1VTNC

Co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
b'HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*GP*AP*CP*TP*AP*AP*GP*TP*CP*AP*AP*CP*C)-3')
publication title Co-Crystal Structure of the HNF-3/Fork Head DNA-Recognition Motif Resembles Histone H5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1vtnC00
4ENKA 2P7VB 1TW2A 4GGGA 3JW4A 3T0YA 2QENA 2IT0A 5AONA 2XAJA 2L3DA 1YQAA 1F9NA 1BJAA 2ZNYA 3ZMVA 4GYIA 4EJUA 4M9SA 3J81K 1ZG1A 5K1YA 3LA2A 1HKSA 2OA4A 3Q9VA 4I2OA 4MGRA 1IN5A 5TJJA 2HS5A 2A5YB 1IN8A 4MQ9F 2MC3A 3T5XA 3GZ6A 2OD5A 3I54A 4IVNA 5HDGA 5HS8A 2HFHA 3K69A 4KN4X 4KN7X 2E1CA 1U5TB 4BH9A 4IRGA 4B09A 3RKXA 2IA2A 3E5UA 4KUMA 2Y75A 5AIPA 4DNCA 1SFUA 3K1PA 1R1TA 4Z2YA 1P2FA 3J80Z 3MFKA 2L02A 4EJVA 4L9NA 1MDMA 4G7OF 5JVTA 3GF2A 4HOBA 3TO6A 1CGPA 2VXZA 2HTSA 1OMIA 3HRUA 2GAUA 3GZ5A 1TTYA 2DQLA 2MH9A 4BNCA 3Q5FA 1SMTA 1YS7A 3HIFA 3ZMDA 2EK5A 2K27A 3KEQA 1WSUA 3HRTA 2ETHA 1KQ9A 2P5KA 3E6MA 4I01A 4KDPA 3GFMA 5AIQA 2FMLA 3E97A 1GHCA 5DCFA 5E8IA 1R5GA 1QGPA 4HZFA 2QLZA 3LQQA 3SQNA 4JQFA 1LDKB 2ZMEB 3WTSC 4M6YA 2BE5F 4GCVA 3IKTA 3WGHA 1YW9A 4RB2C 4GYGA 2XIGA 3IRQA 3ROUA 4ESFA 3P9KA 1IF1A 3E6CC 3WTUC 1YYVA 2XHKA 4AIHA 2XRNA 1W4MA 1SD7A 2ZFWA 2EA2A 5DCMA 4PZJA 3JAMZ 2JZYA 3EQLF 3ZMSA 4LK0F 4ZYDA 2LDUA 4O5VA 1K79A 3T8RA 2RNJA 2G9WA 3HSFA 1Z9CA 2M45A 1KU3A 1F5TA 2F5EA 4CYDA 1YS6A 2PI0A 2ZKZA 1Z91A 2O6GE 2UXXA 5HLHA 1ZREA 2O8XA 2HZTA 3LAJA 4TV7A 5HDKA 3TGNA 2P5LC 1T0FA 2Q2EA 1O3SA 2COMA 4L0YB 5LRSA 2WV0A 5D4SA 5F64A 5LBQA 2Z33A 5KK1A 4ASNA 1T98A 1OYWA 3D5LA 5K5QA 1IRGA 3L7WA 4LLNA 1MGTA 2EFPA 1R1UA 1U2WA 1MJAA 2QYOA 3IC7A 2NNNA 4XLPF 2QM3A 3IWFA 3KCCA 2B0LA 4LK1F 2IP2A 2LKPA 2RC4A 3H3ZA 5ERIA 1XDSA 1I1GA 5D5UB 5LEKA 5HLGA 1XMAA 3WE2A 3BZ6A 3FXRA 3DXJF 3FF5A 1UHWA 4DQ2A 1G3WA 1HSTA 3KFWX 3V7CA 1OYYA 3SHFA 4CZZA 2D1HA 4U0YA 3WU1B 1TQMA 2MLKA 4HA8A 3NRVA 4LD5A 1LDDA 3QP6A 1MKMA 1YG2A 3R61A 1XMKA 3LSTA 4EV0A 2IVMA 2M8EA 3TO9A 2M30A 4H0EA 2W57A 1IRFA 2DO7A 1LEBA 1R00A 4KIGA 3BJ6A 4EJTA 4RAYA 5IT9K 3G73A 1H9TA 1B9NA 1IXCA 1G3SA 2Z99A 1B1BA 4HAMA 2KRFA 3FMRA 3ZN0A 2DT5A 5DV5A 4KYWA 3M8EA 3FHZA 1OYIA 3REOA 4Q4ZF 2VT2A 5BPDA 1ON1A 4P9UA 1P4AA 2JT1A 2DBBA 3KP7A 2EFWA 4NHJA 4UVAA 2UWMA 4A0XA 5LHGA 1FYKA 2UXNA 3GW2A 2GXBA 1J7KA 4YG2F 5ILUA 1H0MA 5FO5A 3J80K 3WTZA 1S6LA 4GXOA 3P9IA 4G6QA 3CUOA 3E5XA 1DUXC 2O3FA 5D8KB 1K7AA 4A6EA 4LB6B 1KQ0A 3KP2A 2GWRA 3I58A 3M9AA 4EM2A 2QZ8A 3W6JB 1B59A 3RIRA 3FXUA 5DEQA 4HX7A 4IJAA 3T8TA 1U6GA 5LLQA 1XGOA 1MJBA 1P6RA 1TNSA 3E6DA 4F7ZA 4ON0A 2EWNA 3LA3A 1EH8A 2OQRA 3EYYA 5FD5A 4M6XA 5L3BA 3IRRA 4KFCA 3P9CA 2VOPA 2R7FA 4EGYA 1J2XA 4BQAA 4HYEA 4LB5A 1EH6A 4GO1A 1OR7A 2Y0MA 4KICA 5LGTA 2FRHA 3LAPA 1IXSB 4IHSA 2R7DA 2QVOA 4RGRA 3HRSA 2A61A 2W25A 1UFMA 2QQ9A 1ULYA 1TQIA 2QUFA 3BWGA 1B4AA 4UXNA 2P8TA 2XKOA 3RDIA 5D8LB 2L54A 1U5TA 4IXAA 1LEAA 3F3XA 2STTA 3TQNA 3KLOA 1WKMA 1J59A 3JAMK 2YPRA 1FBQA 5H6RA 2ISZA 5J6XA 1SAXA 2VBYA 1ZH5A 4XBFA 2G7HA 3M8FA 5HS9A 5FLXZ 3KZYA 1FYMA 1FOKA 3V7RA 4WF2A 1SFEA 1ZGAA 1D8JA 4G6DA 5JFRA 1DPUA 2ADUA 2VBWA 3V7SA 2HQRA 4M9XA 1G3TA 4AVPA 1LVAA 2LNBA 4LGWA 5ICCA 4ENJA 2NYXA 1T6SA 3RYRA 4ESBA 5LRRA 3V8KA 4IRIA 2BBYA 2IJLA 4Y15A 1WWXA 1BBYA 4L5IA 3LA7A 1HSJA 1GXQA 3R6SA 2EB7A 1ZARA 1O3RA 4N9HA 1C0WA 2NRAC 5DYMA 2XVCA 2STWA 3WU0A 5LHHA 1ZLJA 4WCGA 2ZMEA 3BPXA 3BP8A 5TRDA 1I6XA 5K5RA 3R4KA 4K2EA 1W5SA 4RGXA 3BOQA 4UHTA 3DPTA 4LMYA 4Q47A 4MHGA 4CICA 2IA0A 4BYYA 4EM0B 5CVRA 4ESJA 2DFIA 5E1XA 3TDUC 2VODA 1UHMA 3LQRA 3NQOA 2CWEA 2ISYA 2M87A 4ZYHA 2C6YA 4NB5A 2XUBA 2MA3A 4JBAA 6PAXA 4XLNF 2MH2A 4XSXF 4KIFA 2UZKA 1P4WA 4LLLA 3QOPA 2HEOA 2FSWA 1CF7B 1FC3A 4CGZA 2K02A 4WX9A 3M1EA 1FNNA 2PG4A 4Y13A 4L9TA 2FA5A 3HSEA 1IAWA 5DDGA 3F6VA 2O03A 2H6CA 4N0BA 4KMFA 1I27A 4P55A 2FXAA 1YW7A 1I1SA 3U1DA 2A68F 2IPQX 2ZCWA 3EUHA 4KMUX 3HTSB 1ZLKA 2A07F 3KP4A 2BGCA 4HW0A 4EQQA 2KJBA 4FX0A 3FMQA 1IN6A 2VN2A 5L3CA 2FE3A 2DLLA 3GX4X 4RGUA 4HF2A 2DU9A 3SFZA 3FX3A 5A2QZ 3CJNA 2X0LA 3GVAA 5HS7A 1QZZA 3JTGA 2W84A 4MEXF 1A04A 4LJZF 3BPVA 2PEXA 1QZYA 1XSXA 2ZO4A 1P4XA 3CUQC 2P7CB 2CSOA 2M5WA 5DUKA 2HKOA 4G8XA 2J5PA 3ELKA 1XGSA 4IHTA 1QQIA 2GXGA 2A69F 4PGHA 3WTXC 1PDNC 1Q1HA 3KP3A 2XAGA 4I02A 2EJRA 4CDGA 1QBJA 3QU3A 3H3UA 5FGMA 3F72A 5D6FA 4OIQF 3DKWA 3L00A 3FXQA 4HQEA 5CVUA 1VTNC 3WODF 1TQPA 1RUOA 1R58A 1TLHB 2J5OA 4JK1X 3K2ZA 2YX4A 5CLSA 2FBHA 2GIVA 3CO6C 2EV0A 4QLCU 3F8CA 2OAZA 2XGXA 4KIBA 4OIOF 2Z5UA 4PDKA 3LFKA 3C3WA 4YFNF 3GLXA 2H09A 3KEOA 2PQ8A 5L3GA 2E7WA 2VE9A 1PP8F 2GA1A 3RJPA 3OV8A 3F23A 2VBXA 2RQPA 3QP5A 5JHUA 5FLXK 1E17A 2EV5A 2D2WA 3WE3A 5HVQC 4O3MA 3K9TA 4HV6A 3D0SA 1H9GA 4RB3C 4D0PA 4IPAA 2Q8KA 1ZRDA 4YFXF 1MZBA 1OKRA 1TNTA 4U0WA 5CVJA 5J8FA 3GWZA 1L0OC 4CHUA 1LDJA 1ZAOA 3E6BA 4BHCA 1XB4A 3DF8A 5ICFA 3RTRA 4PGGA 1W7PD 3FMSA 3WG9A 4MQVA 3I53A 3TKYA 2VC0A 3WTWC 5FFXA 1G6NA 5BPIA 4OIRF 5H6QA 3GO5A 1Y0UA 1S3JA 4EMSA 2KIMA 3TOAA 2D1VA 5ICGA 2W85A 3RKWA 4ZZDA 2Q0OA 3K1NA 1XSVA 3F8MA 4NQWA 1S8NA 3K1MA 2O0YA 1K6OA 3GUDA 4RS8A 2LF8A 1RI7A 2V9VA 5HOOA 2ESHA 1BC8C 3F21A 1RIOH 1HKTA 2YU3A 1QPMA 5L3EA 2PLYA 5HDNA 1RUNA 1HKQA 2JTVA 1IW7F 3N97A 3CO7C 4UUVA 2ZJ2A 4LG0B 3V4GA 3R0JA 3HTUA 2HWVA 2LF7A 1O7FA 2V1DA 3HUGA 3FM3A 3WGGA 1SMYF 2R3SA 4I09A 4L5JA 4RGSA 4RB0A 4QWQA 1Z6RA 1U8RA 1G3YA 1V4RA 3VEPA 4L0ZB 2VONA 3QPTA 1HW2A 2A6HF 3WTYC 3KP5A 3FM5A 3K0LA 4AWXB 2YSRA 4WXCA 3E5QA 3PFIA 4EGZA 1D8KA 3F22A 1T2KA 3SZTA 3OOPA 3HHGA 1KYWA 5HLIA 2XAHA 1KGSA 2DTRA 2KJCA 3MCZA 3ABUA 4WXDA 5ILSA 1HXDA 3DPLC 3SZPA 2VOOA 3TDZC 1REPC 2CYYA 4WXHA 1Z05A 2EFQA 3V8JA 4U7BA 1F4KA 1G4DA 3C18A 1KU2A 3QPHA 2L4AA 1HQCA 3U2RA 1FWZA 2FNAA 1BC7C 5EEGA 4IF4A 1Z7UA 4HDUA 1BI2A 2OU2A 4OINF 1S7OA 4HV5A 2MBFA 2XAQA 1GXPA 1SD4A 2NS0A 3IL2A 3PQJA 4KA4A 1F1ZA 2XKPA 4UNOA 2V79A 4ENNA 4G9YA 1KU7A 5E1ZB 4E70A 2A3SA 2K4BA 3L9FA 1UCRA 2CFXA 2XV4S 1CF7A 2ZNZA 1FP2A 1ZRCA 2HGCA 2QWWA 1AWCA 3I59B 3MEXA 3CDHA 4A2UA 4M72A 2ESNA 2PJPA 1ZYRF 4BAYA 4OMYA 2MLGA 4MTEA 2IRFG 3BDDA 3CTAA 3HSRA 3DEUA 1R22A 1JXSA 1O3TA 2GZWA 5ED4A 2PMHA 3I71A 5IT3A 4A12A 1XDUA 2KIFA 3BJAA 3ZP5A 2VE8A 2CG4A 5CVIA 1XCBA 4HDVA 3B73A 3VB2A 3LWFA 3EDPA 5FB2A 5ILVA 3BROA 1D5VA 2PMUA 2KIUA 2DQRA 3QAHA 1O57A 2MD5A 1K78B 1STZA 3F6OA 1XCVA 1QNTA 5D6EA 4S05A 2FU4A 3PQKA 2PBIA 1O3QA 3G3ZA 3MQ0A 1R23A 1P92A 3MAJA 5LGNA 1DPRA 4IRHA 2K7LA 2V1UA 3ECHA 5JR3A 3O2PE 4MEYF 3RPUA 3ZMUA 1XN7A 2F2EA 1L3LA 1JGSA 2L4MA 2NNYA 2QBYB 3EYIA 4ETSA 5IT9Z 4XSZF 2H94A 1BIBA 2AS5F 5D4RA 3QRFF 2F5DA 1HBXG 5LEJA 2Z3YA 2JSCA 3HHHA 1Z6TA 1KQ8A 2ZXJA 1JHHA 1U3EM 1FBSA 2P4WA 2P6TA 3ML6A 4I7HA 1B9MA 1BI3A 3C7JA 2E1NA 3F8BA 1KA8A 2OQGA 1FSEA 3F8FA 2XROA 1ZG5A 1IUYA 3CUQB 1HW1A 4YFKF 3JSOA 2EFOA 3E3VA 2WTEA 1FY7A 3GFJA 4Q5SF 3JSPA 1PP7U 1USTA 5FD6A 2RN7A 4EJOA 1WQ2A 3GEZA 2G7UA 1USSA 4M73A 5J8CA 4RB1A 4P96A 2L01A 2HTJA 1R1VA 5E1WA 4AIKA 1TW3A 2H6BA 2NAZA 1T39A 2QQBA 5K5OA 3GYHX 2IW5A 3DP7A 2HKXA 4KNYA 3ULQB 3RYPA 4HF1A 1SD6A 1FT9A 3KETA 2CQKA 1KYZA 1WRJA 2WC2A 4KT5C 1XGNA 2CGPA 2DI3A 3C1DA 5CJ9A 2VT3A 1DDNA 2D45A 2VBZA 4YIIA 3BY6A 3QU6A 4ZZLA 4R8HA 4ENMA 5E20A 1U5TC 3BJOA 5D5XB 1XD7A 2V6CA 1U78A 2F5CA 2WWYA 4PCQA 1IZ1A 3COAC 2RV8A 2JPBA 2P5VA 3I4PA 3GXOA 4HF0A 2PFBA 3HOTA 1J75A 4Q48A 4OIPF 2K86A 2GA2A 4N9IA 4HBLA 2LSOA 2HQNA 4MTDA 5ICEA 5BS6A 2DK8A 5CVVA 4L9JA 2A6EF 4M9ZA 2HR3A 2JRTA 3ECOA 3S2WA 4A0YA 2FMYA 1BI0A 3B02A 3R0AA 4G7HF 2M1BA 2X4HA 1BOAA 1OPCA 4ZYEA 1KU9A 1Z1DA 4ZH4F 1XSDA 1MJ9A 1IN4A 2EV6A 3GFLA 3MZHA 1PUEE 4BXUA 4I0BA 4U88A 4BHPA 4HQMA 5BQTA 3M7GA 2ELHA 1YTYA 2FOKA 2FBIA 1HW5A 2AXLA 1MDMB 1SD5A 3I0TA 4LG0A 4UVCA 1EV7A 3Q9SA 4A6DA 3RI4A 3FWEA 4S04A 4M71A 3VOEA 1D3YA 2F5FA 1T38A 4B8XA 1B6AA 2V1XA 3DV8A 1BM9A 4LFUA 2CW0F 1J9IA 3DQVC 1ZRFA 4A5MA 5F6FA 1XGMA 3I5UA 3ZPLA 2VC1A 5EEHA 4XRFA 3ZMTA 4I0AA 3ISPA 4P9FA 