F;  4G7Z F;  2GA1 A;  4XLP F;  1UJ8 A;  1MMG A;  4L0Z B;  1WHU A;  3FKI J;  4HNU A;  2KIU A;  5E1W A;  1JKO C;  2FJ1 A;  1JTX A;  3IAS 2;  1XG1 A;  4RB2 C;  1YS6 A;  5BQT A;  1BM9 A;  1QQI A;  1RUO A;  3K1M A;  2Y69 H;  3RI4 A;  1YE9 A;  3F8B A;  4GFB A;  4YEJ A;  3RTR A;  3K4M A;  2MSY A;  4G12 A;  2X1D A;  2QSG X;  2MBF A;  1D1B A;  4B8X A;  1K83 J;  1TQI A;  3IWZ A;  1IN5 A;  2FX0 A;  3CF2 A;  1ZKG A;  3TED A;  1TQM A;  1BIB A;  2NNN A;  2X85 A;  4RBO A;  3QPH A;  5HLH A;  1FOW A;  2RVC A;  4ZTJ A;  4O5V A;  4LLG F;  1LFU P;  4XN0 A;  1VQN I;  1H8A C;  2AXL A;  2GXA A;  1FBQ A;  4JX4 A;  1G3Y A;  2XHK A;  1BI1 A;  1U0J A;  5FGM A;  4A93 J;  3MKL A;  3BR5 A;  4EM1 A;  1I50 J;  4A3I J;  2CMP A;  1SVL A;  3BZ6 A;  1NK2 P;  3WTS C;  2E1M C;  4BBR J;  5E3O A;  5K5Q A;  4BQQ A;  2WBM A;  4PJM A;  3J80 K;  3EDP A;  3J80 Z;  1O7L A;  2ZJR F;  3BCB A;  4D0P A;  2EK5 A;  2F2E A;  3BR1 A;  1HCR A;  2H27 A;  2IVM A;  4EM2 A;  3MFK A;  5F0C A;  1ZR4 A;  4GDF A;  5IOZ A;  2HS5 A;  3ZMZ A;  4Y33 A;  1ZYR F;  2ZXJ A;  2YU9 J;  5KAF C;  2DPU A;  4EMS A;  2DJI A;  3BQZ A;  1W0T A;  3KPH A;  1P9Q C;  3VYS B;  4MO7 A;  3VWB A;  3RPQ A;  2DT5 A;  4G7O F;  4HV6 A;  3TDZ C;  2QKM B;  4S05 A;  3ABK H;  2NVQ J;  2G0E A;  2IT0 A;  1WH7 A;  2LOO A;  2ECB A;  2YR2 A;  1RES A;  5CVV A;  2CWE A;  5DYM A;  3ZOB A;  2OC6 A;  1YIO A;  2K86 A;  2EV5 A;  3SZG A;  2HQR A;  2HOA A;  2ZC2 A;  2XAF A;  2K9L A;  2ID6 A;  3S2D J;  3GZ5 A;  1LPQ A;  2PX9 A;  1XTA A;  2FXA A;  2VKV A;  5AIP A;  1R9T J;  1CF7 B;  3L2U A;  2GA2 A;  2ISY A;  5EDN A;  5JVT A;  1MZB A;  4BUP A;  3M9A A;  2N8G A;  1NH3 A;  4LJZ F;  3ZQH A;  2WAE A;  1RR7 A;  1ZHF A;  3HSE A;  4Y7N J;  3L2C A;  4EJO A;  1TWC J;  1MJ9 A;  4JBA A;  4L5E A;  5IP9 J;  2L4M A;  1I3Q J;  3RKY A;  3HKZ A;  4EM0 B;  2Y75 A;  4CCN A;  1R5H A;  2EWN A;  3E5Q A;  2E2I J;  3K70 C;  3OYG A;  3PSF A;  5CVI A;  5H20 A;  2L7Z A;  1LFP A;  2O7O A;  4XQF A;  3CO6 C;  4A3M J;  3KZZ A;  3CCS I;  1B72 B;  4G6T B;  2CUF A;  3RCO A;  3S3M A;  5D6F A;  1OQY A;  3DLA A;  3TW7 A;  4F52 A;  1S7O A;  2DOA A;  2EH3 A;  3NWS A;  4U0Y A;  3J81 K;  5K7F A;  4AIJ A;  4A3B J;  4LG0 A;  3W2W A;  1YS7 A;  4E7Z A;  5F0H A;  3SZP A;  3MEX A;  5GTH C;  3WTW C;  2ISZ A;  3S3N A;  1RR8 C;  3S1M J;  3ZGK A;  2PMZ A;  1JGG A;  3LQQ A;  3IV5 A;  1ETX A;  1K78 A;  1D5Y A;  3FMR A;  1U8R A;  5M3F J;  2X6X A;  1FP2 A;  1B4A A;  1FP1 D;  3M8E A;  5DS9 A;  2AQF A;  3WE3 A;  4CO8 A;  3VOE A;  4MQ9 F;  2QQ9 A;  2M8E A;  4WCG A;  1KYW A;  3GO5 A;  4A3J J;  2VPL A;  2EZH A;  3GVA A;  4DYR A;  1VQ7 I;  3S2H J;  5JFR A;  3ESW B;  2XKO A;  4AM3 A;  1FOY A;  1ETO A;  2FNP A;  1JKP C;  1APL C;  1VTN C;  5ED4 A;  3TQN A;  1TL8 A;  1WJC A;  3CD6 I;  1L3L A;  2A6T A;  4H4K C;  1HKQ A;  4NNJ A;  4A5M A;  3TKY A;  4PDK A;  3ASO H;  1PJR A;  2CW8 A;  2FML A;  2BOL A;  5LBQ A;  2DFH A;  2XRO A;  1QPM A;  1X2M A;  3CUQ C;  4Q4Z F;  1F36 A;  2O5R A;  1R36 A;  1IXR C;  5FKK A;  2DA5 A;  3WU1 B;  4RB3 C;  3D0S A;  2M34 A;  4I76 A;  3CCR I;  1QNT A;  1J2X A;  3Q9V A;  3QP5 A;  4YIR X;  3HOS A;  3BG7 A;  5BS6 A;  4LG0 B;  1FMW A;  2XDV A;  4OIR F;  3CCV I;  2DFE A;  2PN6 A;  3VFZ A;  4LMY A;  2QKL B;  2UZK A;  4OMY A;  4A6D A;  2VE8 A;  4XLN F;  3H9G A;  1GXP A;  2F5E A;  2OZU A;  1ZTR A;  3MD2 A;  2DQL A;  2R3S A;  1IRZ A;  2Z99 A;  5J1R A;  3JSP A;  1Z0X A;  1FPQ A;  2Z5U A;  2EPF A;  2LRD A;  1D0X A;  4HF1 A;  1XCV A;  2K40 A;  2Z2S B;  3D1N I;  2WTE A;  4GCV A;  3FXO A;  2QM3 A;  1H9T A;  3HOZ J;  4D5F A;  2H1L A;  1BR1 A;  2CQK A;  2I8D A;  5E3M A;  3I58 A;  1X3U A;  2OF7 A;  2V1N A;  1XSX A;  1JUP A;  2O0Y A;  2DDA A;  5EJC A;  3HJE A;  3L2W A;  4PK4 A;  1WRJ A;  4X6A J;  5ERI A;  5EEA A;  5E8G A;  5DD4 A;  4CXF A;  4HOB A;  5L3D A;  1X1A A;  1BBY A;  2H09 A;  3M1E A;  2IRF G;  1ETK A;  4Q5S F;  1D8J A;  5J1U A;  3RKW A;  4EAT A;  2EZI A;  1IXS B;  1VF9 A;  2NOG A;  3V8K A;  2P8T A;  4M73 A;  1RUN A;  1CQT A;  3R0J A;  4RAY A;  2M7B A;  4E7I A;  3SHF A;  4ZYH A;  3FDY A;  2HOE A;  2XSJ C;  3I4M J;  1YW7 A;  2WV0 A;  3FXM A;  1XCB A;  3FMQ A;  1ON2 A;  1OFC X;  1E3O C;  4CCJ A;  5E3N A;  1T39 A;  1LB2 A;  3I0T A;  3IH2 A;  2F5V A;  3S17 J;  3CMY A;  1QRY A;  4UV8 A;  2P7V B;  2VOD A;  1S5L C;  4DZP A;  1OCT C;  5E8I A;  2FSW A;  1AKH A;  2YS9 A;  3QOD A;  2V7F A;  4HDV A;  3PO2 J;  2IS4 A;  4LOC A;  1N77 A;  2VBY A;  2LRE A;  3ZMS A;  2JMW A;  5H6Q A;  1HDP A;  2E1N A;  5HS9 A;  3FKJ A;  1N78 A;  4IO9 F;  1YG2 A;  2DTR A;  2H8R A;  3FMS A;  4PGH A;  4XOR A;  2YX4 A;  4PGG A;  4PJN A;  2EV6 A;  1BW5 A;  3KLO A;  2LR8 A;  4ZZL A;  2MYS A;  1EF4 A;  2ZKZ A;  4BEH A;  4UY8 I;  3LSI A;  4K2E A;  5CVJ A;  3WTY C;  3FHZ A;  1JE8 A;  1U9N A;  1JHH A;  2EIK H;  2UXX A;  2ZXW H;  2ESN A;  3C2H A;  1G2H A;  1TLH B;  3QU6 A;  4ASN A;  1WI9 A;  1KQ8 A;  5HLT A;  