4YIFA 1R7JA 3JTHA 2H27A 4G94A 3W6KB 1R5HA 1W5TA 2ACJA 3R60A 4R1HA 3HOSA 3ABTA 2HDCA 3WTVC 2YX7A 4HX4A 2RVCA 3ZQ7A 3O3KA 1FP1D 3J81Z 2K4JA 1BIAA 1AOYA 5E17F 1FPQA 1IXRC 5H20A 1SFXA 3P7NA 2JPCA 3N4MA 4O6JA 1ZG3A 1X3UA 5DD8A 2BV6A 5E8GA 5JI6A 2FQ3A 4WK8F 3J7AO 4HLYA 1J5YA 3VFZA 4UVBA 4FHTA 4OU0A 3HYIA 3L2CA 1UB9A 3IKVA 4P5OA 5DCMB 4UV9A 2Y48A 2XASA 3I64A 3RKYA 2TDXA 3CLOA 4U7DA 1JE8A 1RZ4A 2KKOA 3IWZA 1FSHA 2RKHA 1QO0D 4FT8A 4I98B 3KZZA 1ZHFA 2RDPA 1R36A 2OZ6A 3FZVA 5D5WB 1BN5A 5DD4A 3I59A 3F8NA 3L09A 4R79A 1GVJA 1DP7P 3TOBA 2FF4A 3ZMZA 2O61A 5E18F 2BEOA 4LLGF 1LNWA 3DFGA 2FNPA 1ON2A 4HX8A 3MZYA 4L9VA 2XAFA 3WTTC 4Y17A 4L18B 1W7PA 1MD0A 1K78A 2DW4A 2EFNA 3U9GA 5LGUA 3EETA 4BHBA 3ERED 3H92A 1YIOA 4EJWA 5DUIA 2OZUA 5CYVA 2W24A 3TO7A 1YO5C 2DPUA 1FBUA 2P6SA 1YW8A 2ZBKA 1I5ZA 1BI1A 5A2QK 1RNLA 2DPDA 1WI9A 4UV8A 4OOIA 4FX4A 3RPQA 2YR2A 2Z9OA 4MNUA 1YLFA 2QBYA 1FX7A 5F1RA 2HYGD 2CO5A 4AD9A 4HLXA 3T1BA 1YFHA 3ZN1A 3HRMA 5BOXA 4A5NA 2IA1A 4RAZA 1ONVA 1LB2A 1ODDA 1S7AA 1ZGJA 1S29A 1ZN2A 2EA4A 2PN6A 3CUQA 3SXYA 1NHAA 2HYFA 2OBPA 1J0RA 2BYVE 2FBKA 3IHUA 3GFIA 1O7LA 4AIJA 1EH7A 2RGVA 3VODA 1FZPB 4ZYGA 1LQ1A 1V3FA 5KVRA 5L3FA 1FLIA 2DK5A 1E2XA 4U0VA 4OMZA 3V8LA 2QQAA 2HOEA 5D5VB 3WGIA 3KP6A 2E7XA 1LJ9A 1TBXA 4EM1A 4M74A 5FFZA 3KE2A 4G7ZF 1W7PB 2DAOA 3NEUA 5L3DA 1IN7A 1JHFA 4EVIA 2FEZA 3KLNA 4A0ZA 3MWMA 3O6BB 2GQQA 4CO8A 5LHIA 4CXFA 5BMZA 1FYLA 3AAFA 4WWCA
chains in the Genus database with same CATH superfamily
4CA0A 2E1MC 2EINH 2ELKA 4RLFA 4ENKA 2HQAA 2P7VB 5LD2C 1TW2A 2L2OA 4MFEA 4A3DJ 4GGGA 4HEA2 3JW4A 3PM1A 2XDVA 3T0YA 2QENA 2JVHA 2R5ZA 2IT0A 5AONA 3BZCA 2XAJA 2NVTJ 2FUG2 3H9JA 1XX5A 2L3DA 1YQAA 3GTGJ 2BY3A 1VQPI 1F9NA 1BJAA 3BQZA 3KYDB 1LKXA 3A03A 2PMZN 2NVYJ 2ZNYA 3IH2A 3ZMVA 2ICWG 4GYIA 3DCFA 4M9SA 1IV8A 4EJUA 3J81K 4W1UA 1ZG1A 5K1YA 3LA2A 1HKSA 3H5AA 1ETQA 2OA4A 3Q9VA 4UUSA 4I2OA 4F93B 4MGRA 1IN5A 5TJJA 3TL4X 1T33A 4MIMA 2HS5A 2E36A 2Z16A 2A5YB 2RNGA 1IN8A 4MQ9F 2MC3A 3T5XA 3GZ6A 2OD5A 3I54A 4ZDPA 2DT7B 2OCCH 4IVNA 2DT6A 5HDGA 1F36A 1OQYA 2HPIA 5HS8A 2P81A 2YU9J 2EIKH 1H89C 1OCZH 2HFHA 3TEDA 4KISA 2FJ1A 3K69A 4KN4X 4KN7X 4Y33A 2E1CA 1U5TB 2GM4A 3ZRGA 4GDFA 2JK3A 4BH9A 4IRGA 2KZGA 4ZYAA 4B09A 2ZFUA 2BY1A 3ZXSA 3RKXA 2IA2A 4A3GJ 3M4OJ 3DTKA 3LSMA 3DTIA 3E5UA 4KUMA 1IV6A 2Y75A 5AIPA 5F0HA 4D9JA 2LRDA 4DNCA 1SFUA 3K1PA 1Y39A 1R1TA 2HQ5A 2XGCA 4Z2YA 4BJTA 1P2FA 2JQ7A 3SJMA 1OJLA 3J80Z 3MFKA 4BGDA 4B43A 2L02A 4EJVA 4B3XA 2ZJRF 4L9NA 1MDMA 2V1NA 1ETKA 3KX2A 4G7OF 2K9QA 1I6HJ 4FETA 3S1NJ 5JVTA 2E2HJ 3GF2A 2EZIA 3ZQQA 4HOBA 2KPMA 5FKOA 3TO6A 4AIDA 4JX4A 4NBQA 4YRVA 1CGPA 4BEHB 2VXZA 5J4YA 2HTSA 2VJ4A 1OMIA 3HRUA 5M5YJ 2GAUA 3GZ5A 1TTYA 3MD2A 2DQLA 2MH9A 5GAEJ 1V5GA 3JRDA 4BNCA 4DOZA 2VB6A 4RDUA 1V5FA 3Q5FA 2MSYA 5B1BH 1ZK8A 1SMTA 1XPXA 1YS7A 5GADJ 1X2MA 4EEFG 2WV1A 3HIFA 3BTCA 3ZMDA 2QKMB 2QEXI 1X1BA 2K3PA 2EK5A 2K27A 3KEQA 1JUPA 2F4IA 1I3AA 1R6RA 1WSUA 3HRTA 3PO3J 2ETHA 2XGEA 1KQ9A 2R7SA 2P5KA 3E6MA 2R7WA 4I01A 4KDPA 3GFMA 5EF6A 5AIQA 3NARA 1JTYA 3NWSA 2FMLA 2ZXHA 3E97A 3QOEA 3OSFA 1GHCA 3BG7A 2X51A 5DCFA 5E8IA 5GTHC 1R5GA 1MNDA 1GUUA 3CJQB 1QU3A 1QGPA 4HZFA 2QLZA 2L7FP 1FTZA 3GTOJ 3LQQA 5CPRB 1WHUA 2R5ZB 3SQNA 3BTLA 1BL0A 3FKJA 4Y52J 4JQFA 2Z2SB 1OCCH 1LDKB 2X9DA 2ZMEB 4PSXA 3WTSC 4M6YA 2BE5F 3ABKH 4GCVA 4LOCA 2VQHA 1IDYA 2X1EA 3IKTA 3QYFA 3WGHA 1YW9A 4RB2C 2HVSA 4GYGA 2XIGA 3IRQA 2OTJI 3ROUA 2R7OA 4XQFA 4M3BA 5F04A 9ANTA 4ESFA 4UUSB 4BQOA 2R0QC 4C2UA 4OAYA 2FD5A 3SFIA 5FKLA 3P9KA 2UV1A 1IF1A 3FBIB 3E6CC 1MBFA 1RPWA 2WADA 3RSNA 4JYKA 3WTUC 4AYBN 1YYVA 2XHKA 3BG9A 4AIHA 2XRNA 1W4MA 1HA8A 2CV2A 1SD7A 1RKTA 4BDZA 2ZFWA 2EA2A 3AG2H 3H9GA 5DCMA 5EDNA 5TISC 4PZJA 3JAMZ 2JZYA 3EQLF 1J09A 1N78A 3ZMSA 5C4JJ 3PIOF 4LK0F 4ZYDA 2NVQJ 2R7ZJ 4CYCA 1X2NA 2LDUA 2K40A 4O5VA 1K79A 3T8RA 1FMWA 2RNJA 4PK4A 2VQGA 2G9WA 3HSFA 1Z9CA 2DJNA 2M45A 1KU3A 2WB1A 3JRGA 1F5TA 3AG1H 2F5EA 4CYDA 1YS6A 2PI0A 2ZKZA 3AKZA 1Z91A 2O6GE 1FTTA 4ABZA 2UXXA 1IUFA 1X1DA 5HLHA 3IAM2 2O8XA 4C9YA 1ZREA 1TWGJ 2HZTA 2JRMA 1JKPC 3LAJA 2HNHA 1VQ9I 3QWLA 2ECBA 1GT0C 4PJLA 5CQEA 3FXJA 1XS9A 4TV7A 5HDKA 2AQFA 3TGNA 1T0FA 2Q2EA 3GCMA 2P5LC 3J7ZI 2WAQN 1ACIA 1O3SA 2COMA 2EH3A 4L5EA 5LRSA 4L0YB 2NVUB 2WV0A 1POGA 1G59A 5D4SA 1VQ8I 1T56A 5F64A 4A3EJ 5LBQA 1LPQA 2Z33A 2ZMEC 5KK1A 4ASNA 1T98A 1OYWA 1QZEA 3D5LA 3X2QH 5K5QA 1IRGA 1APLC 3L7WA 4B48A 3CCQI 4LLNA 1MGTA 1R5ID 2EFPA 1DU0A 1R1UA 2LH9A 1U2WA 1YITI 3I4NJ 1YX3A 3CMAI 1MJAA 2QYOA 3IC7A 2NNNA 4XLPF 1BW5A 2JA7J 2W82A 5GTIC 1VQ5I 3SEZA 1SC7A 2QM3A 2DFEA 3IWFA 3KCCA 2B0LA 4LK1F 2IP2A 2LKPA 2RC4A 3H3ZA 5ERIA 1XDSA 2O9LA 1I1GA 1JKQC 5D5UB 4ANJA 1VZ0A 5LEKA 5F1JA 2XPWA 5HLGA 1Y1WJ 1XMAA 3WE2A 3BZ6A 4IKFA 3FXRA 3DXJF 1LFBA 2R5YA 2R7QA 3FF5A 1UHWA 2IAIA 4DQ2A 2E2JJ 1G3WA 2Y0SA 4XKCA 3OIQA 3AL0B 2NVXJ 5FKMA 3W2AA 4KT6A 1HSTA 3KFWX 4IL6C 3V7CA 1OYYA 3SHFA 4FASD 4CZZA 3HDDA 1MIJA 4E7IA 2ME0A 4NC8A 2D1HA 3K4BA 2XSJC 4U0YA 2EZLA 5IYDJ 3WU1B 1NH3A 1TQMA 4UY8I 2LREA 1YHQI 2MLKA 4HA8A 2K9MA 3NRVA 3H1CA 4B44A 4CZCA 4LD5A 3U1KA 1LDDA 3QP6A 1MKMA 3BLYA 2DMTA 1UJ8A 1YG2A 2M2EA 2KFDA 4Y7NJ 3R61A 1XMKA 3LSTA 3GMEA 2W00A 3CCUI 4EV0A 4FTHA 2IVMA 3HEFA 4ZDLA 5J1RA 3JRBA 5B66C 5J47A 2M8EA 4F91B 2KDZA 3TO9A 2M30A 4H0EA 2AXTC 2W57A 1NG6A 3OYCA 2BVMA 1IRFA 2DO7A 1LEBA 3TBIA 3WHCA 2LD5A 1YRNA 1R00A 4KIGA 3BJ6A 4EJTA 4RAYA 5IT9K 3FK6A 3G73A 1H9TA 1JT6A 1B9NA 4P1WA 4IO9F 4YELA 1Y8QB 3IP4B 3EUHC 4CYCB 1S5LC 1IXCA 3DWLE 4IOAF 2O7OA 4CCKA 4XK4A 2B7EA 2M7AA 1G3SA 2Z99A 3VPRA 1TC3C 5E3NA 1B1BA 1LUJB 4HAMA 5HLTA 3CP8A 2KRFA 3K70D 1W36C 3FMRA 2ZSHB 4XIDA 3ZN0A 2DT5A 3JREA 1IJWC 2XB5A 5DV5A 4KYWA 3BR2A 3CCEI 3M8EA 2GIZA 3IH3A 2N8GA 3FHZA 1OYIA 3REOA 4Q4ZF 1U8BA 2BW3A 2L7MP 2VT2A 3A1YA 5BPDA 4A3CJ 1ON1A 2W48A 4CCMA 2QKLB 2L9SA 1UHSA 2DA4A 2F48A 3A2KA 4P9UA 1P4AA 2JT1A 2DBBA 5EGOA 1MBKA 3KP7A 1WI3A 1P7JA 2EFWA 1YJWI 4NHJA 4UVAA 1HOMA 3C2HA 2UWMA 4CCLA 2MGQA 2EIJH 4A0XA 1HC8A 4OWRB 1DGWY 5LHGA 1MSFC 5HNHA 1S9HA 2Z1DA 1FYKA 2UXNA 3GW2A 2GXBA 1J7KA 3HXLA 4YG2F 2DA3A 1OCRH 5ILUA 2NXNB 2HOAA 2XAUA 2ZC2A 3CC2I 1H0MA 5FO5A 5B5EC 3J80K 2KZVA 3WTZA 3S1MJ 1S6LA 2CV0A 4GXOA 3P9IA 4G6QA 2VPLA 3CUOA 2A05A 1ETYA 3E5XA 1DUXC 2O3FA 4U87A 5D8KB 3B6AA 5E3LA 2HDDA 1K7AA 1GLNA 4A6EA 1AKHA 3HOVJ 3PNVA 4LB6B 1KQ0A 4V19K 1IO2A 3KP2A 2XGDA 4B4CA 2A5WA 3PUBA 2GWRA 3I58A 1AA7A 2LG4A 3M9AA 5JVGF 3KYLA 4EM2A 2QZ8A 3W6JB 1B59A 3RIRA 3FXUA 4F52A 5DEQA 4HX7A 2DMQA 4IJAA 3T8TA 4RM3A 3OYIA 1U6GA 1FOYA 3VDXA 3S14J 3CDIA 3A01A 3S3OA 1I39A 3DTEA 1XGOA 5LLQA 1MJBA 1P6RA 2JMWA 2MC4A 4DBRA 2Y30A 1TNSA 4F3QA 2X48A 2RREA 4RA2A 3E6DA 3LL7A 4ON0A 4F7ZA 2EWNA 3LA3A 1EH8A 1TWHJ 3G4SI 1QHHD 2OQRA 2EZKA 3S2HJ 2KRCA 2E19A 3EYYA 3SDGA 5FD5A 4M6XA 5L3BA 3IRRA 4BXXJ 3MZ8A 1ITYA 4KFCA 3P9CA 2VOPA 2OTLI 1X3WB 2R7FA 4DBQA 2CQXA 3AG3H 2LY9A 1Y8RB 4EGYA 1J2XA 5F27A 2CH0A 3CJRB 3L2QA 1UG0A 1G8XA 4BQAA 2HYJA 4HYEA 1SVOA 3I56I 4LB5A 1EH6A 1U0JA 4XN3A 2L9NA 4GO1A 3PSFA 2CUZA 1OR7A 4PJMA 2Y0MA 3H0GJ 2H8WA 4KICA 5LGTA 3H35A 3K7AJ 2FRHA 3LAPA 1IXSB 4IHSA 2R7DA 3IH4A 3GLLA 2QVOA 4RGRA 1VQMI 3HRSA 2A61A 2CUEA 2QSFX 2VJ5A 2W25A 2OV7A 2V9KA 1UFMA 2QQ9A 1ULYA 1TQIA 2QUFA 3AFHA 4YEJA 2L7KA 3OYBA 3RZDJ 3BWGA 3FBNB 1YX5A 1B4AA 5K7ZA 4UXNA 2P8TA 2XKOA 3RDIA 2IGOA 3FIWA 1JT0A 5D8LB 3L1PA 3CC4I 4IHWA 2L54A 4FCYA 1QPIA 3LSKA 1U5TA 2W4SA 4IXAA 1LEAA 3F3XA 2STTA 3TQNA 3KLOA 2M4GA 1WKMA 1J59A 4BQNA 4QPOA 2YPRA 1FBQA 3JAMK 4LIUA 2VPRA 5H6RA 1XG1A 2ISZA 1LFUP 4V2FA 3OYKA 3CP2A 2EPFA 5J6XA 1SAXA 2UUZA 2VBYA 2WB1N 5DTDA 3VYUB 1ZH5A 3LOCA 2WY8Q 2CW7A 4XBFA 4FE4A 3BCBA 2G7HA 3M8FA 2H1LA 5HS9A 5FLXZ 3KZYA 1FYMA 1FOKA 3V7RA 2E35A 4WF2A 1B8IB 1SFEA 1ZGAA 2L9VA 4RM2A 1D8JA 4G6DA 3BZKA 1ZELA 5JFRA 1AU7A 2I8DA 1DPUA 2ADUA 2VBWA 3V7SA 4BEHA 2HQRA 4M9XA 3HUGB 4M3FA 2RAEA 1QRYA 1G3TA 2WA0A 3BR1A 4AVPA 1LVAA 1YOVB 2LNBA 4DW6A 2D5VA 2VKVA 1HDPA 3IV5A 4LGWA 4KITB 5ICCA 3W3CA 3S16J 1OCPA 4NC6A 4ENJA 2V26A 2NYXA 1R9TJ 1T6SA 3RYRA 4ESBA 2R93J 5LRRA 1Z7LA 3V8KA 2GBYA 3S1QJ 4IRIA 2BBYA 4RBOA 2IJLA 5M5XJ 3HB9A 1H88C 3NAUA 4Y15A 1WWXA 2LBFA 3A01B 1Y6IA 1BBYA 3DBRB 4L5IA 3LA7A 3Q0VA 1W36D 1HSJA 4XRSG 1FIAA 1K6YA 2DXIA 1GXQA 3BC8A 3R6SA 5IP9J 2EB7A 1ZARA 1ZGWA 1O3RA 4N9HA 1C0WA 2NRAC 2DMPA 1SFKA 4M6VA 5DYMA 2XVCA 2STWA 1E3HA 2Y0SN 3WU0A 5LHHA 1ZLJA 4WCGA 2ZMEA 3BPXA 3BP8A 3K4MA 5TRDA 4ZJZA 1I6XA 5K7HA 5K5RA 5EEAA 3R4KA 4II2A 1PUFB 4K2EA 2G0EA 1MBGA 2R7XA 3E1SA 2DODA 1W5SA 4RGXA 3L2WA 1PYVA 3K10A 3BOQA 4UHTA 3DPTA 4LMYA 4Q47A 4MHGA 1UG2A 5DM7F 4CICA 2IA0A 4AC0A 3HGYA 4BYYA 2DTZA 1I3QJ 3H36A 3HGGA 4EM0B 1IRXA 3ASOH 4HG2A 5CVRA 4ESJA 2OCEA 2DFIA 3ZQCA 5E1XA 3TDUC 4E7JA 1UHMA 2VODA 3LQRA 3NQOA 2CWEA 2ISYA 2M87A 2M9HA 4ZYHA 2C6YA 4NB5A 2XUBA 2MA3A 3H3VK 4CCNA 3OL3A 2L5QA 4JBAA 1FJLA 6PAXA 4I99C 2OF7A 4XLNF 4IHVA 2MH2A 3VYSB 4BY7J 3S1RJ 5E3OA 4XSXF 4F55A 1LFPA 5M3MJ 4KIFA 2UZKA 3W2VA 1P4WA 1IC8A 4LLLA 2JA6J 3TW7A 3QOPA 3CCSI 2HEOA 2FSWA 2Q1ZB 1CF7B 1FC3A 5DS9A 4CGZA 2KDOA 2K02A 4LITA 2KRHA 3QQAA 4WX9A 2IEKA 2V6EA 1JUSA 4E4HA 2LP0A 2TRTA 3M1EA 3Q0UA 1FNNA 2PG4A 4M3DA 2IS4A 1ETOA 4Y13A 4L9TA 2FA5A 3HSEA 1IAWA 5DDGA 2EQRA 3NWTA 1N25A 1R49A 1OCTC 3F6VA 4XRSA 2O03A 2H6CA 2HDWA 4N0BA 4KMFA 1I27A 3F0CA 4P55A 2FXAA 4ZC3A 3A0BC 1YW7A 1I1SA 3U1DA 2A68F 2IPQX 2ELJA 2ZCWA 2E60A 3EUHA 4KMUX 1VQLI 1HLVA 1ORKA 3HTSB 2FOWA 1ZLKA 4BL0B 2A07F 3KP4A 2BGCA 4HW0A 4EQQA 2KJBA 4FX0A 3FMQA 1IN6A 2VN2A 5L3CA 2FE3A 2LBFB 3K70C 2DLLA 3GX4X 4RGUA 1A35A 3BT9A 4HF2A 1D0XA 2DU9A 5FJ8J 4BXFA 3SFZA 3FX3A 4XN0A 5A2QZ 3CJNA 4QSHA 3BTIA 3G1MA 2X0LA 5E79C 3GVAA 5HS7A 1Y0NA 4GRIA 1QZZA 4BS9A 3JTGA 2W84A 3CLQA 4BJ6C 1SANA 5FLMJ 3D5RC 4MEXF 3J7AY 1LE8B 1A04A 4LJZF 4NDLA 3BPVA 1BJZA 3OL4A 4N4OB 2PJRA 2H8RA 2PEXA 2K9LA 3OYHA 1QZYA 1E0EA 3S32A 1XSXA 2ZO4A 1P4XA 3CUQC 3S2DJ 2LOOA 2P7CB 5IP7J 2CSOA 1D1CA 2M5WA 5DUKA 2HKOA 3O8HA 5B3SH 4G8XA 2J5PA 3ELKA 1XGSA 4C3JJ 4IHTA 4QPQA 1QQIA 2GXGA 5IY5H 2A69F 1SAUA 4PGHA 3WTXC 1GVDA 1PDNC 1Q1HA 3KP3A 3CF2A 1YIJI 3DEEA 2R7VA 2LR8A 2XAGA 4I02A 4M3EA 2EJRA 3CMMA 4CDGA 4HPQA 1QBJA 3QU3A 3GBGA 4HNVA 3H3UA 3PIPF 3JR9A 3JRHA 4BE2A 3CCYA 5FGMA 2F4MB 4EATA 4S0HB 4MFDA 4JX5A 3F72A 5D6FA 4OIQF 1JJ8C 3DKWA 3JRFA 3HOYJ 3L00A 3FXQA 2IGNA 4HQEA 5CVUA 3HG9A 1VTNC 3G1OA 4X0GA 3WODF 1TQPA 4A3FJ 1RUOA 3RZOJ 1R58A 4RAGA 1BOBA 3SEQA 1TLHB 2BZTA 3MKWB 2J5OA 4JK1X 1SVMA 4E7KA 3I4MJ 1RESA 3K2ZA 2YX4A 5CLSA 4CH7A 5IOYA 2FBHA 2GIVA 5IYCJ 2IGKA 5KHDA 3CO6C 4D5FA 2EV0A 3GTJJ 2X6XA 4DJAA 1WCMJ 1GDTA 4J00A 4QLCU 1JKOC 3F8CA 4CCOA 1QA6A 2CQNA 1Z3YA 2OAZA 2XGXA 2B63J 1F43A 4KIBA 3ASNH 3FK7A 2VKHA 4OIOF 4JP0A 3FXOA 2Z5UA 4PDKA 1X4PA 4QIWN 3LFKA 3QPLA 1VQNI 3C3WA 4YFNF 1K61A 3GLXA 5FROA 3MN2A 2H09A 3KEOA 2PQ8A 5L3GA 1YJ9I 4UB6C 2Y31A 3IUOA 4CCJA 1RRJA 2E7WA 2VE9A 1PP8F 3OMYA 2HVQA 5FRNA 2GA1A 3RJPA 3OV8A 3F23A 2COBA 2K5CA 2VBXA 3OYAA 3ZCOA 2RQPA 3DKXA 3QP5A 2JA5J 2O8KA 5JHUA 5FLXK 4C2MJ 3ERMA 2IS6A 1E17A 2EV5A 2D2WA 2M4KA 3DLAA 1FEXA 4E7SA 2X85A 3WE3A 5HVQC 1VQ6I 4IHXA 4O3MA 3K9TA 2KIQA 4HV6A 5GPAA 5KNLA 3D0SA 1H9GA 4RB3C 4D0PA 1UAAA 4BY1J 4IPAA 3HPGA 2KP6A 2Q8KA 1ZRDA 4YFXF 1KZHA 1MZBA 5KAFC 1OKRA 3I3LA 2XRLA 5J1UA 2DYSH 1TNTA 2E71A 3OYLA 2VI6A 4U0WA 3S17J 5CVJA 2LLKA 5J8FA 3LSIA 3GWZA 1L0OC 3K4LA 2MABA 4CHUA 1LDJA 4XOTA 1ZAOA 4ZTFA 3E6BA 4BHCA 1XB4A 3DF8A 2DDAA 2PJRB 5ICFA 3RTRA 4PGGA 1W7PD 3FMSA 4FISA 3WG9A 4MQVA 4IOCF 3I53A 2W1OA 3TKYA 3PSIA 4V2GA 2VC0A 2AQEA 1A6QA 2F4OB 3WTWC 3VYRB 5FFXA 1G6NA 4XL9A 2V7FA 5BPIA 4OIRF 5H6QA 3E0JB 3DBLB 3GO5A 3W2WA 1YI2I 1Y0UA 1X19A 2E5NA 3WU2C 1S3JA 2LKSA 1MNEA 2XF6A 4DZJA 4EMSA 3CD6I 2KIMA 3TOAA 4IQJA 3FDYA 1CQTA 2IS1A 2D1VA 2QF7A 5ICGA 2W85A 2ME6A 1X1AA 2QSHX 5CKTA 5EG0A 3RKWA 3FXMA 4ZZDA 1E3PA 4X1EA 3SZGA 5C44J 3FKIJ 1WGXA 1WJ5A 2Q0OA 2BOLA 3K1NA 1O4XA 1XSVA 2XF5A 3F8MA 5K7FA 1Z0XA 1SVLA 4NQWA 1S8NA 5F0CA 3GTQJ 1ERDA 1WZ2A 3K1MA 1Z77A 3CESA 2O0YA 1JJ6C 2WAEA 1MMSA 1K6OA 3GUDA 4RS8A 1R71A 2LF8A 1RI7A 2MYSA 4FE7A 1ZR4A 4II3A 1WH5A 4FQGA 1IGNA 2V9VA 4BKXA 5HOOA 1RKWA 2VUMJ 2ESHA 1BC8C 2E34A 4XLEA 5JLWA 3F21A 1RIOH 5FRMA 5E3MA 1HKTA 2WAFA 2YU3A 3FXLA 1QPMA 5L3EA 2PLYA 2HU9A 5HDNA 1WJEA 4JX6A 1RUNA 3GTKJ 4B1RA 5IP6A 4BACA 1HKQA 2JTVA 3KPHA 2CU7A 1IW7F 4XR6A 2KLOA 3N97A 3CO7C 4Z6YA 4UUVA 2ZJ2A 4LG0B 2TCTA 1FOWA 2BY0A 3V4GA 3K6GA 1B8IA 3R0JA 5J1YA 4DZPA 3HTUA 5H2FC 2HWVA 2LF7A 3BG5A 2F5VA 1RR8C 1O7FA 2V1DA 3HUGA 2R7TA 4A3IJ 3FM3A 1D1AA 3BTJA 3LSPA 1T8IA 1WPKA 3WGGA 1TWAJ 4KJZA 1SMYF 2R3SA 3SYTA 3PNTA 1VQ4I 1TWCJ 3CMEI 4DYQA 4I09A 1YJNI 3W6VA 2K9NA 4L5JA 4RGSA 1NK3P 2KISA 4RB0A 4QWQA 1Z6RA 1GV5A 1U8RA 1G3YA 1V4RA 3MVPA 4PUSA 3VEPA 3OYNA 4G12A 3PUFA 4L0ZB 3CZ6A 2VONA 3QPTA 1HW2A 4A3KJ 2A6HF 2ZXIA 1VQKI 3C2BA 3WTYC 3HOZJ 3KP5A 3FM5A 4PJJA 2RQQA 3OY9A 3K0LA 4AWXB 4XNFA 2LC2A 2YSRA 4WXCA 3E5QA 3PFIA 4EGZA 4W97A 1D8KA 1T08B 3F22A 2DA2A 1T2KA 3SZTA 4BE0A 3OOPA 3HHGA 1KYWA 3DEWA 5HLIA 2XAHA 1KGSA 3OR1C 2BHYA 4PFPA 2DTRA 2KJCA 3C2GA 4C30A 1WFXA 2VLAA 4PJNA 2CS3A 3MCZA 1K4SA 3ABUA 1N75A 4WXDA 5ILSA 1HXDA 3DPLC 4HSTA 3SZPA 3TDZC 2VOOA 5GPCA 1REPC 2CYYA 4WXHA 4XICA 3A4CA 1PUFA 1Z05A 2EFQA 3DKYA 3V8JA 4U7BA 1F4KA 2JUGA 2QCOA 3HL2A 1MMDA 1G4DA 3C18A 1KU2A 3QPHA 5EG0B 2L4AA 1HQCA 3U2RA 4GFBA 1FWZA 4B3AA 4RMNA 3OYFA 2FNAA 3LSGA 1BC7C 4A3LJ 5EEGA 1TWFJ 3DPUA 1V5EA 4NQWB 4IF4A 1T0FC 1Z7UA 2DOFA 2VJJA 4UB8C 1BI2A 4HDUA 2BXYA 2OU2A 4OINF 2JVGA 3HOXJ 2K9SA 2NOGA 1S7OA 5CQGA 4HV5A 3EUKL 2MBFA 3A02A 4IEJA 4E7LA 2XAQA 1GXPA 5JHFA 4ZDOA 1SD4A 2NS0A 5IOZA 3IL2A 3PQJA 4KA4A 3RKQA 1F1ZA 2XKPA 4UNOA 2V79A 2DN0A 4ENNA 4G9YA 1KU7A 2JWTA 1DQUA 1BR2A 3O8GA 4XLFA 5E1ZB 4E70A 3DU5A 3CDLA 2A3SA 2K4BA 3L9FA 1UCRA 2CFXA 4AU7A 2XV4S 4PSWA 1ZQ3P 2HZDA 4QTRA 1CF7A 3M3YJ 2ZNZA 1FP2A 4C3IJ 3V42A 1ZRCA 2HGCA 2EIMH 2QWWA 1AWCA 3I59B 3MEXA 3CDHA 4A2UA 4M72A 2ESNA 4XKVA 3ZQGA 3HKZA 5C3EJ 2CV1A 2PJPA 4Y3OA 3D1NI 1ZYRF 4BAYA 2CUJA 4OMYA 2QQ8A 2MLGA 2YS9A 4I76A 2MW8A 4MTEA 2IRFG 3BDDA 2CJJA 2ZJQF 3CTAA 3HSRA 4IQ4A 3G71I 2HPMA 3DEUA 3MKZA 4BU2A 1R22A 1JXSA 1O3TA 1MMGA 2GZWA 5EYRA 5ED4A 3BG3A 2PMHA 3I71A 5IT3A 1XDUA 2KIFA 3BJAA 4A12A 3ZP5A 2VE8A 4A3MJ 2CG4A 5CVIA 1R4MB 1XCBA 4HDVA 3B73A 3VB2A 3LWFA 1PVEA 2LY1A 3EDPA 3DLLF 5FB2A 3BROA 5ILVA 1D5VA 2WBMA 1VI0A 3CCVI 1KONA 3M1CA 2PMUA 2KIUA 2DQRA 1W0UA 3QAHA 1O57A 2MD5A 1K78B 3VSKA 3IAS2 1ETWA 2JUCA 2L9RA 1FIPA 3OS1A 1STZA 2LTPA 3F6OA 2OPTA 3FHNA 1XCVA 1JKRC 3OIPA 3GTPJ 3JRCA 1QNTA 3Q0WA 5D6EA 4S05A 2XPUA 2FU4A 3PQKA 2X6WA 3MMYB 1VQ7I 2PBIA 1O3QA 3G3ZA 1EKEA 4J19A 3MQ0A 1R23A 1P92A 2FX0A 3MAJA 2HI3A 5LGNA 3M07A 2Y9ZA 1DPRA 4IRHA 2Y2ZA 1LE8A 1MW7A 2K7LA 2V1UA 3TMOA 3ECHA 5JR3A 2DFFA 3O2PE 4MEYF 2M3AA 3RPUA 4MO7A 5IPAA 5C4XJ 4RAFA 3ZMUA 1MH3A 2JA8J 1XN7A 2F2EA 1L3LA 1NTCA 1JGSA 2ZB9A 2L4MA 2NNYA 2QBYB 1P9QC 3TP3A 5EZHA 4I6ZA 3UKGA 3QODA 3EYIA 4ETSA 3CCRI 4XSZF 5IT9Z 3HM5A 2DA5A 2H94A 1BIBA 1SFOJ 2AS5F 4RLQA 4BQQA 5D4RA 2VQCA 3QRFF 4X6AJ 2F5DA 5JLXA 1HBXG 3SDBA 1G2HA 5GAGJ 5LEJA 1A6IA 1VF9A 2Z3YA 2LVSA 2V4JC 2JSCA 3QPSA 3HHHA 2HXOA 1Z6TA 1KQ8A 2ZXJA 1JHHA 4DYCA 1P7IA 1U3EM 1FBSA 2CUFA 2P4WA 2P6TA 3ML6A 4I7HA 1B9MA 1BI3A 3C7JA 3MKYB 2E1NA 1MH4A 3F8BA 1KA8A 2OQGA 1FSEA 1XTAA 1NG7A 3F8FA 2XROA 1ZG5A 1IUYA 3CUQB 1HW1A 2NS8A 4YFKF 3LSHA 3JSOA 5M3FJ 2EFOA 3E3VA 1W0TA 2WTEA 1FY7A 4HNUA 3GFJA 4Q5SF 4A3BJ 4JOMA 3JSPA 2GOMA 1PP7U 1USTA 5B1AH 5FD6A 2RN7A 4EJOA 1WQ2A 5F0FA 3U21A 3CQZJ 3GEZA 2QA4I 3LNQA 2G7UA 1S7EA 2ZXWH 1USSA 4M73A 3H0DA 5J8CA 4RB1A 4P96A 3J7YJ 2L01A 1Z67A 1R1VA 2HTJA 2LY2A 3OR2C 5E1WA 3S15J 4XOPA 2P0WA 4AIKA 3JRIA 2F6CA 1TW3A 2H6BA 3F9KA 2X1DA 2NAZA 3D5SC 1T39A 2QQBA 4CSWA 3OYMA 1EA3A 2JSPA 2XC7A 3TW6A 4NNJA 5K5OA 3GYHX 