3ABT A;  5EG0 B;  3CCQ I;  4B1R A;  3HDD A;  1SVM A;  2ZME A;  2R7Z J;  1EV7 A;  3C3W A;  3ABM H;  3W6K B;  3RQ4 A;  3NEU A;  1JXS A;  1UG0 A;  3CUO A;  3GTO J;  4XLF A;  4V19 K;  1XGS A;  2CG4 A;  2DT6 A;  2LF7 A;  1O3T A;  3ML6 A;  3CZ6 A;  1PP7 U;  1R7J A;  4RLQ A;  1TBX A;  2BEO A;  4II3 A;  1O3Q A;  2QQ8 A;  3K9T A;  2LSO A;  2JA7 J;  2F4M B;  2IEK A;  2B0L A;  4CHU A;  1G4D A;  2EQR A;  3PIP F;  3KX2 A;  1T95 A;  3BT9 A;  1T2K A;  2IAI A;  1TWF J;  3LST A;  4XR6 A;  4BAC A;  2JVH A;  3GTK J;  1AKH B;  3ABU A;  3ISP A;  4XKV A;  3RJP A;  1ZG3 A;  1YTY A;  4N4N B;  2PI0 A;  4U7D A;  3J7Z I;  1HBX G;  2RQP A;  1DP7 P;  3LA7 A;  2K9N A;  3OYC A;  2R5Z A;  2E7X A;  4YG2 F;  2DLL A;  4F93 B;  1K6Y A;  4V2F A;  1C0W A;  1AU7 A;  5J40 A;  3F22 A;  4A3D J;  2P6T A;  4BJ6 C;  3HZJ A;  2M7A A;  4M6V A;  1F9N A;  1Z6T A;  2TDX A;  1YRN A;  3S1N J;  4NB5 A;  1IN8 A;  2W82 A;  1TWA J;  5A2Q K;  1UFM A;  1FWZ A;  1VI0 A;  3IAM 2;  1HKS A;  3K4C A;  1KYZ A;  4LIV A;  3HYI A;  1TTY A;  4XRF A;  2OQG A;  1OCP A;  1ZGJ A;  3OYK A;  2KLO A;  2XPW A;  3HKZ N;  2Q1Z B;  3P9I A;  3RSN A;  2R4G A;  1SMT A;  2JPC A;  3VEP A;  1U6G A;  4P55 A;  4HPQ A;  1JUM A;  3O3K A;  3WGG A;  3KP5 A;  4DYC A;  1RI7 A;  4BHP A;  3IH4 A;  4XNF A;  3P9C A;  2VPR A;  2IA0 A;  1Z05 A;  2RDP A;  4QSH A;  1MDM B;  4GO1 A;  3ZQQ A;  3RIR A;  1X1C A;  4ESB A;  1J75 A;  2OZ6 A;  1T38 A;  2I10 A;  1ZH5 A;  4PFP A;  5GAE J;  2CRG A;  2I5U A;  3KYC B;  4OOI A;  3AL0 B;  4XOP A;  5GAG J;  4I09 A;  5LHH A;  1KQ0 A;  1QU3 A;  3FXJ A;  4II2 A;  1R23 A;  4RB0 A;  4KN4 X;  4XKC A;  1YJ9 I;  3S1Q J;  2V9V A;  1S72 I;  2H6B A;  1DDN A;  4G94 A;  1XX5 A;  4JOM A;  2BBY A;  4HX8 A;  1BC8 C;  2R7F A;  4ESF A;  2KIQ A;  3LSH A;  1V5G A;  4O3M A;  2BW3 B;  3NRV A;  3NAR A;  4ENK A;  2EA2 A;  1W1W E;  3CUQ B;  1SAN A;  4KMU X;  4HLY A;  4RB1 A;  2ZME B;  1USS A;  4IRG A;  1S29 A;  2Z9O A;  2GIV A;  4E4H A;  3LMM A;  2TCT A;  4IHV A;  4XN3 A;  3IL2 A;  3K1N A;  1WWX A;  1LJ9 A;  4IXA A;  2K9M A;  4KIG A;  4MTD A;  3E6M A;  3FBI B;  3LSK A;  2E19 A;  3MCZ A;  3QU3 A;  2YPR A;  4FE4 A;  4NQW B;  4EGY A;  1Z9C A;  2V9K A;  3F6V A;  3PIO F;  5CYV A;  1ZG1 A;  1J9I A;  2FD5 A;  3UNG C;  3OSF A;  3U9G A;  1BW6 A;  3F8C A;  3REO A;  3ZP5 A;  2B9S A;  5EEG A;  4YRV A;  2DMQ A;  3F72 A;  5DM7 F;  2W57 A;  2NS7 A;  2M30 A;  1ZN2 A;  3E1S A;  1V5E A;  3GLX A;  3MKY B;  1JHF A;  5L3F A;  3OY9 A;  3JRA A;  2O8K A;  2PJR B;  2GBY A;  4WXD A;  3ZMT A;  1W0U A;  3CCY A;  2F48 A;  4ENM A;  1XN7 A;  2P5K A;  5LGN A;  3V4G A;  3F6O A;  1SFX A;  2HDD A;  3PM1 A;  2E71 A;  4Y4R A;  4I7H A;  3GTJ J;  2X9D A;  3I5U A;  2NVT J;  4UHT A;  4H0E A;  2IP2 A;  2FE3 A;  4BS9 A;  1N25 A;  3K4N A;  1QPI A;  3AAF A;  2V1D A;  2BW3 A;  3K4J A;  3FXQ A;  4YIF A;  5D4R A;  4AID A;  1RIO H;  4A3K J;  3PO3 J;  2VI6 A;  2XGX A;  1R1V A;  2LLK A;  3QPT A;  4DIQ A;  2VLA A;  2A68 F;  4YII A;  4D1Q A;  2YUS A;  4M72 A;  3K4K A;  2WY8 Q;  2LKS A;  3BRO A;  2BGC A;  3LSG A;  4FIS A;  1WGX A;  4G6Q A;  1Z1D A;  4XKW A;  4Z6Y A;  3ELK A;  1IN6 A;  3I56 I;  5ICE A;  1YYV A;  2CW0 F;  4J19 A;  4DYQ A;  1WKM A;  4WF2 A;  2LH9 A;  3LOC A;  4HNV A;  5J8F A;  4M71 A;  3DP7 A;  5FB2 A;  4LFU A;  1PUF A;  1T0F A;  3HOT A;  2HDC A;  1YLF A;  3E5X A;  1SD7 A;  3N4M A;  2XIG A;  4GYI A;  2OPT A;  1SFO J;  1I6X A;  4HG2 A;  3IRQ A;  4XRS A;  1LKX A;  1TQP A;  3OYB A;  3UKG A;  5AIQ A;  1LUJ B;  2NVU B;  2H94 A;  3QRF F;  3JW4 A;  3OYN A;  1NHA A;  2IS6 A;  2Y30 A;  3C1D A;  3GZ6 A;  4Y3O A;  3DTI A;  3HBL A;  2Z33 A;  1ZEL A;  3W2V A;  4AD9 A;  3VYU B;  2P5L C;  4XLC A;  1A5J A;  1A35 A;  2ME0 A;  5E1Z B;  3V7C A;  3WGI A;  2XB5 A;  3CJT B;  5EYR A;  3MZY A;  3HEF A;  1GVD A;  4EQQ A;  2E60 A;  3KET A;  2Z16 A;  1E0E A;  5EG0 A;  3M8F A;  1E17 A;  4DBR A;  3DPT A;  1LDD A;  3X2Q H;  4C2T A;  2JA8 J;  3S16 J;  3TO6 A;  4ZYE A;  1YIT I;  4YEL A;  5FJ8 J;  5IT9 K;  4S0H B;  2STW A;  1UCR A;  5DCF A;  3V42 A;  4XLA A;  1IAW A;  1RRJ A;  2E34 A;  4D7M A;  1ZQ3 P;  2IA2 A;  1WJA A;  2DYS H;  2ME6 A;  4S04 A;  1JT0 A;  5C44 J;  1QGP A;  1S7A A;  3BCA A;  2LKP A;  3DXJ F;  3SXY A;  2HYF A;  2PLY A;  1OLT A;  3O2P E;  1Y0U A;  2JSP A;  2OBP A;  2BYV E;  3O8H A;  1STZ A;  4CZZ A;  4XRM A;  4OMZ A;  1T8I A;  2VQL A;  4GXO A;  2GOX B;  3HRS A;  2W25 A;  5GPC A;  1M1E B;  2JK3 A;  3JRC A;  1K61 A;  4RA2 A;  3KP4 A;  2EFW A;  1IO2 A;  4IHY A;  4LIU A;  2EFQ A;  1OYI A;  2PFB A;  4BH9 A;  4EV0 A;  3LSM A;  5FKN A;  3GFJ A;  1W5T A;  1LEA A;  4FX0 A;  2WV1 A;  1W5C C;  1ZRC A;  2J5P A;  1T08 B;  1MJB A;  1UB9 A;  3BQY A;  5GPA A;  2WAD A;  3BJA A;  2IJL A;  5GTI C;  2BXZ A;  3RYR A;  2A6H F;  1WZ2 A;  1LQ1 A;  3KLN A;  4BKX A;  2VJJ A;  2AXT C;  2FA5 A;  4BDZ A;  1YQA A;  2ACJ A;  5JHF A;  5J47 A;  2KIS A;  4F7Z A;  4IHX A;  1O4X A;  2QWW A;  