3KIOA 2JN6A 2IW5A 4D5CA 4C2TA 3DP7A 4XLCA 1BR4A 1PJRA 2HKXA 2M0MA 4NUBA 3OYDA 4KNYA 2OJED 4BBSJ 4HSRA 2GOXB 3ULQB 3RYPA 1OCOH 1MMAA 1AHDP 1OR7C 4HF1A 3K4JA 2AHQA 3BQYA 1SD6A 1FT9A 1ZTRA 4BBRJ 2CQKA 3KETA 2R7RA 4DGWB 1KYZA 3VSLA 2WY7Q 2R7UA 1WRJA 1QVUA 2WC2A 4KT5C 3JCUC 1XGNA 3LSJA 2CGPA 3S3MA 2DI3A 3C1DA 3ESWB 5CJ9A 2E5ZA 3PO2J 2VT3A 2CMPA 2DOAA 4OAZA 1DDNA 3ZQIA 3VYTB 2D45A 2VBZA 3L2VA 3E7LA 2R4GA 4YIIA 3BY6A 3QU6A 1OLTA 4PJ0C 4ZZLA 4R8HA 4ENMA 2R92J 2XB0X 5E20A 3LFUA 5KAIC 1U5TC 3BJOA 2ZSIB 5D5XB 1XD7A 2V6CA 4AM3A 1U78A 4C3HJ 2F5CA 3PL8A 3ZQLA 2WWYA 4XLHA 4PCQA 3CCLI 1IZ1A 3COAC 3HZJA 1D0YA 2OUMA 2RV8A 2JPBA 1E3OC 1GV2A 2P5VA 3I4PA 2CFOA 3GXOA 4HF0A 4XONA 2PFBA 2IXSA 3HOTA 1J75A 2DDBA 4Q48A 2K86A 3BCAA 4OIPF 1VFCA 4CUGA 2GA2A 3KYCB 4N9IA 4A69C 4HBLA 2MFZA 1EF4A 2LSOA 1R4NB 2HQNA 4MTDA 5ICEA 5BS6A 3I55I 4BUPA 2DK8A 3JRAA 5CVVA 2ID3A 4IX7A 4L9JA 2FQ4A 1X1CA 2A6EF 4M9ZA 2HR3A 3CCJI 2JRTA 3ECOA 3S2WA 4A0YA 2FMYA 4D7MA 1BI0A 3B02A 3R0AA 4AVZA 4G7HF 2M1BA 4XLAA 2X4HA 1BOAA 3I9V2 3L2RA 1OPCA 4XRMA 4ZYEA 1KU9A 1Z1DA 3UR3C 4B47A 4E6KG 2W7NA 2I10A 4ITVA 4ZH4F 1N77A 3UNGC 1XSDA 1MJ9A 3PJRA 1IN4A 2EILH 3QYBA 2EV6A 3GFLA 3MZHA 2GLOA 1NK2P 2X6YA 1PUEE 4AUXA 4BXUA 3S3NA 4I0BA 4U88A 4BHPA 4HQMA 5BQTA 3M7GA 2ELHA 1YTYA 2FOKA 2Y69H 2FBIA 3HJEA 1HW5A 3FISA 2AXLA 1MDMB 1SD5A 3I0TA 2DMNA 4LG0A 4UVCA 1EV7A 1WVRA 3RQIA 5EZGA 3Q9SA 3HKZN 4A6DA 3FWEA 4XORA 2K85A 4S04A 2L0KA 3RI4A 1D1BA 1DGRM 2KQRA 4M71A 1D3YA 5EJCA 3VOEA 1S72I 2M7BA 2F5FA 1T38A 1X1PA 4B8XA 2BXZA 3OYJA 1B6AA 1Q1VA 2V1XA 3DV8A 3H5RA 1IDZA 2VQLA 1BM9A 1Z3XA 4LG3A 4LFUA 2CW0F 1J9IA 3DQVC 1ZRFA 3G2BA 4A5MA 5F6FA 1BR1A 1XGMA 4N4NB 3ZOBA 1SEUA 3ABMH 3I5UA 3ZPLA 2VC1A 2MG4A 2KMUA 2O5RA 5EEHA 2JA2A 4XRFA 2LK2A 1RR7A 4A93J 3ZMTA 4I0AA 3ISPA 4PFOA 4P9FA 4YIFA 1R7JA 1ETVA 3JTHA 1D5YA 4G94A 3W6KB 2H27A 1R5HA 3EUAA 4A3JJ 3BR0A 3G1LA 1W5TA 3PNYA 2ACJA 2XF7A 3R60A 4R1HA 5J40A 3HOSA 3ABTA 3OS2A 3Q3SA 3EPZA 4G6TB 2HDCA 3MKLA 1JGGA 3WTVC 2DA7A 2CQQA 4IHYA 1IRZA 2YX7A 2DFHA 3KEYA 2CW8A 3CMYA 1QVTA 4MLOA 3OYGA 4HX4A 4Y4RA 2RVCA 3ZQ7A 5BNGA 3O3KA 3OIOA 1FP1D 3K4NA 2H1KA 4HNTA 2KHMA 2K4JA 2PMZA 1BIAA 3J81Z 1AOYA 5E17F 1FPQA 1MBHA 2EBIA 2Y9YA 1IXRC 5H20A 2XPVA 1TT0A 1WJAA 1SFXA 1IG7A 3P7NA 1UELB 4XKWA 3DBHB 5HNFA 2JPCA 3N4MA 4O6JA 1ZG3A 1B72A 1MNMC 1X3UA 5DD8A 2BV6A 5E8GA 1WJDA 5JI6A 3HOWJ 1YE9A 2FQ3A 2AO9A 1U9OA 2IBDA 4WK8F 3J7AO 4HLYA 1J5YA 4M3GA 3VFZA 4UVBA 4FHTA 4BE1A 2LFBA 2M34A 3RQ4A 4OU0A 3OSGA 3HYIA 3L2CA 1UB9A 3IKVA 4P5OA 2BVLA 4UV9A 2CQ7A 5DCMB 2Y48A 1X3ZB 2XASA 3I64A 3RKYA 1H8AC 5FKKA 1VNDA 2TDXA 3CLOA 5LFAA 4U7DA 1JE8A 1MBJA 1RZ4A 3A0HC 3L2UA 2KKOA 4DYRA 1TL8A 1WH7A 1X58A 3IWZA 3KZIC 5FKNA 1FSHA 2RKHA 1QO0D 4FT8A 4I98B 3KZZA 1ZHFA 2RDPA 5TGTA 1W1WE 1R36A 2OC6A 2OZ6A 3FZVA 5D5WB 1BN5A 2VKDA 2HOTA 5DD4A 5F08A 2X6OA 3I59A 3F8NA 3L09A 4R79A 1XC5A 1QHGA 2Q2EB 4YIRX 3CC7I 1GVJA 1DP7P 3TOBA 1T95A 2VIXA 2ZJPF 2FF4A 5IYBJ 1TT5B 3BR6A 3K4KA 3OYEA 3ZMZA 2L7ZA 1A31A 2O61A 2JJ7A 5E18F 2BEOA 4J01A 3AL0C 4LLGF 2DYRH 3QYEA 2QGUA 3GZNB 3LSRA 1LNWA 3GTLJ 1Z21A 3DFGA 3WG7H 3ONQA 2FNPA 1ON2A 4HX8A 4E7ZA 4D1QA 3MZYA 1XMXA 4L9VA 2XAFA 3WTTC 4Y17A 3ZGKA 4L18B 1W7PA 3BR3A 1MD0A 1K78A 2DW4A 1ETXA 3ZQFA 2DJIA 1OISA 2EFNA 2HVRA 3U9GA 4F92B 5LGUA 1LVKA 1JTXA 3EETA 4BHBA 5J4VA 3ERED 3H92A 1YIOA 1JI8A 4EJWA 5DUIA 2I5UA 2OZUA 5CYVA 3GTMJ 2W24A 1RC9A 3TO7A 1YO5C 2DPUA 3OWTA 2DA1A 2R5YB 1FBUA 2P6SA 2VL8A 1YW8A 2ZBKA 1I5ZA 4H4KC 1Y56A 3BG6A 1BI1A 2LKXA 5A2QK 4XMYA 5DM6F 5GAHJ 2KL4A 2MD0A 1RNLA 1W5CC 2DPDA 1A5JA 1DU6A 4D7NA 4DIQA 1WI9A 4UV8A 1OFCX 5M5WJ 2K3FA 3S8PA 2DOEA 4OOIA 4FX4A 1DP3A 1BW6A 1MMNA 1B72B 3RPQA 2YR2A 2Z9OA 5FLVA 3CCMI 4XM3A 4MNUA 1UZCA 2QSGX 1YLFA 2QBYA 1FX7A 3OOUA 4ZTJA 5F1RA 2ECCA 2HYGD 4AYBA 2CO5A 4AD9A 3LMMA 4HLXA 5GP9A 3T1BA 1MSEC 2GXAA 1YFHA 2ID6A 3ZN1A 2NOJB 1YRNB 3HRMA 5BOXA 1V55H 2BY2A 1HCRA 2DCEA 3FXKA 4LIVA 3HC7A 4A5NA 2IA1A 4RAZA 1MBEA 3RPUD 3PFYA 1M1EB 3K2AA 2KT0A 3H5NA 3N05A 1ONVA 1V54H 1ZKGA 4IZZA 1LB2A 2VKEA 1ODDA 1S7AA 1X4OA 1JUMA 1ZGJA 1HF0A 4UUTA 2CRGA 2E1MB 3WHBA 1S29A 1ZN2A 2EA4A 2PN6A 3CUQA 3SXYA 1NHAA 4NC7A 2IGMA 2BW3B 2HXIA 3CF5F 2HYFA 2OBPA 2IS2A 1WJBA 1J0RA 2BYVE 2FBKA 3IHUA 1WJFA 3ZQHA 3GFIA 3B6CA 2NS7A 1O7LA 5KCMA 5HODA 1U9NA 1VQOI 1K83J 2WAQA 4AIJA 1EH7A 3CJTB 2RGVA 1A36A 3K4CA 1WJCA 3VODA 5EGOB 1FZPB 3HBLA 4ZYGA 1V3FA 1LQ1A 5KVRA 1FOXA 5L3FA 3HPHA 1FLIA 2XSDC 1Y1VJ 2E1OA 2HOSA 4BDYA 2DK5A 1HDDC 1E2XA 4U0VA 4OMZA 3V8LA 2QQAA 2HOEA 1FMVA 2VASA 5D5VB 2YUSA 1UMQA 3WGIA 2LYCA 3KP6A 2E7XA 3ZR8X 1EJ9A 1LJ9A 1TBXA 2E2IJ 4XKBA 2M0CA 3G6EI 4EM1A 4M74A 5FFZA 2X1CA 3OS0A 3ABLH 3KE2A 4G7ZF 3S93A 1BA5A 1TZLA 4BJ5C 1W7PB 3RCOA 2LMDA 3BR5A 1AKHB 3P5JA 2A6TA 2DAOA 2PX9A 2M8GX 3NEUA 2DMUA 5L3DA 1ENHA 1IN7A 3M8JA 1ZR2A 2EZHA 1JHFA 2VJIA 4EVIA 3HOUJ 2FEZA 3VWBA 2VXDA 3KLNA 3H9QA 4HRIA 4A0ZA 3DU6A 3MWMA 2V9PA 3AG4H 3O6BB 3TP0A 1I50J 2GQQA 4CO8A 5LHIA 4CXFA 4E7HA 5BMZA 1FYLA 1TP4A 2BHZA 5J3LA 2DA6A 2B9SA 1RETA 1D0ZA 1K4TA 3AAFA 4WWCA
chains in the Genus database with same CATH topology
4ENKA 2P7VB 1TW2A 4GGGA 3JW4A 3T0YA 2QENA 2IT0A 5AONA 2XAJA 2L3DA 1YQAA 1F9NA 1BJAA 2ZNYA 3ZMVA 4GYIA 4EJUA 4M9SA 3J81K 1ZG1A 5K1YA 3LA2A 1HKSA 2OA4A 3Q9VA 4I2OA 4MGRA 1IN5A 5TJJA 2HS5A 2A5YB 1IN8A 4MQ9F 2MC3A 3T5XA 3GZ6A 2OD5A 3I54A 4IVNA 5HDGA 5HS8A 2HFHA 3K69A 4KN4X 4KN7X 2E1CA 1U5TB 4BH9A 4IRGA 4B09A 3RKXA 2IA2A 3E5UA 4KUMA 2Y75A 5AIPA 4DNCA 1SFUA 3K1PA 1R1TA 4Z2YA 1P2FA 3J80Z 3MFKA 2L02A 4EJVA 4L9NA 1MDMA 4G7OF 5JVTA 3GF2A 4HOBA 3TO6A 1CGPA 2VXZA 2HTSA 1OMIA 3HRUA 2GAUA 3GZ5A 1TTYA 2DQLA 2MH9A 4BNCA 3Q5FA 1SMTA 1YS7A 3HIFA 3ZMDA 2EK5A 2K27A 3KEQA 1WSUA 3HRTA 2ETHA 1KQ9A 2P5KA 3E6MA 4I01A 4KDPA 3GFMA 5AIQA 2FMLA 3E97A 1GHCA 5DCFA 5E8IA 1R5GA 1QGPA 4HZFA 2QLZA 3LQQA 3SQNA 4JQFA 1LDKB 2ZMEB 3WTSC 4M6YA 2BE5F 4GCVA 3IKTA 3WGHA 1YW9A 4RB2C 4GYGA 2XIGA 3IRQA 3ROUA 4ESFA 3P9KA 1IF1A 3E6CC 3WTUC 1YYVA 2XHKA 4AIHA 2XRNA 1W4MA 1SD7A 2ZFWA 2EA2A 5DCMA 4PZJA 3JAMZ 2JZYA 3EQLF 3ZMSA 4LK0F 4ZYDA 2LDUA 4O5VA 1K79A 3T8RA 2RNJA 2G9WA 3HSFA 1Z9CA 2M45A 1KU3A 1F5TA 2F5EA 4CYDA 1YS6A 2PI0A 2ZKZA 1Z91A 2O6GE 2UXXA 5HLHA 1ZREA 2O8XA 2HZTA 3LAJA 4TV7A 5HDKA 3TGNA 2P5LC 1T0FA 2Q2EA 1O3SA 2COMA 4L0YB 5LRSA 2WV0A 5D4SA 5F64A 5LBQA 2Z33A 5KK1A 4ASNA 1T98A 1OYWA 3D5LA 5K5QA 1IRGA 3L7WA 4LLNA 1MGTA 2EFPA 1R1UA 1U2WA 1MJAA 2QYOA 3IC7A 2NNNA 4XLPF 2QM3A 3IWFA 3KCCA 2B0LA 4LK1F 2IP2A 2LKPA 2RC4A 3H3ZA 5ERIA 1XDSA 1I1GA 5D5UB 5LEKA 5HLGA 1XMAA 3WE2A 3BZ6A 3FXRA 3DXJF 3FF5A 1UHWA 4DQ2A 1G3WA 1HSTA 3KFWX 3V7CA 1OYYA 3SHFA 4CZZA 2D1HA 4U0YA 3WU1B 1TQMA 2MLKA 4HA8A 3NRVA 4LD5A 1LDDA 3QP6A 1MKMA 1YG2A 3R61A 1XMKA 3LSTA 4EV0A 2IVMA 2M8EA 3TO9A 2M30A 4H0EA 2W57A 1IRFA 2DO7A 1LEBA 1R00A 4KIGA 3BJ6A 4EJTA 4RAYA 5IT9K 3G73A 1H9TA 1B9NA 1IXCA 1G3SA 2Z99A 1B1BA 4HAMA 2KRFA 3FMRA 3ZN0A 2DT5A 5DV5A 4KYWA 3M8EA 3FHZA 1OYIA 3REOA 4Q4ZF 2VT2A 5BPDA 1ON1A 4P9UA 1P4AA 2JT1A 2DBBA 3KP7A 2EFWA 4NHJA 4UVAA 2UWMA 4A0XA 5LHGA 1FYKA 2UXNA 3GW2A 2GXBA 1J7KA 4YG2F 5ILUA 1H0MA 5FO5A 3J80K 3WTZA 1S6LA 4GXOA 3P9IA 4G6QA 3CUOA 3E5XA 1DUXC 2O3FA 5D8KB 1K7AA 4A6EA 4LB6B 1KQ0A 3KP2A 2GWRA 3I58A 3M9AA 4EM2A 2QZ8A 3W6JB 1B59A 3RIRA 3FXUA 5DEQA 4HX7A 4IJAA 3T8TA 1U6GA 5LLQA 1XGOA 1MJBA 1P6RA 1TNSA 3E6DA 4F7ZA 4ON0A 2EWNA 3LA3A 1EH8A 2OQRA 3EYYA 5FD5A 4M6XA 5L3BA 3IRRA 4KFCA 3P9CA 2VOPA 2R7FA 4EGYA 1J2XA 4BQAA 4HYEA 4LB5A 1EH6A 4GO1A 1OR7A 2Y0MA 4KICA 5LGTA 2FRHA 3LAPA 1IXSB 4IHSA 2R7DA 2QVOA 4RGRA 3HRSA 2A61A 2W25A 1UFMA 2QQ9A 1ULYA 1TQIA 2QUFA 3BWGA 1B4AA 4UXNA 2P8TA 2XKOA 3RDIA 5D8LB 2L54A 1U5TA 4IXAA 1LEAA 3F3XA 2STTA 3TQNA 3KLOA 1WKMA 1J59A 3JAMK 2YPRA 1FBQA 5H6RA 2ISZA 5J6XA 1SAXA 2VBYA 1ZH5A 4XBFA 2G7HA 3M8FA 5HS9A 5FLXZ 3KZYA 1FYMA 1FOKA 3V7RA 4WF2A 1SFEA 1ZGAA 1D8JA 4G6DA 5JFRA 1DPUA 2ADUA 2VBWA 3V7SA 2HQRA 4M9XA 1G3TA 4AVPA 1LVAA 2LNBA 4LGWA 5ICCA 4ENJA 2NYXA 1T6SA 3RYRA 4ESBA 5LRRA 3V8KA 4IRIA 2BBYA 2IJLA 4Y15A 1WWXA 1BBYA 4L5IA 3LA7A 1HSJA 1GXQA 3R6SA 2EB7A 1ZARA 1O3RA 4N9HA 1C0WA 2NRAC 5DYMA 2XVCA 2STWA 3WU0A 5LHHA 1ZLJA 4WCGA 2ZMEA 3BPXA 3BP8A 5TRDA 1I6XA 5K5RA 3R4KA 4K2EA 1W5SA 4RGXA 3BOQA 4UHTA 3DPTA 4LMYA 4Q47A 4MHGA 4CICA 2IA0A 4BYYA 4EM0B 5CVRA 4ESJA 2DFIA 5E1XA 3TDUC 2VODA 1UHMA 3LQRA 3NQOA 2CWEA 2ISYA 2M87A 4ZYHA 2C6YA 4NB5A 2XUBA 2MA3A 4JBAA 6PAXA 4XLNF 2MH2A 4XSXF 4KIFA 2UZKA 1P4WA 4LLLA 3QOPA 2HEOA 2FSWA 1CF7B 1FC3A 4CGZA 2K02A 4WX9A 3M1EA 1FNNA 2PG4A 4Y13A 4L9TA 2FA5A 3HSEA 1IAWA 5DDGA 3F6VA 2O03A 2H6CA 4N0BA 4KMFA 1I27A 4P55A 2FXAA 1YW7A 1I1SA 3U1DA 2A68F 2IPQX 2ZCWA 3EUHA 4KMUX 3HTSB 1ZLKA 2A07F 3KP4A 2BGCA 4HW0A 4EQQA 2KJBA 4FX0A 3FMQA 1IN6A 2VN2A 5L3CA 2FE3A 2DLLA 3GX4X 4RGUA 4HF2A 2DU9A 3SFZA 3FX3A 5A2QZ 3CJNA 2X0LA 3GVAA 5HS7A 1QZZA 3JTGA 2W84A 4MEXF 1A04A 4LJZF 3BPVA 2PEXA 1QZYA 1XSXA 2ZO4A 1P4XA 3CUQC 2P7CB 2CSOA 2M5WA 5DUKA 2HKOA 4G8XA 2J5PA 3ELKA 1XGSA 4IHTA 1QQIA 2GXGA 2A69F 4PGHA 3WTXC 1PDNC 1Q1HA 3KP3A 2XAGA 4I02A 2EJRA 4CDGA 1QBJA 3QU3A 3H3UA 5FGMA 3F72A 5D6FA 4OIQF 3DKWA 3L00A 3FXQA 4HQEA 5CVUA 1VTNC 3WODF 1TQPA 1RUOA 1R58A 1TLHB 2J5OA 4JK1X 3K2ZA 2YX4A 5CLSA 2FBHA 2GIVA 3CO6C 2EV0A 4QLCU 3F8CA 2OAZA 2XGXA 4KIBA 4OIOF 2Z5UA 4PDKA 3LFKA 3C3WA 4YFNF 3GLXA 2H09A 3KEOA 2PQ8A 5L3GA 2E7WA 2VE9A 1PP8F 2GA1A 3RJPA 3OV8A 3F23A 2VBXA 2RQPA 3QP5A 5JHUA 5FLXK 1E17A 2EV5A 2D2WA 3WE3A 5HVQC 4O3MA 3K9TA 4HV6A 3D0SA 1H9GA 4RB3C 4D0PA 4IPAA 2Q8KA 1ZRDA 4YFXF 1MZBA 1OKRA 1TNTA 4U0WA 5CVJA 5J8FA 3GWZA 1L0OC 4CHUA 1LDJA 1ZAOA 3E6BA 4BHCA 1XB4A 3DF8A 5ICFA 3RTRA 4PGGA 1W7PD 3FMSA 3WG9A 4MQVA 3I53A 3TKYA 2VC0A 3WTWC 5FFXA 1G6NA 5BPIA 4OIRF 5H6QA 3GO5A 1Y0UA 1S3JA 4EMSA 2KIMA 3TOAA 2D1VA 5ICGA 2W85A 3RKWA 4ZZDA 2Q0OA 3K1NA 1XSVA 3F8MA 4NQWA 1S8NA 3K1MA 2O0YA 1K6OA 3GUDA 4RS8A 2LF8A 1RI7A 2V9VA 5HOOA 2ESHA 1BC8C 3F21A 1RIOH 1HKTA 2YU3A 1QPMA 5L3EA 2PLYA 5HDNA 1RUNA 1HKQA 2JTVA 1IW7F 3N97A 3CO7C 4UUVA 2ZJ2A 4LG0B 3V4GA 3R0JA 3HTUA 2HWVA 2LF7A 1O7FA 2V1DA 3HUGA 3FM3A 3WGGA 1SMYF 2R3SA 4I09A 4L5JA 4RGSA 4RB0A 4QWQA 1Z6RA 1U8RA 1G3YA 1V4RA 3VEPA 4L0ZB 2VONA 3QPTA 1HW2A 2A6HF 3WTYC 3KP5A 3FM5A 3K0LA 4AWXB 2YSRA 4WXCA 3E5QA 3PFIA 4EGZA 1D8KA 3F22A 1T2KA 3SZTA 3OOPA 3HHGA 1KYWA 5HLIA 2XAHA 1KGSA 2DTRA 2KJCA 3MCZA 3ABUA 4WXDA 5ILSA 1HXDA 3DPLC 3SZPA 2VOOA 3TDZC 1REPC 2CYYA 4WXHA 1Z05A 2EFQA 3V8JA 4U7BA 1F4KA 1G4DA 3C18A 1KU2A 3QPHA 2L4AA 1HQCA 3U2RA 1FWZA 2FNAA 1BC7C 5EEGA 4IF4A 1Z7UA 4HDUA 1BI2A 2OU2A 4OINF 1S7OA 4HV5A 2MBFA 2XAQA 1GXPA 1SD4A 2NS0A 3IL2A 3PQJA 4KA4A 1F1ZA 2XKPA 4UNOA 2V79A 4ENNA 4G9YA 1KU7A 5E1ZB 4E70A 2A3SA 2K4BA 3L9FA 1UCRA 2CFXA 2XV4S 1CF7A 2ZNZA 1FP2A 1ZRCA 2HGCA 2QWWA 1AWCA 3I59B 3MEXA 3CDHA 4A2UA 4M72A 2ESNA 2PJPA 1ZYRF 4BAYA 4OMYA 2MLGA 4MTEA 2IRFG 3BDDA 3CTAA 3HSRA 3DEUA 1R22A 1JXSA 1O3TA 2GZWA 5ED4A 2PMHA 3I71A 5IT3A 4A12A 1XDUA 2KIFA 3BJAA 3ZP5A 2VE8A 2CG4A 5CVIA 1XCBA 4HDVA 3B73A 3VB2A 3LWFA 3EDPA 5FB2A 5ILVA 3BROA 1D5VA 2PMUA 2KIUA 2DQRA 3QAHA 1O57A 2MD5A 1K78B 1STZA 3F6OA 1XCVA 1QNTA 5D6EA 4S05A 2FU4A 3PQKA 2PBIA 1O3QA 3G3ZA 3MQ0A 1R23A 1P92A 3MAJA 5LGNA 1DPRA 4IRHA 2K7LA 2V1UA 3ECHA 5JR3A 3O2PE 4MEYF 3RPUA 3ZMUA 1XN7A 2F2EA 1L3LA 1JGSA 2L4MA 2NNYA 2QBYB 3EYIA 4ETSA 5IT9Z 4XSZF 2H94A 1BIBA 2AS5F 5D4RA 3QRFF 2F5DA 1HBXG 5LEJA 2Z3YA 2JSCA 3HHHA 1Z6TA 1KQ8A 2ZXJA 1JHHA 1U3EM 1FBSA 2P4WA 2P6TA 3ML6A 4I7HA 1B9MA 1BI3A 3C7JA 2E1NA 3F8BA 1KA8A 2OQGA 1FSEA 3F8FA 2XROA 1ZG5A 1IUYA 3CUQB 1HW1A 4YFKF 3JSOA 2EFOA 3E3VA 2WTEA 1FY7A 3GFJA 4Q5SF 3JSPA 1PP7U 1USTA 5FD6A 2RN7A 4EJOA 1WQ2A 3GEZA 2G7UA 1USSA 4M73A 5J8CA 4RB1A 4P96A 2L01A 2HTJA 1R1VA 5E1WA 4AIKA 1TW3A 2H6BA 2NAZA 1T39A 2QQBA 5K5OA 3GYHX 2IW5A 3DP7A 2HKXA 4KNYA 3ULQB 3RYPA 4HF1A 1SD6A 1FT9A 3KETA 2CQKA 1KYZA 1WRJA 2WC2A 4KT5C 1XGNA 2CGPA 2DI3A 3C1DA 5CJ9A 2VT3A 1DDNA 2D45A 2VBZA 4YIIA 3BY6A 3QU6A 4ZZLA 4R8HA 4ENMA 5E20A 1U5TC 3BJOA 5D5XB 1XD7A 2V6CA 1U78A 2F5CA 2WWYA 4PCQA 1IZ1A 3COAC 2RV8A 2JPBA 2P5VA 3I4PA 3GXOA 4HF0A 2PFBA 3HOTA 1J75A 4Q48A 4OIPF 2K86A 2GA2A 4N9IA 4HBLA 2LSOA 2HQNA 4MTDA 5ICEA 5BS6A 2DK8A 5CVVA 4L9JA 2A6EF 4M9ZA 2HR3A 2JRTA 3ECOA 3S2WA 4A0YA 2FMYA 1BI0A 3B02A 3R0AA 4G7HF 2M1BA 2X4HA 1BOAA 1OPCA 4ZYEA 1KU9A 1Z1DA 4ZH4F 1XSDA 1MJ9A 1IN4A 2EV6A 3GFLA 3MZHA 1PUEE 4BXUA 4I0BA 4U88A 4BHPA 4HQMA 5BQTA 3M7GA 2ELHA 1YTYA 2FOKA 2FBIA 1HW5A 2AXLA 1MDMB 1SD5A 3I0TA 4LG0A 4UVCA 1EV7A 3Q9SA 4A6DA 3RI4A 3FWEA 4S04A 4M71A 3VOEA 1D3YA 2F5FA 1T38A 4B8XA 1B6AA 2V1XA 3DV8A 1BM9A 4LFUA 2CW0F 1J9IA 3DQVC 1ZRFA 4A5MA 5F6FA 1XGMA 3I5UA 3ZPLA 2VC1A 5EEHA 4XRFA 3ZMTA 4I0AA 3ISPA 4P9FA 4YIFA 1R7JA 3JTHA 2H27A 4G94A 3W6KB 1R5HA 1W5TA 2ACJA 3R60A 4R1HA 3HOSA 3ABTA 2HDCA 3WTVC 2YX7A 4HX4A 2RVCA 3ZQ7A 3O3KA 1FP1D 3J81Z 2K4JA 1BIAA 1AOYA 5E17F 1FPQA 1IXRC 5H20A 1SFXA 3P7NA 2JPCA 3N4MA 4O6JA 1ZG3A 1X3UA 5DD8A 2BV6A 5E8GA 5JI6A 2FQ3A 4WK8F 3J7AO 4HLYA 1J5YA 3VFZA 4UVBA 4FHTA 4OU0A 3HYIA 3L2CA 1UB9A 3IKVA 4P5OA 5DCMB 4UV9A 2Y48A 2XASA 3I64A 3RKYA 2TDXA 3CLOA 4U7DA 1JE8A 1RZ4A 2KKOA 3IWZA 1FSHA 2RKHA 1QO0D 4FT8A 4I98B 3KZZA 1ZHFA 2RDPA 1R36A 2OZ6A 3FZVA 5D5WB 1BN5A 5DD4A 3I59A 3F8NA 3L09A 4R79A 1GVJA 1DP7P 3TOBA 2FF4A 3ZMZA 2O61A 5E18F 2BEOA 4LLGF 1LNWA 3DFGA 2FNPA 1ON2A 4HX8A 3MZYA 4L9VA 2XAFA 3WTTC 4Y17A 4L18B 1W7PA 1MD0A 1K78A 2DW4A 2EFNA 3U9GA 5LGUA 3EETA 4BHBA 3ERED 3H92A 1YIOA 4EJWA 5DUIA 2OZUA 5CYVA 2W24A 3TO7A 1YO5C 2DPUA 1FBUA 2P6SA 1YW8A 2ZBKA 1I5ZA 1BI1A 5A2QK 1RNLA 2DPDA 1WI9A 4UV8A 4OOIA 4FX4A 3RPQA 2YR2A 2Z9OA 4MNUA 1YLFA 2QBYA 1FX7A 5F1RA 2HYGD 2CO5A 4AD9A 4HLXA 3T1BA 1YFHA 3ZN1A 3HRMA 5BOXA 4A5NA 2IA1A 4RAZA 1ONVA 1LB2A 1ODDA 1S7AA 1ZGJA 1S29A 1ZN2A 2EA4A 2PN6A 3CUQA 3SXYA 1NHAA 2HYFA 2OBPA 1J0RA 2BYVE 2FBKA 3IHUA 3GFIA 1O7LA 4AIJA 1EH7A 2RGVA 3VODA 1FZPB 4ZYGA 1LQ1A 1V3FA 5KVRA 5L3FA 1FLIA 2DK5A 1E2XA 4U0VA 4OMZA 3V8LA 2QQAA 2HOEA 5D5VB 3WGIA 3KP6A 2E7XA 1LJ9A 1TBXA 4EM1A 4M74A 5FFZA 3KE2A 4G7ZF 1W7PB 2DAOA 3NEUA 5L3DA 1IN7A 1JHFA 4EVIA 2FEZA 3KLNA 4A0ZA 3MWMA 3O6BB 2GQQA 4CO8A 5LHIA 4CXFA 5BMZA 1FYLA 3AAFA 4WWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ENK A;  2P7V B;  1TW2 A;  4GGG A;  3JW4 A;  3T0Y A;  2QEN A;  2IT0 A;  5AON A;  2XAJ A;  2L3D A;  1YQA A;  1F9N A;  1BJA A;  2ZNY A;  3ZMV A;  4GYI A;  4EJU A;  4M9S A;  3J81 K;  1ZG1 A;  5K1Y A;  3LA2 A;  1HKS A;  2OA4 A;  3Q9V A;  4I2O A;  4MGR A;  1IN5 A;  5TJJ A;  2HS5 A;  2A5Y B;  1IN8 A;  4MQ9 F;  2MC3 A;  3T5X A;  3GZ6 A;  2OD5 A;  3I54 A;  4IVN A;  5HDG A;  5HS8 A;  2HFH A;  3K69 A;  4KN4 X;  4KN7 X;  2E1C A;  1U5T B;  4BH9 A;  4IRG A;  4B09 A;  3RKX A;  2IA2 A;  3E5U A;  4KUM A;  2Y75 A;  5AIP A;  4DNC A;  1SFU A;  3K1P A;  1R1T A;  4Z2Y A;  1P2F A;  3J80 Z;  3MFK A;  2L02 A;  4EJV A;  4L9N A;  1MDM A;  4G7O F;  5JVT A;  3GF2 A;  4HOB A;  3TO6 A;  1CGP A;  2VXZ A;  2HTS A;  1OMI A;  3HRU A;  2GAU A;  3GZ5 A;  1TTY A;  2DQL A;  2MH9 A;  4BNC A;  3Q5F A;  1SMT A;  1YS7 A;  3HIF A;  3ZMD A;  2EK5 A;  2K27 A;  3KEQ A;  1WSU A;  3HRT A;  2ETH A;  1KQ9 A;  2P5K A;  3E6M A;  4I01 A;  4KDP A;  3GFM A;  5AIQ A;  2FML A;  3E97 A;  1GHC A;  5DCF A;  5E8I A;  1R5G A;  1QGP A;  4HZF A;  2QLZ A;  3LQQ A;  3SQN A;  4JQF A;  1LDK B;  2ZME B;  3WTS C;  4M6Y A;  2BE5 F;  4GCV A;  3IKT A;  3WGH A;  1YW9 A;  4RB2 C;  4GYG A;  2XIG A;  3IRQ A;  3ROU A;  4ESF A;  3P9K A;  1IF1 A;  3E6C C;  3WTU C;  1YYV A;  2XHK A;  4AIH A;  2XRN A;  1W4M A;  1SD7 A;  2ZFW A;  2EA2 A;  5DCM A;  4PZJ A;  3JAM Z;  2JZY A;  3EQL F;  3ZMS A;  4LK0 F;  4ZYD A;  2LDU A;  4O5V A;  1K79 A;  3T8R A;  2RNJ A;  2G9W A;  3HSF A;  1Z9C A;  2M45 A;  1KU3 A;  1F5T A;  2F5E A;  4CYD A;  1YS6 A;  2PI0 A;  