3S32 A;  3ZN0 A;  1TC3 C;  5IT9 Z;  3DEU A;  3H3U A;  4AYB A;  3JRI A;  1VFC A;  1R58 A;  3AKZ A;  2IGO A;  3KP7 A;  1TW3 A;  4EEF G;  2B7E A;  1MH3 A;  3QYB A;  1DGW Y;  2OCE A;  2K02 A;  3MZH A;  3F9K A;  1U2W A;  3B6C A;  2JRM A;  3U21 A;  4LB6 B;  2TRT A;  1MJA A;  2DO7 A;  3I53 A;  3PSI A;  4HF2 A;  4IHS A;  2GXG A;  1UHW A;  3SEQ A;  2B63 J;  3H35 A;  1LE8 B;  4PFO A;  3IHU A;  1HQC A;  1JJ8 C;  4O6J A;  3OL3 A;  1Z3X A;  1T33 A;  2DA3 A;  3QOP A;  4CYD A;  4I99 C;  4C3J J;  2DBB A;  3OS1 A;  2Z3Y A;  3AG1 H;  2JA6 J;  2M4G A;  3LNQ A;  1KZH A;  2K27 A;  3T8R A;  1H0M A;  2CQ7 A;  2GXB A;  3CCJ I;  3GBG A;  3PQK A;  4LGW A;  5GAH J;  3JRH A;  5BOX A;  5BPI A;  2DYR H;  1JUS A;  1VQK I;  4B3A A;  5TGT A;  2XAJ A;  4WXC A;  4AUX A;  4A3E J;  1K7A A;  4BQA A;  1FYK A;  2VJ5 A;  1ZAO A;  2KFD A;  2RV8 A;  4YFX F;  5F1R A;  3DU5 A;  2AS5 F;  2LNB A;  2JUG A;  2LY9 A;  2E1C A;  1MND A;  2R7X A;  4M9Z A;  3BJ6 A;  2KDO A;  2D1H A;  4XLH A;  4EVI A;  1BIA A;  2LY1 A;  3SFI A;  2A3S A;  4IQ4 A;  3GF2 A;  4HSR A;  1V54 H;  4OU0 A;  2ZCW A;  2HQ5 A;  3LSJ A;  5C3E J;  4L0Y B;  1PUE E;  4ZDO A;  2HYG D;  4HZF A;  1ZRF A;  1YW9 A;  1W5S A;  2LK2 A;  2OTL I;  1UHM A;  3I59 A;  3CC4 I;  4DOZ A;  2XAG A;  3DBL B;  3WOD F;  1BL0 A;  4A69 C;  2W24 A;  2XUB A;  3KZY A;  4E7K A;  4IQJ A;  3U1D A;  1MSE C;  4MGR A;  2E35 A;  2X48 A;  2HQN A;  3K4L A;  2WB1 A;  2NRA C;  5FLV A;  3HHG A;  4B43 A;  1V55 H;  4XID A;  4IEJ A;  4U0W A;  3DBH B;  5B1B H;  4HW0 A;  3DTE A;  2LDU A;  4RM3 A;  4MEY F;  1F1Z A;  2L5Q A;  5HS7 A;  2DTZ A;  3CLQ A;  2M9H A;  1FNN A;  1QZY A;  3IUO A;  2DA7 A;  1OYW A;  5FD6 A;  3CP8 A;  2CV2 A;  1J0R A;  2X1E A;  4RM2 A;  3Q0W A;  3ZRG A;  2XRN A;  4GRI A;  3HM5 A;  3M07 A;  2VQC A;  2QBY A;  4MFE A;  1WSU A;  4HDU A;  2HZD A;  1HF0 A;  3ZMV A;  3CTA A;  2CFX A;  2LF8 A;  4C2M J;  1S3J A;  2UWM A;  1HKT A;  3ZPL A;  2VOO A;  3G6E I;  3F21 A;  1T0F C;  3D5S C;  2LTP A;  1WVR A;  5DCM A;  1WI3 A;  1X1D A;  1ZAR A;  4KIB A;  4Q48 A;  3IKT A;  1BOA A;  2PG4 A;  4ABZ A;  1FJL A;  2FOK A;  2JT1 A;  4NQW A;  2E1O A;  3I4N J;  4QPO A;  1GHC A;  3J7A Y;  4I02 A;  1W36 D;  1AOY A;  3VYT B;  4IOA F;  1IZ1 A;  3R61 A;  2JVG A;  4MQV A;  5J6X A;  2E5Z A;  3TOB A;  2ZFW A;  1I3A A;  2VC1 A;  3IC7 A;  5DD8 A;  1Z7L A;  5M3M J;  3WG9 A;  3EUK L;  1WJF A;  2MC3 A;  3GFL A;  3W2A A;  4WX9 A;  2MC4 A;  2VC0 A;  3BPV A;  5L3C A;  4PSW A;  1IXC A;  4AVP A;  4KIT B;  3GTP J;  3LAP A;  3H1C A;  2QCO A;  2ZSI B;  3C2B A;  3GW2 A;  2QSF X;  3J81 Z;  2XGE A;  1REP C;  3ZCO A;  1MNE A;  1KGS A;  3OSG A;  1FSH A;  3BP8 A;  3A0H C;  2QF7 A;  2JUC A;  4AC0 A;  3KP6 A;  4ZZD A;  4P96 A;  3VPR A;  1O7F A;  4RGR A;  4FX4 A;  3L09 A;  3CDL A;  1YRN B;  4L5I A;  4G7H F;  4HNT A;  1BOB A;  1W7P B;  2M87 A;  1E2X A;  1XS9 A;  1GXQ A;  2XPU A;  4HST A;  3I55 I;  4RAF A;  4NC7 A;  3JTG A;  2JTV A;  4L5J A;  2QUF A;  3KYD B;  4IVN A;  3QWL A;  2VAS A;  2OA4 A;  2M8G X;  5FRM A;  3M4O J;  1EKE A;  1SD6 A;  3GCM A;  2ZBK A;  2NOJ B;  3CF5 F;  3TL4 X;  3L2Q A;  1EH6 A;  4UUV A;  3GFM A;  1QVU A;  1P2F A;  3V7S A;  3RPU D;  1PDN C;  2K3F A;  3L7W A;  3OIP A;  3OOU A;  2NAZ A;  3OYE A;  2DXI A;  1BR4 A;  3ZQC A;  1WJD A;  4U0V A;  5EZH A;  3JSO A;  1XC5 A;  3BR6 A;  2V4J C;  5J3L A;  3H92 A;  4BDY A;  2HNH A;  2JQ7 A;  1ZRD A;  5IYB J;  4LB5 A;  1IJW C;  3HGG A;  2ELK A;  2FBH A;  1J09 A;  3R0A A;  1YHQ I;  5D5W B;  1T98 A;  1ZK8 A;  2KRF A;  2L9R A;  2CQQ A;  4GYG A;  3F8F A;  5E79 C;  1RKT A;  2CJJ A;  4KUM A;  5IP6 A;  3MMY B;  5TIS C;  3HOV J;  3W6J B;  4DJA A;  2GIZ A;  3RZO J;  1ZGA A;  5K5R A;  2DOF A;  4HRI A;  1SD5 A;  3HL2 A;  1Y56 A;  1P7I A;  3L00 A;  4QIW N;  5L3E A;  3H9J A;  1YO5 C;  3CC7 I;  3NWT A;  2O03 A;  4CCO A;  3JRG A;  3A2K A;  1AA7 A;  2KP6 A;  2JWT A;  3BDD A;  4PJ0 C;  2CS3 A;  3WHC A;  4PZJ A;  4M9X A;  1LNW A;  2FRH A;  2XGD A;  2DPD A;  1ZLJ A;  1R4M B;  4KYW A;  5LRS A;  2M0M A;  2A61 A;  4WK8 F;  2OV7 A;  2RKH A;  3WTU C;  3DWL E;  1IUY A;  3IRR A;  1R49 A;  1MMS A;  4RGU A;  1XPX A;  3HUG B;  4BJ5 C;  5BMZ A;  1B6A A;  5ICG A;  1IUF A;  4FHT A;  4XIC A;  1FZP B;  4R1H A;  2HTS A;  1FBU A;  1H88 C;  1U5T C;  3DU6 A;  4G6D A;  5E20 A;  1RET A;  2K9S A;  3ZR8 X;  5DDG A;  2G7H A;  2PMZ N;  2VL8 A;  4B47 A;  1SD4 A;  4M3G A;  2HYJ A;  3GEZ A;  1R1U A;  5DM6 F;  3TMO A;  1A6I A;  2J5O A;  4D9J A;  4UXN A;  2P6S A;  2R7V A;  3HTU A;  3WTZ A;  3W3C A;  2BY3 A;  1HA8 A;  1WJB A;  3TBI A;  1VQL I;  4QTR A;  1FMV A;  1Z77 A;  1K6O A;  3A0B C;  3HOW J;  2E2J J;  3DKW A;  1U3E M;  3BG9 A;  2CV0 A;  2R7T A;  3ZQ7 A;  2CQN A;  5HDG A;  1UG2 A;  3J7Y J;  1XDS A;  3CDH A;  3R60 A;  2L9V A;  4BQO A;  1YFH A;  2VUM J;  5ILU A;  3M7G A;  1VQ9 I;  3GFI A;  1B9M A;  1IN7 A;  4BGD A;  4BXF A;  3GTQ J;  4FAS D;  3MWM A;  4M6X A;  4EJU A;  1IDZ A;  3L2R A;  1Z7U A;  1IV6 A;  2P4W A;  2XV4 S;  1G3W A;  1B1B A;  2W00 A;  3KE2 A;  5M5Y J;  2ID3 A;  1T56 A;  2NXN B;  4Z2Y A;  1G59 A;  4OAY A;  3PUF A;  4I2O A;  4BU2 A;  1HW2 A;  3KP3 A;  4OIQ F;  3RZD J;  5KAI C;  2CUE A;  1D0Y A;  1A31 A;  3PJR A;  4UNO A;  3PNV A;  5D4S A;  2WAF A;  1ACI A;  4JP0 A;  3M3Y J;  5LEJ A;  3F23 A;  1ZRE A;  3OR2 C;  4Y13 A;  2GWR A;  2BHZ A;  1ZG5 A;  1MW7 A;  4YFK F;  1U8B A;  3RKQ A;  3CCL I;  3ZXS A;  3WTT C;  3S2W A;  2CV1 A;  2O6G E;  2LD5 A;  2HPI A;  3HHH A;  2DMU A;  1F4K A;  1X2N A;  2K5C A;  4BE2 A;  2ZB9 A;  2F4O B;  2W7N A;  1SAU A;  2RC4 A;  3JRD A;  2EIJ H;  2A5W A;  2IGK A;  3DBR B;  2JZY A;  3DFG A;  2QVO A;  4N0B A;  4M3D A;  2HQA A;  3CLO A;  3MVP A;  1AHD P;  2IPQ X;  1I5Z A;  2JRT A;  2G9W A;  3GLL A;  4ZYA A;  1D1C A;  4LLL A;  4DGW B;  5D8L B;  1WJE A;  4LK0 F;  3GX4 X;  1LVK A;  3DKX A;  5LGT A;  3WU2 C;  1Z6R A;  3ZQI A;  5HS8 A;  1PVE A;  1IRF A;  2GQQ A;  5DTD A;  4NHJ A;  2NNY A;  1D3Y A;  3NAU A;  1NTC A;  1MBJ A;  2HGC A;  3S8P A;  1IRG A;  2NS0 A;  2VQH A;  4RS8 A;  2ESH A;  5KVR A;  2HDW A;  4HA8 A;  1I1S A;  3BR0 A;  5DCM B;  4CIC A;  5IP7 J;  3A02 A;  3ERE D;  1QA6 A;  1KU3 A;  3IWF A;  3N05 A;  3WTV C;  4HYE A;  2VIX A;  3H3Z A;  3MZ8 A;  1W4M A;  2AO9 A;  4NBQ A;  4PSX A;  1MSF C;  1W7P D;  2RN7 A;  4EJW A;  5IYC J;  4F3Q A;  3KYL A;  2VOP A;  1Y8Q B;  4B44 A;  3AG2 H;  3H0G J;  3OIQ A;  1WQ2 A;  1TNS A;  5BPD A;  3ONQ A;  1RNL A;  3E6B A;  2QEX I;  4A3F J;  5KCM A;  2L02 A;  3GUD A;  1HXD A;  1XGN A;  2PBI A;  2WWY A;  3SDB A;  5ILV A;  3GTG J;  3FX3 A;  5D5X B;  4P9U A;  1XSD A;  2DQR A;  2HXI A;  2KKO A;  3CP2 A;  2Y0S A;  4BEH B;  5AON A;  4KNY A;  4KT5 C;  1MBF A;  1SVO A;  4MLO A;  3K7A J;  2E5N A;  2K85 A;  2CGP A;  4AU7 A;  1LVA A;  2KZG A;  3BLY A;  1XMA A;  3FZV A;  1WCM J;  3ZMU A;  2DK5 A;  3FHN A;  1IN4 A;  3TO9 A;  1FLI A;  3LA2 A;  1GVJ A;  1IW7 F;  4HBL A;  3T1B A;  5CVR A;  3RDI A;  1TWH J;  1OCZ H;  2G7U A;  3OOP A;  5K7Z A;  2R7Q A;  4I98 B;  4UB6 C;  1P4W A;  2K4B A;  2KJB A;  2V1X A;  3LAJ A;  1Y39 A;  4IL6 C;  4DW6 A;  2HTJ A;  3SEZ A;  3DV8 A;  4XON A;  1U5T A;  3QP6 A;  4ZYG A;  1BI3 A;  3HIF A;  2FQ3 A;  1EA3 A;  2OUM A;  1PP8 F;  1O3S A;  1VQP I;  1FX7 A;  2E1M B;  3LQR A;  3U1K A;  2HZT A;  3BTC A;  3C7J A;  5LGU A;  5HLI A;  2XC7 A;  4JYK A;  1YW8 A;  4D5C A;  1Z91 A;  2M4K A;  3OS0 A;  2DA6 A;  2EBI A;  2M5W A;  1K79 A;  2PMU A;  3DEW A;  1ETW A;  3F8N A;  5HVQ C;  1LFB A;  4F91 B;  1YJN I;  4JQF A;  3EUA A;  3EPZ A;  3V8L A;  4EJT A;  3K2Z A;  4ENN A;  1MKM A;  1FYL A;  1POG A;  4E70 A;  5D5U B;  1E3H A;  3PFI A;  3KEQ A;  5JR3 A;  4NC8 A;  2IBD A;  2CFO A;  1R6R A;  2OU2 A;  1Z3Y A;  4KIF A;  2X0L A;  3GME A;  4BXU A;  1GDT A;  1J7K A;  4IF4 A;  2ZFU A;  2A69 F;  4UUS A;  1KU7 A;  3RKX A;  2LMD A;  2BY2 A;  1ETQ A;  2EV0 A;  5K7H A;  2CUZ A;  1GT0 C;  3A03 A;  4HQE A;  1LDJ A;  1YX5 A;  2RRE A;  5E3L A;  3H36 A;  4KA4 A;  1X1P A;  3RQI A;  5TJJ A;  5F27 A;  3QOE A;  3GZN B;  2COB A;  4XOT A;  3TO7 A;  2WA0 A;  1VQ8 I;  3DKY A;  3OYH A;  2RNG A;  4G9Y A;  1DPU A;  2DMT A;  3CME I;  4I6Z A;  1HST A;  3JCU C;  4UVB A;  3TP3 A;  2VXD A;  4W1U A;  3OYA A;  2BVM A;  4M6Y A;  2O61 A;  3CJQ B;  3K4B A;  1VND A;  1UAA A;  1BN5 A;  2LY2 A;  1UEL B;  3E7L A;  3HSF A;  3QPS A;  4B4C A;  4ZYD A;  1BA5 A;  2ECC A;  2XRL A;  2JJ7 A;  1OCO H;  1IG7 A;  2JA5 J;  2MGQ A;  4E7H A;  4A12 A;  4A0X A;  5LHG A;  2KIF A;  4KJZ A;  2K7L A;  3AFH A;  3N97 A;  4KMF A;  4E7S A;  2MA3 A;  2KIM A;  4XLE A;  2XPV A;  1WPK A;  3P9K A;  2MD0 A;  1MGT A;  4OAZ A;  4E6K G;  1X19 A;  5JVG F;  4UB8 C;  1Y8R B;  2DA2 A;  4KT6 A;  1D8K A;  4P9F A;  1Y0N A;  3PNT A;  1BJA A;  2XVC A;  2DFF A;  5BNG A;  1TP4 A;  1GV2 A;  2Q2E B;  4A6E A;  3DPU A;  2KRC A;  3FWE A;  3JAM K;  3CO7 C;  4UUT A;  1ERD A;  2RQQ A;  3H5A A;  3CES A;  1RPW A;  3COA C;  3CCE I;  3PNY A;  3D5R C;  4B3X A;  2HEO A;  4C3H J;  2LC2 A;  1R5I D;  4AIK A;  1KQ9 A;  2BXY A;  2FBI A;  1RZ4 A;  1SFE A;  1MDM A;  4UV9 A;  1JGS A;  4YFN F;  2AQE A;  2KT0 A;  2P0W A;  2LP0 A;  4I0A A;  1O3R A;  1FBS A;  3JTH A;  4BQN A;  4IRI A;  1NG6 A;  2XAU A;  2IS1 A;  3FXL A;  4IX7 A;  4A3C J;  1R00 A;  2V1U A;  3I3L A;  2DA1 A;  5J4Y A;  2CSO A;  2DOD A;  4N9I A;  2XSD C;  3HTS B;  1HOM A;  1YX3 A;  1DQU A;  3D5L A;  1Y1W J;  1R71 A;  2R5Z B;  5GAD J;  4XRS G;  4JX5 A;  2MD5 A;  4BY1 J;  1DP3 A;  4HEA 2;  2MG4 A;  1MD0 A;  3WHB A;  4EGZ A;  3CCU I;  3LFK A;  3J7A O;  2L9N A;  5EZG A;  4P1W A;  4L18 B;  1HSJ A;  2DDB A;  1XSV A;  4ANJ A;  2XF7 A;  1R1T A;  3BR3 A;  3KEY A;  3OL4 A;  4PJL A;  2DA4 A;  1UZC A;  5F64 A;  2MLG A;  2R7S A;  2Q2E A;  4QLC U;  3OS2 A;  1H9G A;  2CQX A;  4PCQ A;  3E3V A;  3QYF A;  2MLK A;  5FFZ A;  5J1Y A;  2W4S A;  4ZDP A;  1R22 A;  1G6N A;  4LLN A;  4HAM A;  