2ZKZ A;  1Z91 A;  2O6G E;  2UXX A;  5HLH A;  1ZRE A;  2O8X A;  2HZT A;  3LAJ A;  4TV7 A;  5HDK A;  3TGN A;  2P5L C;  1T0F A;  2Q2E A;  1O3S A;  2COM A;  4L0Y B;  5LRS A;  2WV0 A;  5D4S A;  5F64 A;  5LBQ A;  2Z33 A;  5KK1 A;  4ASN A;  1T98 A;  1OYW A;  3D5L A;  5K5Q A;  1IRG A;  3L7W A;  4LLN A;  1MGT A;  2EFP A;  1R1U A;  1U2W A;  1MJA A;  2QYO A;  3IC7 A;  2NNN A;  4XLP F;  2QM3 A;  3IWF A;  3KCC A;  2B0L A;  4LK1 F;  2IP2 A;  2LKP A;  2RC4 A;  3H3Z A;  5ERI A;  1XDS A;  1I1G A;  5D5U B;  5LEK A;  5HLG A;  1XMA A;  3WE2 A;  3BZ6 A;  3FXR A;  3DXJ F;  3FF5 A;  1UHW A;  4DQ2 A;  1G3W A;  1HST A;  3KFW X;  3V7C A;  1OYY A;  3SHF A;  4CZZ A;  2D1H A;  4U0Y A;  3WU1 B;  1TQM A;  2MLK A;  4HA8 A;  3NRV A;  4LD5 A;  1LDD A;  3QP6 A;  1MKM A;  1YG2 A;  3R61 A;  1XMK A;  3LST A;  4EV0 A;  2IVM A;  2M8E A;  3TO9 A;  2M30 A;  4H0E A;  2W57 A;  1IRF A;  2DO7 A;  1LEB A;  1R00 A;  4KIG A;  3BJ6 A;  4EJT A;  4RAY A;  5IT9 K;  3G73 A;  1H9T A;  1B9N A;  1IXC A;  1G3S A;  2Z99 A;  1B1B A;  4HAM A;  2KRF A;  3FMR A;  3ZN0 A;  2DT5 A;  5DV5 A;  4KYW A;  3M8E A;  3FHZ A;  1OYI A;  3REO A;  4Q4Z F;  2VT2 A;  5BPD A;  1ON1 A;  4P9U A;  1P4A A;  2JT1 A;  2DBB A;  3KP7 A;  2EFW A;  4NHJ A;  4UVA A;  2UWM A;  4A0X A;  5LHG A;  1FYK A;  2UXN A;  3GW2 A;  2GXB A;  1J7K A;  4YG2 F;  5ILU A;  1H0M A;  5FO5 A;  3J80 K;  3WTZ A;  1S6L A;  4GXO A;  3P9I A;  4G6Q A;  3CUO A;  3E5X A;  1DUX C;  2O3F A;  5D8K B;  1K7A A;  4A6E A;  4LB6 B;  1KQ0 A;  3KP2 A;  2GWR A;  3I58 A;  3M9A A;  4EM2 A;  2QZ8 A;  3W6J B;  1B59 A;  3RIR A;  3FXU A;  5DEQ A;  4HX7 A;  4IJA A;  3T8T A;  1U6G A;  5LLQ A;  1XGO A;  1MJB A;  1P6R A;  1TNS A;  3E6D A;  4F7Z A;  4ON0 A;  2EWN A;  3LA3 A;  1EH8 A;  2OQR A;  3EYY A;  5FD5 A;  4M6X A;  5L3B A;  3IRR A;  4KFC A;  3P9C A;  2VOP A;  2R7F A;  4EGY A;  1J2X A;  4BQA A;  4HYE A;  4LB5 A;  1EH6 A;  4GO1 A;  1OR7 A;  2Y0M A;  4KIC A;  5LGT A;  2FRH A;  3LAP A;  1IXS B;  4IHS A;  2R7D A;  2QVO A;  4RGR A;  3HRS A;  2A61 A;  2W25 A;  1UFM A;  2QQ9 A;  1ULY A;  1TQI A;  2QUF A;  3BWG A;  1B4A A;  4UXN A;  2P8T A;  2XKO A;  3RDI A;  5D8L B;  2L54 A;  1U5T A;  4IXA A;  1LEA A;  3F3X A;  2STT A;  3TQN A;  3KLO A;  1WKM A;  1J59 A;  3JAM K;  2YPR A;  1FBQ A;  5H6R A;  2ISZ A;  5J6X A;  1SAX A;  2VBY A;  1ZH5 A;  4XBF A;  2G7H A;  3M8F A;  5HS9 A;  5FLX Z;  3KZY A;  1FYM A;  1FOK A;  3V7R A;  4WF2 A;  1SFE A;  1ZGA A;  1D8J A;  4G6D A;  5JFR A;  1DPU A;  2ADU A;  2VBW A;  3V7S A;  2HQR A;  4M9X A;  1G3T A;  4AVP A;  1LVA A;  2LNB A;  4LGW A;  5ICC A;  4ENJ A;  2NYX A;  1T6S A;  3RYR A;  4ESB A;  5LRR A;  3V8K A;  4IRI A;  2BBY A;  2IJL A;  4Y15 A;  1WWX A;  1BBY A;  4L5I A;  3LA7 A;  1HSJ A;  1GXQ A;  3R6S A;  2EB7 A;  1ZAR A;  1O3R A;  4N9H A;  1C0W A;  2NRA C;  5DYM A;  2XVC A;  2STW A;  3WU0 A;  5LHH A;  1ZLJ A;  4WCG A;  2ZME A;  3BPX A;  3BP8 A;  5TRD A;  1I6X A;  5K5R A;  3R4K A;  4K2E A;  1W5S A;  4RGX A;  3BOQ A;  4UHT A;  3DPT A;  4LMY A;  4Q47 A;  4MHG A;  4CIC A;  2IA0 A;  4BYY A;  4EM0 B;  5CVR A;  4ESJ A;  2DFI A;  5E1X A;  3TDU C;  2VOD A;  1UHM A;  3LQR A;  3NQO A;  2CWE A;  2ISY A;  2M87 A;  4ZYH A;  2C6Y A;  4NB5 A;  2XUB A;  2MA3 A;  4JBA A;  6PAX A;  4XLN F;  2MH2 A;  4XSX F;  4KIF A;  2UZK A;  1P4W A;  4LLL A;  3QOP A;  2HEO A;  2FSW A;  1CF7 B;  1FC3 A;  4CGZ A;  2K02 A;  4WX9 A;  3M1E A;  1FNN A;  2PG4 A;  4Y13 A;  4L9T A;  2FA5 A;  3HSE A;  1IAW A;  5DDG A;  3F6V A;  2O03 A;  2H6C A;  4N0B A;  4KMF A;  1I27 A;  4P55 A;  2FXA A;  1YW7 A;  1I1S A;  3U1D A;  2A68 F;  2IPQ X;  2ZCW A;  3EUH A;  4KMU X;  3HTS B;  1ZLK A;  2A07 F;  3KP4 A;  2BGC A;  4HW0 A;  4EQQ A;  2KJB A;  4FX0 A;  3FMQ A;  1IN6 A;  2VN2 A;  5L3C A;  2FE3 A;  2DLL A;  3GX4 X;  4RGU A;  4HF2 A;  2DU9 A;  3SFZ A;  3FX3 A;  5A2Q Z;  3CJN A;  2X0L A;  3GVA A;  5HS7 A;  1QZZ A;  3JTG A;  2W84 A;  4MEX F;  1A04 A;  4LJZ F;  3BPV A;  2PEX A;  1QZY A;  1XSX A;  2ZO4 A;  1P4X A;  3CUQ C;  2P7C B;  2CSO A;  2M5W A;  5DUK A;  2HKO A;  4G8X A;  2J5P A;  3ELK A;  1XGS A;  4IHT A;  1QQI A;  2GXG A;  2A69 F;  4PGH A;  3WTX C;  1PDN C;  1Q1H A;  3KP3 A;  2XAG A;  4I02 A;  2EJR A;  4CDG A;  1QBJ A;  3QU3 A;  3H3U A;  5FGM A;  3F72 A;  5D6F A;  4OIQ F;  3DKW A;  3L00 A;  3FXQ A;  4HQE A;  5CVU A;  1VTN C;  3WOD F;  1TQP A;  1RUO A;  1R58 A;  1TLH B;  2J5O A;  4JK1 X;  3K2Z A;  2YX4 A;  5CLS A;  2FBH A;  2GIV A;  3CO6 C;  2EV0 A;  4QLC U;  3F8C A;  2OAZ A;  2XGX A;  4KIB A;  4OIO F;  2Z5U A;  4PDK A;  3LFK A;  3C3W A;  4YFN F;  3GLX A;  2H09 A;  3KEO A;  2PQ8 A;  5L3G A;  2E7W A;  2VE9 A;  1PP8 F;  2GA1 A;  3RJP A;  3OV8 A;  3F23 A;  2VBX A;  2RQP A;  3QP5 A;  5JHU A;  5FLX K;  1E17 A;  2EV5 A;  2D2W A;  3WE3 A;  5HVQ C;  4O3M A;  3K9T A;  4HV6 A;  3D0S A;  1H9G A;  4RB3 C;  4D0P A;  4IPA A;  2Q8K A;  1ZRD A;  4YFX F;  1MZB A;  1OKR A;  1TNT A;  4U0W A;  5CVJ A;  5J8F A;  3GWZ A;  1L0O C;  4CHU A;  1LDJ A;  1ZAO A;  3E6B A;  4BHC A;  1XB4 A;  3DF8 A;  5ICF A;  3RTR A;  4PGG A;  1W7P D;  3FMS A;  3WG9 A;  4MQV A;  3I53 A;  3TKY A;  2VC0 A;  3WTW C;  5FFX A;  1G6N A;  5BPI A;  4OIR F;  5H6Q A;  3GO5 A;  1Y0U A;  1S3J A;  4EMS A;  2KIM A;  3TOA A;  2D1V A;  5ICG A;  2W85 A;  3RKW A;  4ZZD A;  2Q0O A;  3K1N A;  1XSV A;  3F8M A;  4NQW A;  1S8N A;  3K1M A;  2O0Y A;  1K6O A;  3GUD A;  4RS8 A;  2LF8 A;  1RI7 A;  2V9V A;  5HOO A;  2ESH A;  1BC8 C;  3F21 A;  1RIO H;  1HKT A;  2YU3 A;  1QPM A;  5L3E A;  2PLY A;  5HDN A;  1RUN A;  1HKQ A;  2JTV A;  1IW7 F;  3N97 A;  3CO7 C;  4UUV A;  2ZJ2 A;  4LG0 B;  3V4G A;  3R0J A;  3HTU A;  2HWV A;  2LF7 A;  1O7F A;  2V1D A;  3HUG A;  3FM3 A;  3WGG A;  1SMY F;  2R3S A;  4I09 A;  4L5J A;  4RGS A;  4RB0 A;  4QWQ A;  1Z6R A;  1U8R A;  1G3Y A;  1V4R A;  3VEP A;  4L0Z B;  2VON A;  3QPT A;  1HW2 A;  2A6H F;  3WTY C;  3KP5 A;  3FM5 A;  3K0L A;  4AWX B;  2YSR A;  4WXC A;  3E5Q A;  3PFI A;  4EGZ A;  1D8K A;  3F22 A;  1T2K A;  3SZT A;  3OOP A;  3HHG A;  1KYW A;  5HLI A;  2XAH A;  1KGS A;  2DTR A;  2KJC A;  3MCZ A;  3ABU A;  4WXD A;  5ILS A;  1HXD A;  3DPL C;  3SZP A;  2VOO A;  3TDZ C;  1REP C;  2CYY A;  4WXH A;  1Z05 A;  2EFQ A;  3V8J A;  4U7B A;  1F4K A;  1G4D A;  3C18 A;  1KU2 A;  3QPH A;  2L4A A;  1HQC A;  3U2R A;  1FWZ A;  2FNA A;  1BC7 C;  5EEG A;  4IF4 A;  1Z7U A;  4HDU A;  1BI2 A;  2OU2 A;  4OIN F;  1S7O A;  4HV5 A;  2MBF A;  2XAQ A;  1GXP A;  1SD4 A;  2NS0 A;  3IL2 A;  3PQJ A;  4KA4 A;  1F1Z A;  2XKP A;  4UNO A;  2V79 A;  4ENN A;  4G9Y A;  1KU7 A;  5E1Z B;  4E70 A;  2A3S A;  2K4B A;  3L9F A;  1UCR A;  2CFX A;  2XV4 S;  1CF7 A;  2ZNZ A;  1FP2 A;  1ZRC A;  2HGC A;  2QWW A;  1AWC A;  3I59 B;  3MEX A;  3CDH A;  4A2U A;  4M72 A;  2ESN A;  2PJP A;  1ZYR F;  4BAY A;  4OMY A;  2MLG A;  4MTE A;  2IRF G;  3BDD A;  3CTA A;  3HSR A;  3DEU A;  1R22 A;  1JXS A;  1O3T A;  2GZW A;  5ED4 A;  2PMH A;  3I71 A;  5IT3 A;  4A12 A;  1XDU A;  2KIF A;  3BJA A;  3ZP5 A;  2VE8 A;  2CG4 A;  5CVI A;  1XCB A;  4HDV A;  3B73 A;  3VB2 A;  3LWF A;  3EDP A;  5FB2 A;  5ILV A;  3BRO A;  1D5V A;  2PMU A;  2KIU A;  2DQR A;  3QAH A;  1O57 A;  2MD5 A;  1K78 B;  1STZ A;  3F6O A;  1XCV A;  1QNT A;  5D6E A;  4S05 A;  2FU4 A;  3PQK A;  2PBI A;  1O3Q A;  3G3Z A;  3MQ0 A;  1R23 A;  1P92 A;  3MAJ A;  5LGN A;  1DPR A;  4IRH A;  2K7L A;  2V1U A;  3ECH A;  5JR3 A;  3O2P E;  4MEY F;  3RPU A;  3ZMU A;  1XN7 A;  2F2E A;  1L3L A;  1JGS A;  2L4M A;  2NNY A;  2QBY B;  3EYI A;  4ETS A;  5IT9 Z;  4XSZ F;  2H94 A;  1BIB A;  2AS5 F;  5D4R A;  3QRF F;  2F5D A;  1HBX G;  5LEJ A;  2Z3Y A;  2JSC A;  3HHH A;  1Z6T A;  1KQ8 A;  2ZXJ A;  1JHH A;  1U3E M;  1FBS A;  2P4W A;  2P6T A;  3ML6 A;  4I7H A;  1B9M A;  1BI3 A;  