1DGR M;  3ULQ B;  3E6D A;  5CQE A;  2ZXI A;  2V9P A;  1J5Y A;  3K6G A;  2DOE A;  2FNA A;  2R7O A;  2H6C A;  2X6W A;  4IZZ A;  1QBJ A;  1G3S A;  3LL7 A;  1FOK A;  4IKF A;  2EIN H;  5IT3 A;  3C2G A;  2YSR A;  2FUG 2;  4FET A;  1BI0 A;  3QPL A;  1BC7 C;  1K4S A;  3ZN1 A;  5J4V A;  2KPM A;  4XSZ F;  1ONV A;  5IPA A;  3T8T A;  1QVT A;  1YOV B;  2A05 A;  4ZJZ A;  3ERM A;  2VT3 A;  1WH5 A;  5LEK A;  1IGN A;  3I64 A;  3BTJ A;  2JPB A;  2WAQ N;  1NK3 P;  3LWF A;  3OYM A;  1SFU A;  3EQL F;  2L7K A;  3DEE A;  3IP4 B;  4XMY A;  3E5U A;  4BHC A;  3BOQ A;  1KA8 A;  1AWC A;  5C4X J;  4KFC A;  2M3A A;  1OCR H;  2EZK A;  1N75 A;  3BZC A;  1XD7 A;  3FXR A;  5FLM J;  3K69 A;  2V79 A;  3FM5 A;  1FC3 A;  2L7F P;  4AWX B;  5HNF A;  2V6E A;  2E7W A;  5TRD A;  1GUU A;  1Z67 A;  3KCC A;  2HXO A;  2L54 A;  2H8W A;  3ASN H;  1VZ0 A;  3FF5 A;  3V7R A;  1OIS A;  2IGM A;  2VXZ A;  4CH7 A;  3A01 A;  1XGM A;  2L7M P;  5ICC A;  3ZQL A;  1J59 A;  2M0C A;  3HOU J;  1R4N B;  4MTE A;  1VQ5 I;  2HWV A;  2HOT A;  2DJN A;  3O8G A;  1QZE A;  1TZL A;  2CW7 A;  4BYY A;  2VKE A;  3G1M A;  3V8J A;  1EH7 A;  1LDK B;  2DI3 A;  2R92 J;  4L9N A;  1I39 A;  4JX6 A;  4B48 A;  4U88 A;  5F1J A;  3A4C A;  4BY7 J;  2HVS A;  4FCY A;  2VKD A;  1ORK A;  3ROU A;  4PJJ A;  4NC6 A;  1FTT A;  3B02 A;  2CYY A;  3ZQG A;  2V26 A;  1B9N A;  2LYC A;  5DUK A;  3JRB A;  2GOM A;  1A04 A;  2KDZ A;  3RYP A;  2O9L A;  5FKM A;  5FRN A;  2M1B A;  5FD5 A;  2FU4 A;  1Q1V A;  5FKO A;  5CJ9 A;  3CMA I;  4OIP F;  2EIM H;  4MNU A;  2VBZ A;  4N4O B;  3KFW X;  2ZJP F;  4RGX A;  1D0Z A;  2Y2Z A;  2XF5 A;  5J8C A;  1MIJ A;  3DPL C;  3SDG A;  1H89 C;  1KU2 A;  3K2A A;  4NUB A;  1P4A A;  2A5Y B;  3CJR B;  4OIN F;  3HC7 A;  5A2Q Z;  3T0Y A;  2R7U A;  1OR7 C;  2IS2 A;  3K10 A;  2VBW A;  2X4H A;  3VSK A;  2DT7 B;  5DUI A;  3OYL A;  2PJR A;  5K5O A;  2BY0 A;  4CA0 A;  2CH0 A;  3FXK A;  2FMY A;  3CMM A;  3BJO A;  5CLS A;  4AYB N;  2HVQ A;  4M74 A;  2W48 A;  4R8H A;  4I0B A;  4G8X A;  5FRO A;  5D5V B;  2BZT A;  4N9H A;  4V2G A;  2LG4 A;  2ZME C;  2UUZ A;  4C9Y A;  4KN7 X;  2ICW G;  4CYC B;  3FK6 A;  4B09 A;  1O57 A;  1UST A;  1YI2 I;  2DN0 A;  2HKO A;  1TW2 A;  1LEB A;  4MIM A;  2KMU A;  4XL9 A;  2F5D A;  5ILS A;  1TNT A;  1S9H A;  2L4A A;  2YX7 A;  4CCL A;  3B73 A;  1FY7 A;  2F4I A;  2FBK A;  4EJV A;  2X1C A;  3HSR A;  2FOW A;  2DMP A;  3HRM A;  2W84 A;  3DLL F;  1VQO I;  3HG9 A;  1FT9 A;  3HGY A;  1SMY F;  3A01 B;  5CPR B;  3VYR B;  3BR2 A;  2KQR A;  3KEO A;  3MQ0 A;  3JR9 A;  3G71 I;  1YJW I;  1JI8 A;  1T6S A;  4U87 A;  1TWG J;  2O8X A;  5KNL A;  3DQV C;  3CJN A;  3G1O A;  5HLG A;  3MKZ A;  1SEU A;  4IJA A;  1HLV A;  1X3W B;  3ABL H;  3WTX C;  3OV8 A;  3BY6 A;  4M3E A;  4A3G J;  3F0C A;  1RKW A;  2WC2 A;  1ETY A;  3E97 A;  3LSP A;  5LLQ A;  3F8M A;  3BG3 A;  4M9S A;  5GP9 A;  3OWT A;  2L9S A;  4BL0 B;  2X6O A;  3E0J B;  6PAX A;  4OWR B;  4DBQ A;  1FOX A;  1HDD C;  3OYD A;  2QQB A;  3R4K A;  3JRF A;  3CDI A;  2DCE A;  1DUX C;  1R5G A;  1EH8 A;  2P7C B;  3S14 J;  4P5O A;  3CCM I;  2WB1 N;  2L3D A;  1OJL A;  2CO5 A;  3BC8 A;  3P7N A;  2MAB A;  1EJ9 A;  5D6E A;  4ESJ A;  3LFU A;  1HW5 A;  2QBY B;  2ZNZ A;  1CF7 A;  2DK8 A;  2GZW A;  4KIS A;  4XBF A;  2BY1 A;  2F6C A;  2W1O A;  5KK1 A;  2R7W A;  2MFZ A;  4WXH A;  2HU9 A;  4MEX F;  2P81 A;  2BE5 F;  4HQM A;  4IHW A;  5F04 A;  3E6C C;  2QZ8 A;  3G4S I;  1L0O C;  4KIC A;  2EFP A;  3GTM J;  1UMQ A;  2DMN A;  2K4J A;  5FKL A;  1UHS A;  3TDU C;  5IYD J;  3I54 A;  1ETV A;  3TP0 A;  3QQA A;  1U78 A;  2CU7 A;  3BTL A;  2HFH A;  4KDP A;  1DU6 A;  4TV7 A;  4L9J A;  4HX4 A;  1G8X A;  1PYV A;  5H2F C;  2LBF A;  3QYE A;  3WG7 H;  5HNH A;  1G3T A;  1OCC H;  1OYY A;  5F6F A;  1IV8 A;  2Y0M A;  5IOY A;  3S93 A;  4CYC A;  2KJC A;  3G2B A;  3HPG A;  3KP2 A;  2MH9 A;  4A5N A;  3G1L A;  2PJP A;  1BJZ A;  3IKV A;  4I01 A;  1IC8 A;  1MH4 A;  2Y31 A;  4F92 B;  4BNC A;  4Y17 A;  1P7J A;  2ZNY A;  3ZMD A;  4M3F A;  3H5N A;  2NVY J;  1IRX A;  1D1A A;  1DPR A;  1X4P A;  1ZLK A;  5E18 F;  4W97 A;  5B3S H;  1B8I B;  4A0Z A;  2XAQ A;  4LG3 A;  3WE2 A;  2EZL A;  3JRE A;  5CVU A;  3B6A A;  1F5T A;  2WY7 Q;  4PUS A;  3KIO A;  1X3Z B;  1YIJ I;  3EYI A;  3VOD A;  4CCM A;  1ZR2 A;  1BR2 A;  2RNJ A;  4BBS J;  3GTL J;  2CUJ A;  3MAJ A;  1JT6 A;  3EUH C;  2EFO A;  2M2E A;  1K4T A;  4CGZ A;  1ODD A;  2BV6 A;  2ZXH A;  3SYT A;  3NQO A;  2ZJQ F;  2OQR A;  3QAH A;  4BXX J;  5M5X J;  2KZV A;  1V4R A;  2F5F A;  2VKH A;  2HOS A;  2XF6 A;  2ELJ A;  3H3V K;  2FQ4 A;  2STT A;  2Q0O A;  3TGN A;  1OKR A;  3H9Q A;  1JJ6 C;  1GV5 A;  3H5R A;  1P6R A;  2KHM A;  3DCF A;  4R79 A;  2VJ4 A;  3S3O A;  1HW1 A;  5B1A H;  1TT5 B;  2AHQ A;  4UUS B;  1HC8 A;  5FLX Z;  1SFK A;  2IA1 A;  2RAE A;  3C18 A;  3G3Z A;  2FF4 A;  1ULY A;  3A1Y A;  1BI2 A;  4C3I J;  3I9V 2;  3I71 A;  3L2V A;  2LKX A;  1IF1 A;  3FIW A;  4BJT A;  3T5X A;  3AL0 C;  2OD5 A;  4X1E A;  3O6B B;  2COM A;  4QPQ A;  1K78 B;  2PEX A;  4MHG A;  2QEN A;  2QLZ A;  5B66 C;  2KL4 A;  4D7N A;  5L3B A;  1JKQ C;  1DU0 A;  3L9F A;  3LSR A;  1FSE A;  3IH3 A;  1S6L A;  1WFX A;  5CKT A;  4DNC A;  3HRT A;  4BE1 A;  1JTY A;  1Y1V J;  2JA2 A;  3K70 D;  3FXU A;  3L1P A;  4Q47 A;  4Y52 J;  1V5F A;  4XK4 A;  1Z21 A;  5JLW A;  2F5C A;  5HOO A;  3HPH A;  2NYX A;  1FIP A;  3MKW B;  2Y9Y A;  3Q0V A;  5JI6 A;  1ITY A;  1QHG A;  2LBF B;  2HVR A;  3R6S A;  2K9Q A;  4HLX A;  3DTK A;  3VB2 A;  1KU9 A;  3AG4 H;  2QGU A;  1OMI A;  3KZI C;  2FEZ A;  1FEX A;  3FM3 A;  5K1Y A;  2ETH A;  4A0Y A;  3EYY A;  3OYI A;  4RLF A;  3HOY J;  4DQ2 A;  1XGO A;  3M8J A;  5FO5 A;  1W7P A;  1XMX A;  2VB6 A;  2A07 F;  4ZC3 A;  3VDX A;  2D2W A;  3Q0U A;  3S1R J;  1ON1 A;  2QSH X;  2KRH A;  2MH2 A;  4RAG A;  3U2R A;  5FLX K;  1Y6I A;  3EET A;  3PFY A;  1ENH A;  2HR3 A;  5E1X A;  3P5J A;  2DU9 A;  2Y48 A;  2MW8 A;  3MN2 A;  1P92 A;  3PL8 A;  3WU0 A;  4A3L J;  3PQJ A;  2OTJ I;  5JLX A;  2DFI A;  5DEQ A;  2VE9 A;  3ZQF A;  5JHU A;  5D8K B;  1PUF B;  4E7J A;  1P4X A;  2BHY A;  1SC7 A;  1MBG A;  1B72 A;  2VON A;  1XDU A;  3EUH A;  2V6C A;  1QHH D;  2YU3 A;  3Q9S A;  4XKB A;  4U7B A;  4ENJ A;  1LE8 A;  2Y9Z A;  2LVS A;  3H0D A;  1X1B A;  2VN2 A;  2C6Y A;  3OYF A;  2GAU A;  3OIO A;  2EB7 A;  3ECH A;  2R5Y A;  2OJE D;  1QO0 D;  2Q8K A;  1MBE A;  1W36 C;  5LRR A;  3CC2 I; 
#chains in the Genus database with same CATH homology
 4GGG A;  3K0L A;  2XKP A;  2IW5 A;  4LD5 A;  2VT2 A;  3BWG A;  3SFZ A;  2D45 A;  4ETS A;  4QWQ A;  2EJR A;  2M45 A;  1OPC A;  4BAY A;  4HF0 A;  4FT8 A;  3I59 B;  2P5V A;  2QQA A;  4XSX F;  4Y15 A;  2DAO A;  2PQ8 A;  3GXO A;  2EFN A;  3JAM Z;  2D1V A;  2ADU A;  2XAS A;  1FYM A;  3DF8 A;  3Q5F A;  2JSC A;  4ON0 A;  2RGV A;  3F3X A;  4AIH A;  4RAZ A;  3K1P A;  2L01 A;  4HX7 A;  3SZT A;  1QZZ A;  5HDN A;  1XMK A;  1B59 A;  3CUQ A;  1OR7 A;  1Q1H A;  5ICF A;  2ZJ2 A;  4RGS A;  2QYO A;  5DV5 A;  4HV5 A;  3HUG A;  4UVC A;  1V3F A;  1CGP A;  4IPA A;  2DW4 A;  3BPX A;  3GYH X;  4UVA A;  2O3F A;  5H6R A;  1SAX A;  4IRH A;  4JK1 X;  5EEH A;  4A2U A;  3SQN A;  2PMH A;  2W85 A;  3HRU A;  4IHT A;  2ZO4 A;  5FFX A;  2EA4 A;  5E17 F;  5HDK A;  2HKX A;  4LK1 F;  3G73 A;  2UXN A;  1S8N A;  1I27 A;  3GWZ A;  3ECO A;  3RPU A;  1XB4 A;  4CDG A;  5LHI A;  4ZH4 F;  2R7D A;  2XAH A;  4BHB A;  1U5T B;  4WWC A;  3I4P A;  1D5V A;  3WGH A;  4L9V A;  4OIO F;  5L3G A;  2VBX A;  3LA3 A;  3TOA A;  2ELH A;  1I1G A;  2OAZ A;  4L9T A;  2A6E F;  4G7Z F;  2GA1 A;  4XLP F;  4L0Z B;  2KIU A;  5E1W A;  4RB2 C;  1YS6 A;  5BQT A;  1BM9 A;  1QQI A;  1RUO A;  3K1M A;  3RI4 A;  3F8B A;  3RTR A;  2MBF A;  4B8X A;  1TQI A;  3IWZ A;  1IN5 A;  1TQM A;  1BIB A;  2NNN A;  3QPH A;  5HLH A;  2RVC A;  4O5V A;  4LLG F;  2AXL A;  1FBQ A;  1G3Y A;  2XHK A;  1BI1 A;  5FGM A;  4EM1 A;  3BZ6 A;  3WTS C;  5K5Q A;  3J80 K;  3EDP A;  3J80 Z;  1O7L A;  4D0P A;  2EK5 A;  2F2E A;  2H27 A;  2IVM A;  4EM2 A;  3MFK A;  2HS5 A;  3ZMZ A;  1ZYR F;  2ZXJ A;  2DPU A;  4EMS A;  3RPQ A;  2DT5 A;  4G7O F;  4HV6 A;  3TDZ C;  4S05 A;  2IT0 A;  2YR2 A;  5CVV A;  2CWE A;  5DYM A;  1YIO A;  2K86 A;  2EV5 A;  2HQR A;  2XAF A;  3GZ5 A;  2FXA A;  5AIP A;  1CF7 B;  2GA2 A;  2ISY A;  5JVT A;  1MZB A;  3M9A A;  4LJZ F;  1ZHF A;  3HSE A;  3L2C A;  4EJO A;  1MJ9 A;  4JBA A;  2L4M A;  3RKY A;  4EM0 B;  2Y75 A;  1R5H A;  2EWN A;  3E5Q A;  5H20 A;  5CVI A;  3CO6 C;  3KZZ A;  5D6F A;  1S7O A;  4U0Y A;  3J81 K;  4AIJ A;  4LG0 A;  1YS7 A;  3SZP A;  3MEX A;  3WTW C;  2ISZ A;  3LQQ A;  1K78 A;  3FMR A;  1U8R A;  1FP2 A;  3M8E A;  1B4A A;  1FP1 D;  3WE3 A;  4CO8 A;  3VOE A;  4MQ9 F;  2QQ9 A;  2M8E A;  4WCG A;  1KYW A;  3GO5 A;  3GVA A;  5JFR A;  2XKO A;  2FNP A;  1VTN C;  5ED4 A;  3TQN A;  1L3L A;  1HKQ A;  4A5M A;  3TKY A;  4PDK A;  2FML A;  5LBQ A;  2XRO A;  1QPM A;  3CUQ C;  4Q4Z F;  1R36 A;  1IXR C;  3WU1 B;  4RB3 C;  3D0S A;  1QNT A;  1J2X A;  3Q9V A;  3QP5 A;  3HOS A;  5BS6 A;  4LG0 B;  4OIR F;  2PN6 A;  3VFZ A;  4LMY A;  2UZK A;  4OMY A;  4A6D A;  2VE8 A;  4XLN F;  1GXP A;  2F5E A;  2OZU A;  2DQL A;  2R3S A;  2Z99 A;  3JSP A;  1FPQ A;  2Z5U A;  4HF1 A;  1XCV A;  2WTE A;  4GCV A;  2QM3 A;  1H9T A;  2CQK A;  3I58 A;  1X3U A;  1XSX A;  2O0Y A;  1WRJ A;  5ERI A;  5E8G A;  5DD4 A;  4CXF A;  4HOB A;  5L3D A;  1BBY A;  2H09 A;  3M1E A;  2IRF G;  1D8J A;  4Q5S F;  3RKW A;  1IXS B;  3V8K A;  2P8T A;  4M73 A;  1RUN A;  3R0J A;  4RAY A;  3SHF A;  4ZYH A;  2HOE A;  1YW7 A;  2WV0 A;  1XCB A;  3FMQ A;  1ON2 A;  1T39 A;  1LB2 A;  3I0T A;  4UV8 A;  2P7V B;  2VOD A;  5E8I A;  2FSW A;  4HDV A;  2VBY A;  3ZMS A;  5H6Q A;  5HS9 A;  2E1N A;  1YG2 A;  2DTR A;  3FMS A;  4PGH A;  2YX4 A;  4PGG A;  2EV6 A;  3KLO A;  4ZZL A;  2ZKZ A;  4K2E A;  5CVJ A;  3WTY C;  3FHZ A;  1JE8 A;  1JHH A;  2UXX A;  2ESN A;  