3C7J A;  2E1N A;  3F8B A;  1KA8 A;  2OQG A;  1FSE A;  3F8F A;  2XRO A;  1ZG5 A;  1IUY A;  3CUQ B;  1HW1 A;  4YFK F;  3JSO A;  2EFO A;  3E3V A;  2WTE A;  1FY7 A;  3GFJ A;  4Q5S F;  3JSP A;  1PP7 U;  1UST A;  5FD6 A;  2RN7 A;  4EJO A;  1WQ2 A;  3GEZ A;  2G7U A;  1USS A;  4M73 A;  5J8C A;  4RB1 A;  4P96 A;  2L01 A;  2HTJ A;  1R1V A;  5E1W A;  4AIK A;  1TW3 A;  2H6B A;  2NAZ A;  1T39 A;  2QQB A;  5K5O A;  3GYH X;  2IW5 A;  3DP7 A;  2HKX A;  4KNY A;  3ULQ B;  3RYP A;  4HF1 A;  1SD6 A;  1FT9 A;  3KET A;  2CQK A;  1KYZ A;  1WRJ A;  2WC2 A;  4KT5 C;  1XGN A;  2CGP A;  2DI3 A;  3C1D A;  5CJ9 A;  2VT3 A;  1DDN A;  2D45 A;  2VBZ A;  4YII A;  3BY6 A;  3QU6 A;  4ZZL A;  4R8H A;  4ENM A;  5E20 A;  1U5T C;  3BJO A;  5D5X B;  1XD7 A;  2V6C A;  1U78 A;  2F5C A;  2WWY A;  4PCQ A;  1IZ1 A;  3COA C;  2RV8 A;  2JPB A;  2P5V A;  3I4P A;  3GXO A;  4HF0 A;  2PFB A;  3HOT A;  1J75 A;  4Q48 A;  4OIP F;  2K86 A;  2GA2 A;  4N9I A;  4HBL A;  2LSO A;  2HQN A;  4MTD A;  5ICE A;  5BS6 A;  2DK8 A;  5CVV A;  4L9J A;  2A6E F;  4M9Z A;  2HR3 A;  2JRT A;  3ECO A;  3S2W A;  4A0Y A;  2FMY A;  1BI0 A;  3B02 A;  3R0A A;  4G7H F;  2M1B A;  2X4H A;  1BOA A;  1OPC A;  4ZYE A;  1KU9 A;  1Z1D A;  4ZH4 F;  1XSD A;  1MJ9 A;  1IN4 A;  2EV6 A;  3GFL A;  3MZH A;  1PUE E;  4BXU A;  4I0B A;  4U88 A;  4BHP A;  4HQM A;  5BQT A;  3M7G A;  2ELH A;  1YTY A;  2FOK A;  2FBI A;  1HW5 A;  2AXL A;  1MDM B;  1SD5 A;  3I0T A;  4LG0 A;  4UVC A;  1EV7 A;  3Q9S A;  4A6D A;  3RI4 A;  3FWE A;  4S04 A;  4M71 A;  3VOE A;  1D3Y A;  2F5F A;  1T38 A;  4B8X A;  1B6A A;  2V1X A;  3DV8 A;  1BM9 A;  4LFU A;  2CW0 F;  1J9I A;  3DQV C;  1ZRF A;  4A5M A;  5F6F A;  1XGM A;  3I5U A;  3ZPL A;  2VC1 A;  5EEH A;  4XRF A;  3ZMT A;  4I0A A;  3ISP A;  4P9F A;  4YIF A;  1R7J A;  3JTH A;  2H27 A;  4G94 A;  3W6K B;  1R5H A;  1W5T A;  2ACJ A;  3R60 A;  4R1H A;  3HOS A;  3ABT A;  2HDC A;  3WTV C;  2YX7 A;  4HX4 A;  2RVC A;  3ZQ7 A;  3O3K A;  1FP1 D;  3J81 Z;  2K4J A;  1BIA A;  1AOY A;  5E17 F;  1FPQ A;  1IXR C;  5H20 A;  1SFX A;  3P7N A;  2JPC A;  3N4M A;  4O6J A;  1ZG3 A;  1X3U A;  5DD8 A;  2BV6 A;  5E8G A;  5JI6 A;  2FQ3 A;  4WK8 F;  3J7A O;  4HLY A;  1J5Y A;  3VFZ A;  4UVB A;  4FHT A;  4OU0 A;  3HYI A;  3L2C A;  1UB9 A;  3IKV A;  4P5O A;  5DCM B;  4UV9 A;  2Y48 A;  2XAS A;  3I64 A;  3RKY A;  2TDX A;  3CLO A;  4U7D A;  1JE8 A;  1RZ4 A;  2KKO A;  3IWZ A;  1FSH A;  2RKH A;  1QO0 D;  4FT8 A;  4I98 B;  3KZZ A;  1ZHF A;  2RDP A;  1R36 A;  2OZ6 A;  3FZV A;  5D5W B;  1BN5 A;  5DD4 A;  3I59 A;  3F8N A;  3L09 A;  4R79 A;  1GVJ A;  1DP7 P;  3TOB A;  2FF4 A;  3ZMZ A;  2O61 A;  5E18 F;  2BEO A;  4LLG F;  1LNW A;  3DFG A;  2FNP A;  1ON2 A;  4HX8 A;  3MZY A;  4L9V A;  2XAF A;  3WTT C;  4Y17 A;  4L18 B;  1W7P A;  1MD0 A;  1K78 A;  2DW4 A;  2EFN A;  3U9G A;  5LGU A;  3EET A;  4BHB A;  3ERE D;  3H92 A;  1YIO A;  4EJW A;  5DUI A;  2OZU A;  5CYV A;  2W24 A;  3TO7 A;  1YO5 C;  2DPU A;  1FBU A;  2P6S A;  1YW8 A;  2ZBK A;  1I5Z A;  1BI1 A;  5A2Q K;  1RNL A;  2DPD A;  1WI9 A;  4UV8 A;  4OOI A;  4FX4 A;  3RPQ A;  2YR2 A;  2Z9O A;  4MNU A;  1YLF A;  2QBY A;  1FX7 A;  5F1R A;  2HYG D;  2CO5 A;  4AD9 A;  4HLX A;  3T1B A;  1YFH A;  3ZN1 A;  3HRM A;  5BOX A;  4A5N A;  2IA1 A;  4RAZ A;  1ONV A;  1LB2 A;  1ODD A;  1S7A A;  1ZGJ A;  1S29 A;  1ZN2 A;  2EA4 A;  2PN6 A;  3CUQ A;  3SXY A;  1NHA A;  2HYF A;  2OBP A;  1J0R A;  2BYV E;  2FBK A;  3IHU A;  3GFI A;  1O7L A;  4AIJ A;  1EH7 A;  2RGV A;  3VOD A;  1FZP B;  4ZYG A;  1LQ1 A;  1V3F A;  5KVR A;  5L3F A;  1FLI A;  2DK5 A;  1E2X A;  4U0V A;  4OMZ A;  3V8L A;  2QQA A;  2HOE A;  5D5V B;  3WGI A;  3KP6 A;  2E7X A;  1LJ9 A;  1TBX A;  4EM1 A;  4M74 A;  5FFZ A;  3KE2 A;  4G7Z F;  1W7P B;  2DAO A;  3NEU A;  5L3D A;  1IN7 A;  1JHF A;  4EVI A;  2FEZ A;  3KLN A;  4A0Z A;  3MWM A;  3O6B B;  2GQQ A;  4CO8 A;  5LHI A;  4CXF A;  5BMZ A;  1FYL A;  3AAF A;  4WWC A; 
#chains in the Genus database with same CATH topology
 4CA0 A;  2E1M C;  2EIN H;  2ELK A;  4RLF A;  4ENK A;  2HQA A;  2P7V B;  5LD2 C;  1TW2 A;  2L2O A;  4MFE A;  4A3D J;  4GGG A;  4HEA 2;  3JW4 A;  3PM1 A;  2XDV A;  3T0Y A;  2QEN A;  2JVH A;  2R5Z A;  2IT0 A;  5AON A;  3BZC A;  2XAJ A;  2NVT J;  2FUG 2;  3H9J A;  1XX5 A;  2L3D A;  1YQA A;  3GTG J;  2BY3 A;  1VQP I;  1F9N A;  1BJA A;  3BQZ A;  3KYD B;  1LKX A;  3A03 A;  2PMZ N;  2NVY J;  2ZNY A;  3IH2 A;  3ZMV A;  2ICW G;  4GYI A;  3DCF A;  4M9S A;  1IV8 A;  4EJU A;  3J81 K;  4W1U A;  1ZG1 A;  5K1Y A;  3LA2 A;  1HKS A;  3H5A A;  1ETQ A;  2OA4 A;  3Q9V A;  4UUS A;  4I2O A;  4F93 B;  4MGR A;  1IN5 A;  5TJJ A;  3TL4 X;  1T33 A;  4MIM A;  2HS5 A;  2E36 A;  2Z16 A;  2A5Y B;  2RNG A;  1IN8 A;  4MQ9 F;  2MC3 A;  3T5X A;  3GZ6 A;  2OD5 A;  3I54 A;  4ZDP A;  2DT7 B;  2OCC H;  4IVN A;  2DT6 A;  5HDG A;  1F36 A;  1OQY A;  2HPI A;  5HS8 A;  2P81 A;  2YU9 J;  2EIK H;  1H89 C;  1OCZ H;  2HFH A;  3TED A;  4KIS A;  2FJ1 A;  3K69 A;  4KN4 X;  4KN7 X;  4Y33 A;  2E1C A;  1U5T B;  2GM4 A;  3ZRG A;  4GDF A;  2JK3 A;  4BH9 A;  4IRG A;  2KZG A;  4ZYA A;  4B09 A;  2ZFU A;  2BY1 A;  3ZXS A;  3RKX A;  2IA2 A;  4A3G J;  3M4O J;  3DTK A;  3LSM A;  3DTI A;  3E5U A;  4KUM A;  1IV6 A;  2Y75 A;  5AIP A;  5F0H A;  4D9J A;  2LRD A;  4DNC A;  1SFU A;  3K1P A;  1Y39 A;  1R1T A;  2HQ5 A;  2XGC A;  4Z2Y A;  4BJT A;  1P2F A;  2JQ7 A;  3SJM A;  1OJL A;  3J80 Z;  3MFK A;  4BGD A;  4B43 A;  2L02 A;  4EJV A;  4B3X A;  2ZJR F;  4L9N A;  1MDM A;  2V1N A;  1ETK A;  3KX2 A;  4G7O F;  2K9Q A;  1I6H J;  4FET A;  3S1N J;  5JVT A;  2E2H J;  3GF2 A;  2EZI A;  3ZQQ A;  4HOB A;  2KPM A;  5FKO A;  3TO6 A;  4AID A;  4JX4 A;  4NBQ A;  4YRV A;  1CGP A;  4BEH B;  2VXZ A;  5J4Y A;  2HTS A;  2VJ4 A;  1OMI A;  3HRU A;  5M5Y J;  2GAU A;  3GZ5 A;  1TTY A;  3MD2 A;  2DQL A;  2MH9 A;  5GAE J;  1V5G A;  3JRD A;  4BNC A;  4DOZ A;  2VB6 A;  4RDU A;  1V5F A;  3Q5F A;  2MSY A;  5B1B H;  1ZK8 A;  1SMT A;  1XPX A;  1YS7 A;  5GAD J;  1X2M A;  4EEF G;  2WV1 A;  3HIF A;  3BTC A;  3ZMD A;  2QKM B;  2QEX I;  1X1B A;  2K3P A;  2EK5 A;  2K27 A;  3KEQ A;  1JUP A;  2F4I A;  1I3A A;  1R6R A;  1WSU A;  3HRT A;  3PO3 J;  2ETH A;  2XGE A;  1KQ9 A;  2R7S A;  2P5K A;  3E6M A;  2R7W A;  4I01 A;  4KDP A;  3GFM A;  5EF6 A;  5AIQ A;  3NAR A;  1JTY A;  3NWS A;  2FML A;  2ZXH A;  3E97 A;  3QOE A;  3OSF A;  1GHC A;  3BG7 A;  2X51 A;  5DCF A;  5E8I A;  5GTH C;  1R5G A;  1MND A;  1GUU A;  3CJQ B;  1QU3 A;  1QGP A;  4HZF A;  2QLZ A;  2L7F P;  1FTZ A;  3GTO J;  3LQQ A;  5CPR B;  1WHU A;  2R5Z B;  3SQN A;  3BTL A;  1BL0 A;  3FKJ A;  4Y52 J;  4JQF A;  2Z2S B;  1OCC H;  1LDK B;  2X9D A;  2ZME B;  4PSX A;  3WTS C;  4M6Y A;  2BE5 F;  3ABK H;  4GCV A;  4LOC A;  2VQH A;  1IDY A;  2X1E A;  3IKT A;  3QYF A;  3WGH A;  1YW9 A;  4RB2 C;  2HVS A;  4GYG A;  2XIG A;  3IRQ A;  2OTJ I;  3ROU A;  2R7O A;  4XQF A;  4M3B A;  5F04 A;  9ANT A;  4ESF A;  4UUS B;  4BQO A;  2R0Q C;  4C2U A;  4OAY A;  2FD5 A;  3SFI A;  5FKL A;  3P9K A;  2UV1 A;  1IF1 A;  3FBI B;  3E6C C;  1MBF A;  1RPW A;  2WAD A;  3RSN A;  4JYK A;  3WTU C;  4AYB N;  1YYV A;  2XHK A;  3BG9 A;  4AIH A;  2XRN A;  1W4M A;  1HA8 A;  2CV2 A;  1SD7 A;  1RKT A;  4BDZ A;  2ZFW A;  2EA2 A;  3AG2 H;  3H9G A;  5DCM A;  5EDN A;  5TIS C;  4PZJ A;  3JAM Z;  2JZY A;  3EQL F;  1J09 A;  1N78 A;  3ZMS A;  5C4J J;  3PIO F;  4LK0 F;  4ZYD A;  2NVQ J;  2R7Z J;  4CYC A;  1X2N A;  2LDU A;  2K40 A;  4O5V A;  1K79 A;  3T8R A;  1FMW A;  2RNJ A;  4PK4 A;  2VQG A;  2G9W A;  3HSF A;  1Z9C A;  2DJN A;  2M45 A;  1KU3 A;  2WB1 A;  3JRG A;  1F5T A;  3AG1 H;  2F5E A;  4CYD A;  1YS6 A;  2PI0 A;  2ZKZ A;  3AKZ A;  1Z91 A;  2O6G E;  1FTT A;  4ABZ A;  2UXX A;  1IUF A;  1X1D A;  5HLH A;  3IAM 2;  