1TLH B;  3QU6 A;  4ASN A;  1WI9 A;  1KQ8 A;  3ABT A;  2ZME A;  1EV7 A;  3C3W A;  3W6K B;  3NEU A;  1JXS A;  3CUO A;  1XGS A;  2CG4 A;  2LF7 A;  1O3T A;  3ML6 A;  1PP7 U;  1R7J A;  1TBX A;  2BEO A;  1O3Q A;  3K9T A;  2LSO A;  2B0L A;  4CHU A;  1G4D A;  1T2K A;  3LST A;  3ABU A;  3ISP A;  3RJP A;  1ZG3 A;  2PI0 A;  1YTY A;  4U7D A;  1HBX G;  2RQP A;  1DP7 P;  3LA7 A;  2E7X A;  4YG2 F;  2DLL A;  1C0W A;  3F22 A;  2P6T A;  1F9N A;  1Z6T A;  2TDX A;  4NB5 A;  1IN8 A;  5A2Q K;  1UFM A;  1FWZ A;  1HKS A;  1KYZ A;  3HYI A;  1TTY A;  4XRF A;  2OQG A;  1ZGJ A;  3P9I A;  1SMT A;  2JPC A;  3VEP A;  1U6G A;  4P55 A;  3O3K A;  3WGG A;  3KP5 A;  1RI7 A;  4BHP A;  3P9C A;  2IA0 A;  1Z05 A;  2RDP A;  1MDM B;  4GO1 A;  3RIR A;  4ESB A;  1J75 A;  2OZ6 A;  1T38 A;  1ZH5 A;  4OOI A;  4I09 A;  5LHH A;  1KQ0 A;  1R23 A;  4RB0 A;  4KN4 X;  2V9V A;  2H6B A;  1DDN A;  4G94 A;  2BBY A;  4HX8 A;  1BC8 C;  2R7F A;  4ESF A;  4O3M A;  3NRV A;  4ENK A;  2EA2 A;  3CUQ B;  4KMU X;  4HLY A;  4RB1 A;  2ZME B;  1USS A;  4IRG A;  1S29 A;  2Z9O A;  2GIV A;  3IL2 A;  3K1N A;  1WWX A;  1LJ9 A;  4IXA A;  4KIG A;  4MTD A;  3E6M A;  3QU3 A;  3MCZ A;  1Z9C A;  2YPR A;  4EGY A;  3F6V A;  5CYV A;  1ZG1 A;  1J9I A;  3U9G A;  3F8C A;  3REO A;  3ZP5 A;  5EEG A;  3F72 A;  2W57 A;  2M30 A;  1ZN2 A;  3GLX A;  1JHF A;  5L3F A;  4WXD A;  3ZMT A;  4ENM A;  1XN7 A;  2P5K A;  5LGN A;  3V4G A;  3F6O A;  1SFX A;  4I7H A;  3I5U A;  4UHT A;  4H0E A;  2IP2 A;  2FE3 A;  3AAF A;  2V1D A;  3FXQ A;  4YIF A;  5D4R A;  1RIO H;  2XGX A;  1R1V A;  3QPT A;  2A68 F;  4YII A;  4M72 A;  3BRO A;  2BGC A;  4G6Q A;  1Z1D A;  3ELK A;  1IN6 A;  5ICE A;  1YYV A;  2CW0 F;  1WKM A;  4WF2 A;  5J8F A;  4M71 A;  3DP7 A;  5FB2 A;  4LFU A;  1T0F A;  3HOT A;  2HDC A;  1YLF A;  3E5X A;  1SD7 A;  3N4M A;  2XIG A;  4GYI A;  1I6X A;  3IRQ A;  1TQP A;  5AIQ A;  2H94 A;  3QRF F;  3JW4 A;  1NHA A;  3C1D A;  3GZ6 A;  2Z33 A;  4AD9 A;  2P5L C;  3V7C A;  5E1Z B;  3WGI A;  3MZY A;  4EQQ A;  3KET A;  3M8F A;  1E17 A;  3DPT A;  1LDD A;  3TO6 A;  4ZYE A;  5IT9 K;  2STW A;  1UCR A;  5DCF A;  1IAW A;  2IA2 A;  4S04 A;  1QGP A;  1S7A A;  2LKP A;  3DXJ F;  3SXY A;  2HYF A;  2PLY A;  3O2P E;  1Y0U A;  2OBP A;  2BYV E;  1STZ A;  4CZZ A;  4OMZ A;  4GXO A;  3HRS A;  2W25 A;  3KP4 A;  2EFW A;  2EFQ A;  1OYI A;  2PFB A;  4BH9 A;  4EV0 A;  3GFJ A;  1W5T A;  1LEA A;  4FX0 A;  1ZRC A;  2J5P A;  1MJB A;  1UB9 A;  3BJA A;  2IJL A;  3RYR A;  2A6H F;  1LQ1 A;  3KLN A;  2FA5 A;  1YQA A;  2ACJ A;  4F7Z A;  2QWW A;  5IT9 Z;  3ZN0 A;  3DEU A;  3H3U A;  1R58 A;  3KP7 A;  1TW3 A;  2K02 A;  3MZH A;  1U2W A;  4LB6 B;  4HF2 A;  1MJA A;  2DO7 A;  3I53 A;  4IHS A;  2GXG A;  1UHW A;  3IHU A;  1HQC A;  4O6J A;  3QOP A;  4CYD A;  2DBB A;  2Z3Y A;  2K27 A;  3T8R A;  1H0M A;  2GXB A;  4LGW A;  3PQK A;  5BPI A;  5BOX A;  2XAJ A;  4WXC A;  1K7A A;  4BQA A;  1FYK A;  1ZAO A;  2RV8 A;  4YFX F;  5F1R A;  2AS5 F;  2LNB A;  2E1C A;  4M9Z A;  3BJ6 A;  2D1H A;  4EVI A;  1BIA A;  2A3S A;  3GF2 A;  4OU0 A;  2ZCW A;  4L0Y B;  1PUE E;  2HYG D;  4HZF A;  1ZRF A;  1YW9 A;  1W5S A;  1UHM A;  3I59 A;  2XAG A;  3WOD F;  2W24 A;  2XUB A;  3KZY A;  3U1D A;  4MGR A;  2HQN A;  2NRA C;  3HHG A;  4U0W A;  4HW0 A;  2LDU A;  4MEY F;  1F1Z A;  5HS7 A;  1FNN A;  1QZY A;  1OYW A;  5FD6 A;  1J0R A;  2XRN A;  2QBY A;  1WSU A;  4HDU A;  3ZMV A;  2CFX A;  2LF8 A;  3CTA A;  1S3J A;  2UWM A;  1HKT A;  3ZPL A;  2VOO A;  3F21 A;  5DCM A;  1ZAR A;  4KIB A;  4Q48 A;  3IKT A;  1BOA A;  2PG4 A;  2FOK A;  2JT1 A;  4NQW A;  1GHC A;  4I02 A;  1AOY A;  1IZ1 A;  3R61 A;  4MQV A;  5J6X A;  3TOB A;  2ZFW A;  3IC7 A;  2VC1 A;  5DD8 A;  3WG9 A;  2MC3 A;  3GFL A;  4WX9 A;  2VC0 A;  3BPV A;  5L3C A;  1IXC A;  4AVP A;  3LAP A;  3GW2 A;  3J81 Z;  1REP C;  1KGS A;  1FSH A;  3BP8 A;  3KP6 A;  4ZZD A;  4P96 A;  1O7F A;  4RGR A;  4FX4 A;  3L09 A;  4L5I A;  4G7H F;  1W7P B;  2M87 A;  1E2X A;  1GXQ A;  3JTG A;  2JTV A;  4L5J A;  2QUF A;  4IVN A;  2OA4 A;  1SD6 A;  2ZBK A;  1EH6 A;  4UUV A;  3GFM A;  1P2F A;  3V7S A;  1PDN C;  3L7W A;  2NAZ A;  4U0V A;  3JSO A;  3H92 A;  1ZRD A;  4LB5 A;  2FBH A;  3R0A A;  5D5W B;  1T98 A;  2KRF A;  4GYG A;  3F8F A;  4KUM A;  3W6J B;  1ZGA A;  5K5R A;  1SD5 A;  3L00 A;  5L3E A;  1YO5 C;  2O03 A;  3BDD A;  4PZJ A;  4M9X A;  1LNW A;  2FRH A;  2DPD A;  1ZLJ A;  4KYW A;  5LRS A;  2A61 A;  4WK8 F;  2RKH A;  3WTU C;  1IUY A;  3IRR A;  4RGU A;  5BMZ A;  1B6A A;  5ICG A;  4FHT A;  1FZP B;  4R1H A;  2HTS A;  1FBU A;  1U5T C;  4G6D A;  5E20 A;  5DDG A;  2G7H A;  1SD4 A;  3GEZ A;  1R1U A;  2J5O A;  4UXN A;  2P6S A;  3HTU A;  3WTZ A;  1K6O A;  3DKW A;  1U3E M;  3ZQ7 A;  5HDG A;  1XDS A;  3CDH A;  3R60 A;  1YFH A;  5ILU A;  3M7G A;  3GFI A;  1B9M A;  1IN7 A;  3MWM A;  4M6X A;  4EJU A;  1Z7U A;  2P4W A;  2XV4 S;  1G3W A;  1B1B A;  3KE2 A;  4I2O A;  4Z2Y A;  1HW2 A;  3KP3 A;  4OIQ F;  4UNO A;  5D4S A;  5LEJ A;  3F23 A;  1ZRE A;  4Y13 A;  2GWR A;  1ZG5 A;  4YFK F;  3WTT C;  3S2W A;  2O6G E;  3HHH A;  1F4K A;  2RC4 A;  2JZY A;  3DFG A;  2QVO A;  4N0B A;  3CLO A;  2IPQ X;  1I5Z A;  2JRT A;  2G9W A;  4LLL A;  5D8L B;  4LK0 F;  3GX4 X;  5LGT A;  1Z6R A;  5HS8 A;  1IRF A;  2GQQ A;  4NHJ A;  2NNY A;  1D3Y A;  2HGC A;  1IRG A;  2NS0 A;  4RS8 A;  2ESH A;  5KVR A;  4HA8 A;  1I1S A;  5DCM B;  4CIC A;  3ERE D;  1KU3 A;  3IWF A;  3WTV C;  4HYE A;  3H3Z A;  1W4M A;  1W7P D;  2RN7 A;  4EJW A;  2VOP A;  1WQ2 A;  1TNS A;  5BPD A;  1RNL A;  3E6B A;  2L02 A;  3GUD A;  1HXD A;  1XGN A;  2PBI A;  2WWY A;  5ILV A;  3FX3 A;  5D5X B;  4P9U A;  1XSD A;  2DQR A;  2KKO A;  5AON A;  4KNY A;  4KT5 C;  2CGP A;  1LVA A;  1XMA A;  3FZV A;  3ZMU A;  2DK5 A;  1IN4 A;  3TO9 A;  1FLI A;  3LA2 A;  1GVJ A;  1IW7 F;  4HBL A;  3T1B A;  5CVR A;  3RDI A;  2G7U A;  3OOP A;  4I98 B;  1P4W A;  2K4B A;  2KJB A;  2V1X A;  3LAJ A;  2HTJ A;  3DV8 A;  1U5T A;  3QP6 A;  4ZYG A;  1BI3 A;  3HIF A;  2FQ3 A;  1PP8 F;  1O3S A;  1FX7 A;  3LQR A;  2HZT A;  3C7J A;  5LGU A;  5HLI A;  1YW8 A;  1Z91 A;  2M5W A;  1K79 A;  2PMU A;  3F8N A;  5HVQ C;  4JQF A;  3V8L A;  4EJT A;  4ENN A;  1FYL A;  1MKM A;  3K2Z A;  4E70 A;  5D5U B;  3PFI A;  3KEQ A;  5JR3 A;  2OU2 A;  4KIF A;  2X0L A;  4BXU A;  1J7K A;  4IF4 A;  2A69 F;  1KU7 A;  3RKX A;  2EV0 A;  4HQE A;  1LDJ A;  4KA4 A;  5TJJ A;  3TO7 A;  1DPU A;  4G9Y A;  1HST A;  4UVB A;  4M6Y A;  2O61 A;  1BN5 A;  3HSF A;  4ZYD A;  4A12 A;  4A0X A;  5LHG A;  2KIF A;  2K7L A;  3N97 A;  4KMF A;  2MA3 A;  2KIM A;  3P9K A;  1MGT A;  1D8K A;  4P9F A;  1BJA A;  2XVC A;  4A6E A;  3FWE A;  3JAM K;  3CO7 C;  3COA C;  2HEO A;  4AIK A;  1KQ9 A;  2FBI A;  1RZ4 A;  1SFE A;  1MDM A;  4UV9 A;  1JGS A;  4YFN F;  1O3R A;  4I0A A;  1FBS A;  3JTH A;  4IRI A;  1R00 A;  2V1U A;  2CSO A;  4N9I A;  3HTS B;  3D5L A;  2MD5 A;  1MD0 A;  4EGZ A;  3LFK A;  3J7A O;  4L18 B;  1HSJ A;  1XSV A;  1R1T A;  5F64 A;  2MLG A;  2Q2E A;  4QLC U;  1H9G A;  4PCQ A;  3E3V A;  2MLK A;  5FFZ A;  1R22 A;  1G6N A;  4LLN A;  4HAM A;  3ULQ B;  3E6D A;  1J5Y A;  2FNA A;  2H6C A;  1QBJ A;  1G3S A;  1FOK A;  5IT3 A;  2YSR A;  1BI0 A;  1BC7 C;  3ZN1 A;  4XSZ F;  1ONV A;  3T8T A;  2VT3 A;  5LEK A;  3I64 A;  2JPB A;  3LWF A;  1SFU A;  3EQL F;  3E5U A;  4BHC A;  3BOQ A;  1KA8 A;  1AWC A;  4KFC A;  1XD7 A;  3FXR A;  3K69 A;  2V79 A;  3FM5 A;  1FC3 A;  4AWX B;  2E7W A;  5TRD A;  3KCC A;  2L54 A;  3FF5 A;  3V7R A;  2VXZ A;  1XGM A;  5ICC A;  1J59 A;  4MTE A;  2HWV A;  4BYY A;  3V8J A;  1EH7 A;  1LDK B;  2DI3 A;  4L9N A;  4U88 A;  3ROU A;  3B02 A;  2CYY A;  1B9N A;  5DUK A;  1A04 A;  3RYP A;  2M1B A;  5FD5 A;  2FU4 A;  5CJ9 A;  4OIP F;  4MNU A;  2VBZ A;  3KFW X;  4RGX A;  5J8C A;  3DPL C;  2C6Y A;  1KU2 A;  4OIN F;  1P4A A;  2A5Y B;  5A2Q Z;  3T0Y A;  2VBW A;  2X4H A;  5DUI A;  5K5O A;  2FMY A;  5CLS A;  3BJO A;  4M74 A;  4R8H A;  4I0B A;  4G8X A;  5D5V B;  4N9H A;  4KN7 X;  4B09 A;  1O57 A;  1UST A;  2HKO A;  1TW2 A;  1LEB A;  2F5D A;  5ILS A;  1TNT A;  2YX7 A;  2L4A A;  3B73 A;  1FY7 A;  2FBK A;  4EJV A;  3HSR A;  3HRM A;  2W84 A;  1FT9 A;  1SMY F;  3KEO A;  3MQ0 A;  1T6S A;  2O8X A;  3DQV C;  3CJN A;  5HLG A;  4IJA A;  3WTX C;  3OV8 A;  3BY6 A;  2WC2 A;  3E97 A;  5LLQ A;  3F8M A;  4M9S A;  6PAX A;  2QQB A;  3R4K A;  1DUX C;  1R5G A;  1EH8 A;  2P7C B;  4P5O A;  2L3D A;  2CO5 A;  3P7N A;  5D6E A;  4ESJ A;  1HW5 A;  2QBY B;  2ZNZ A;  1CF7 A;  2DK8 A;  2GZW A;  4XBF A;  5KK1 A;  4WXH A;  4MEX F;  2BE5 F;  4HQM A;  3E6C C;  2QZ8 A;  1L0O C;  4KIC A;  2EFP A;  2K4J A;  3TDU C;  3I54 A;  1U78 A;  2HFH A;  4KDP A;  4TV7 A;  4L9J A;  4HX4 A;  1G3T A;  1OYY A;  5F6F A;  2Y0M A;  2KJC A;  3KP2 A;  2MH9 A;  4A5N A;  2PJP A;  3IKV A;  4I01 A;  4BNC A;  4Y17 A;  2ZNY A;  3ZMD A;  1DPR A;  1ZLK A;  5E18 F;  4A0Z A;  2XAQ A;  3WE2 A;  5CVU A;  1F5T A;  3EYI A;  3VOD A;  2RNJ A;  3MAJ A;  2EFO A;  4CGZ A;  1ODD A;  2BV6 A;  3NQO A;  2OQR A;  3QAH A;  1V4R A;  2F5F A;  2STT A;  2Q0O A;  3TGN A;  1OKR A;  1P6R A;  4R79 A;  1HW1 A;  5FLX Z;  2IA1 A;  3C18 A;  3G3Z A;  2FF4 A;  1ULY A;  1BI2 A;  1IF1 A;  3I71 A;  3T5X A;  2OD5 A;  3O6B B;  1K78 B;  2COM A;  2PEX A;  4MHG A;  2QEN A;  2QLZ A;  5L3B A;  3L9F A;  1FSE A;  1S6L A;  4DNC A;  3HRT A;  3FXU A;  4Q47 A;  2F5C A;  5HOO A;  2NYX A;  5JI6 A;  3R6S A;  4HLX A;  3VB2 A;  1KU9 A;  1OMI A;  2FEZ A;  3FM3 A;  5K1Y A;  2ETH A;  4A0Y A;  3EYY A;  4DQ2 A;  1XGO A;  5FO5 A;  1W7P A;  2A07 F;  2D2W A;  1ON1 A;  2MH2 A;  3U2R A;  5FLX K;  3EET A;  2HR3 A;  5E1X A;  2DU9 A;  2Y48 A;  3WU0 A;  1P92 A;  3PQJ A;  2DFI A;  5DEQ A;  2VE9 A;  5JHU A;  5D8K B;  1P4X A;  2VON A;  1XDU A;  3EUH A;  2V6C A;  2YU3 A;  3Q9S A;  4U7B A;  4ENJ A;  2VN2 A;  2GAU A;  2EB7 A;  3ECH A;  1QO0 D;  2Q8K A;  5LRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...