2O8X A;  4C9Y A;  1ZRE A;  1TWG J;  2HZT A;  2JRM A;  1JKP C;  3LAJ A;  2HNH A;  1VQ9 I;  3QWL A;  2ECB A;  1GT0 C;  4PJL A;  5CQE A;  3FXJ A;  1XS9 A;  4TV7 A;  5HDK A;  2AQF A;  3TGN A;  1T0F A;  2Q2E A;  3GCM A;  2P5L C;  3J7Z I;  2WAQ N;  1ACI A;  1O3S A;  2COM A;  2EH3 A;  4L5E A;  5LRS A;  4L0Y B;  2NVU B;  2WV0 A;  1POG A;  1G59 A;  5D4S A;  1VQ8 I;  1T56 A;  5F64 A;  4A3E J;  5LBQ A;  1LPQ A;  2Z33 A;  2ZME C;  5KK1 A;  4ASN A;  1T98 A;  1OYW A;  1QZE A;  3D5L A;  3X2Q H;  5K5Q A;  1IRG A;  1APL C;  3L7W A;  4B48 A;  3CCQ I;  4LLN A;  1MGT A;  1R5I D;  2EFP A;  1DU0 A;  1R1U A;  2LH9 A;  1U2W A;  1YIT I;  3I4N J;  1YX3 A;  3CMA I;  1MJA A;  2QYO A;  3IC7 A;  2NNN A;  4XLP F;  1BW5 A;  2JA7 J;  2W82 A;  5GTI C;  1VQ5 I;  3SEZ A;  1SC7 A;  2QM3 A;  2DFE A;  3IWF A;  3KCC A;  2B0L A;  4LK1 F;  2IP2 A;  2LKP A;  2RC4 A;  3H3Z A;  5ERI A;  1XDS A;  2O9L A;  1I1G A;  1JKQ C;  5D5U B;  4ANJ A;  1VZ0 A;  5LEK A;  5F1J A;  2XPW A;  5HLG A;  1Y1W J;  1XMA A;  3WE2 A;  3BZ6 A;  4IKF A;  3FXR A;  3DXJ F;  1LFB A;  2R5Y A;  2R7Q A;  3FF5 A;  1UHW A;  2IAI A;  4DQ2 A;  2E2J J;  1G3W A;  2Y0S A;  4XKC A;  3OIQ A;  3AL0 B;  2NVX J;  5FKM A;  3W2A A;  4KT6 A;  1HST A;  3KFW X;  4IL6 C;  3V7C A;  1OYY A;  3SHF A;  4FAS D;  4CZZ A;  3HDD A;  1MIJ A;  4E7I A;  2ME0 A;  4NC8 A;  2D1H A;  3K4B A;  2XSJ C;  4U0Y A;  2EZL A;  5IYD J;  3WU1 B;  1NH3 A;  1TQM A;  4UY8 I;  2LRE A;  1YHQ I;  2MLK A;  4HA8 A;  2K9M A;  3NRV A;  3H1C A;  4B44 A;  4CZC A;  4LD5 A;  3U1K A;  1LDD A;  3QP6 A;  1MKM A;  3BLY A;  2DMT A;  1UJ8 A;  1YG2 A;  2M2E A;  2KFD A;  4Y7N J;  3R61 A;  1XMK A;  3LST A;  3GME A;  2W00 A;  3CCU I;  4EV0 A;  4FTH A;  2IVM A;  3HEF A;  4ZDL A;  5J1R A;  3JRB A;  5B66 C;  5J47 A;  2M8E A;  4F91 B;  2KDZ A;  3TO9 A;  2M30 A;  4H0E A;  2AXT C;  2W57 A;  1NG6 A;  3OYC A;  2BVM A;  1IRF A;  2DO7 A;  1LEB A;  3TBI A;  3WHC A;  2LD5 A;  1YRN A;  1R00 A;  4KIG A;  3BJ6 A;  4EJT A;  4RAY A;  5IT9 K;  3FK6 A;  3G73 A;  1H9T A;  1JT6 A;  1B9N A;  4P1W A;  4IO9 F;  4YEL A;  1Y8Q B;  3IP4 B;  3EUH C;  4CYC B;  1S5L C;  1IXC A;  3DWL E;  4IOA F;  2O7O A;  4CCK A;  4XK4 A;  2B7E A;  2M7A A;  1G3S A;  2Z99 A;  3VPR A;  1TC3 C;  5E3N A;  1B1B A;  1LUJ B;  4HAM A;  5HLT A;  3CP8 A;  2KRF A;  3K70 D;  1W36 C;  3FMR A;  2ZSH B;  4XID A;  3ZN0 A;  2DT5 A;  3JRE A;  1IJW C;  2XB5 A;  5DV5 A;  4KYW A;  3BR2 A;  3CCE I;  3M8E A;  2GIZ A;  3IH3 A;  2N8G A;  3FHZ A;  1OYI A;  3REO A;  4Q4Z F;  1U8B A;  2BW3 A;  2L7M P;  2VT2 A;  3A1Y A;  5BPD A;  4A3C J;  1ON1 A;  2W48 A;  4CCM A;  2QKL B;  2L9S A;  1UHS A;  2DA4 A;  2F48 A;  3A2K A;  4P9U A;  1P4A A;  2JT1 A;  2DBB A;  5EGO A;  1MBK A;  3KP7 A;  1WI3 A;  1P7J A;  2EFW A;  1YJW I;  4NHJ A;  4UVA A;  1HOM A;  3C2H A;  2UWM A;  4CCL A;  2MGQ A;  2EIJ H;  4A0X A;  1HC8 A;  4OWR B;  1DGW Y;  5LHG A;  1MSF C;  5HNH A;  1S9H A;  2Z1D A;  1FYK A;  2UXN A;  3GW2 A;  2GXB A;  1J7K A;  3HXL A;  4YG2 F;  2DA3 A;  1OCR H;  5ILU A;  2NXN B;  2HOA A;  2XAU A;  2ZC2 A;  3CC2 I;  1H0M A;  5FO5 A;  5B5E C;  3J80 K;  2KZV A;  3WTZ A;  3S1M J;  1S6L A;  2CV0 A;  4GXO A;  3P9I A;  4G6Q A;  2VPL A;  3CUO A;  2A05 A;  1ETY A;  3E5X A;  1DUX C;  2O3F A;  4U87 A;  5D8K B;  3B6A A;  5E3L A;  2HDD A;  1K7A A;  1GLN A;  4A6E A;  1AKH A;  3HOV J;  3PNV A;  4LB6 B;  1KQ0 A;  4V19 K;  1IO2 A;  3KP2 A;  2XGD A;  4B4C A;  2A5W A;  3PUB A;  2GWR A;  3I58 A;  1AA7 A;  2LG4 A;  3M9A A;  5JVG F;  3KYL A;  4EM2 A;  2QZ8 A;  3W6J B;  1B59 A;  3RIR A;  3FXU A;  4F52 A;  5DEQ A;  4HX7 A;  2DMQ A;  4IJA A;  3T8T A;  4RM3 A;  3OYI A;  1U6G A;  1FOY A;  3VDX A;  3S14 J;  3CDI A;  3A01 A;  3S3O A;  1I39 A;  3DTE A;  1XGO A;  5LLQ A;  1MJB A;  1P6R A;  2JMW A;  2MC4 A;  4DBR A;  2Y30 A;  1TNS A;  4F3Q A;  2X48 A;  2RRE A;  4RA2 A;  3E6D A;  3LL7 A;  4ON0 A;  4F7Z A;  2EWN A;  3LA3 A;  1EH8 A;  1TWH J;  3G4S I;  1QHH D;  2OQR A;  2EZK A;  3S2H J;  2KRC A;  2E19 A;  3EYY A;  3SDG A;  5FD5 A;  4M6X A;  5L3B A;  3IRR A;  4BXX J;  3MZ8 A;  1ITY A;  4KFC A;  3P9C A;  2VOP A;  2OTL I;  1X3W B;  2R7F A;  4DBQ A;  2CQX A;  3AG3 H;  2LY9 A;  1Y8R B;  4EGY A;  1J2X A;  5F27 A;  2CH0 A;  3CJR B;  3L2Q A;  1UG0 A;  1G8X A;  4BQA A;  2HYJ A;  4HYE A;  1SVO A;  3I56 I;  4LB5 A;  1EH6 A;  1U0J A;  4XN3 A;  2L9N A;  4GO1 A;  3PSF A;  2CUZ A;  1OR7 A;  4PJM A;  2Y0M A;  3H0G J;  2H8W A;  4KIC A;  5LGT A;  3H35 A;  3K7A J;  2FRH A;  3LAP A;  1IXS B;  4IHS A;  2R7D A;  3IH4 A;  3GLL A;  2QVO A;  4RGR A;  1VQM I;  3HRS A;  2A61 A;  2CUE A;  2QSF X;  2VJ5 A;  2W25 A;  2OV7 A;  2V9K A;  1UFM A;  2QQ9 A;  1ULY A;  1TQI A;  2QUF A;  3AFH A;  4YEJ A;  2L7K A;  3OYB A;  3RZD J;  3BWG A;  3FBN B;  1YX5 A;  1B4A A;  5K7Z A;  4UXN A;  2P8T A;  2XKO A;  3RDI A;  2IGO A;  3FIW A;  1JT0 A;  5D8L B;  3L1P A;  3CC4 I;  4IHW A;  2L54 A;  4FCY A;  1QPI A;  3LSK A;  1U5T A;  2W4S A;  4IXA A;  1LEA A;  3F3X A;  2STT A;  3TQN A;  3KLO A;  2M4G A;  1WKM A;  1J59 A;  4BQN A;  4QPO A;  2YPR A;  1FBQ A;  3JAM K;  4LIU A;  2VPR A;  5H6R A;  1XG1 A;  2ISZ A;  1LFU P;  4V2F A;  3OYK A;  3CP2 A;  2EPF A;  5J6X A;  1SAX A;  2UUZ A;  2VBY A;  2WB1 N;  5DTD A;  3VYU B;  1ZH5 A;  3LOC A;  2WY8 Q;  2CW7 A;  4XBF A;  4FE4 A;  3BCB A;  2G7H A;  3M8F A;  2H1L A;  5HS9 A;  5FLX Z;  3KZY A;  1FYM A;  1FOK A;  3V7R A;  2E35 A;  4WF2 A;  1B8I B;  1SFE A;  1ZGA A;  2L9V A;  4RM2 A;  1D8J A;  4G6D A;  3BZK A;  1ZEL A;  5JFR A;  1AU7 A;  2I8D A;  1DPU A;  2ADU A;  2VBW A;  3V7S A;  4BEH A;  2HQR A;  4M9X A;  3HUG B;  4M3F A;  2RAE A;  1QRY A;  1G3T A;  2WA0 A;  3BR1 A;  4AVP A;  1LVA A;  1YOV B;  2LNB A;  4DW6 A;  2D5V A;  2VKV A;  1HDP A;  3IV5 A;  4LGW A;  4KIT B;  5ICC A;  3W3C A;  3S16 J;  1OCP A;  4NC6 A;  4ENJ A;  2V26 A;  2NYX A;  1R9T J;  1T6S A;  3RYR A;  4ESB A;  2R93 J;  5LRR A;  1Z7L A;  3V8K A;  2GBY A;  3S1Q J;  4IRI A;  2BBY A;  4RBO A;  2IJL A;  5M5X J;  3HB9 A;  1H88 C;  3NAU A;  4Y15 A;  1WWX A;  2LBF A;  3A01 B;  1Y6I A;  1BBY A;  3DBR B;  4L5I A;  3LA7 A;  3Q0V A;  1W36 D;  1HSJ A;  4XRS G;  1FIA A;  1K6Y A;  2DXI A;  1GXQ A;  3BC8 A;  3R6S A;  5IP9 J;  2EB7 A;  1ZAR A;  1ZGW A;  1O3R A;  4N9H A;  1C0W A;  2NRA C;  2DMP A;  1SFK A;  4M6V A;  5DYM A;  2XVC A;  2STW A;  1E3H A;  2Y0S N;  3WU0 A;  5LHH A;  1ZLJ A;  4WCG A;  2ZME A;  3BPX A;  3BP8 A;  3K4M A;  5TRD A;  4ZJZ A;  1I6X A;  5K7H A;  5K5R A;  5EEA A;  3R4K A;  4II2 A;  1PUF B;  4K2E A;  2G0E A;  1MBG A;  2R7X A;  3E1S A;  2DOD A;  1W5S A;  4RGX A;  3L2W A;  1PYV A;  3K10 A;  3BOQ A;  4UHT A;  3DPT A;  4LMY A;  4Q47 A;  4MHG A;  1UG2 A;  5DM7 F;  4CIC A;  2IA0 A;  4AC0 A;  3HGY A;  4BYY A;  2DTZ A;  1I3Q J;  3H36 A;  3HGG A;  4EM0 B;  1IRX A;  3ASO H;  4HG2 A;  5CVR A;  4ESJ A;  2OCE A;  2DFI A;  3ZQC A;  5E1X A;  3TDU C;  4E7J A;  1UHM A;  2VOD A;  3LQR A;  3NQO A;  2CWE A;  2ISY A;  2M87 A;  2M9H A;  4ZYH A;  2C6Y A;  4NB5 A;  2XUB A;  2MA3 A;  3H3V K;  4CCN A;  3OL3 A;  2L5Q A;  4JBA A;  1FJL A;  6PAX A;  4I99 C;  2OF7 A;  4XLN F;  4IHV A;  2MH2 A;  3VYS B;  4BY7 J;  3S1R J;  5E3O A;  4XSX F;  4F55 A;  1LFP A;  5M3M J;  4KIF A;  2UZK A;  3W2V A;  1P4W A;  1IC8 A;  4LLL A;  2JA6 J;  3TW7 A;  3QOP A;  3CCS I;  2HEO A;  2FSW A;  2Q1Z B;  1CF7 B;  1FC3 A;  5DS9 A;  4CGZ A;  2KDO A;  2K02 A;  4LIT A;  2KRH A;  3QQA A;  4WX9 A;  2IEK A;  2V6E A;  1JUS A;  4E4H A;  2LP0 A;  2TRT A;  3M1E A;  3Q0U A;  1FNN A;  2PG4 A;  4M3D A;  2IS4 A;  1ETO A;  4Y13 A;  4L9T A;  2FA5 A;  3HSE A;  1IAW A;  5DDG A;  2EQR A;  3NWT A;  1N25 A;  1R49 A;  1OCT C;  3F6V A;  4XRS A;  2O03 A;  2H6C A;  2HDW A;  4N0B A;  4KMF A;  1I27 A;  3F0C A;  4P55 A;  2FXA A;  4ZC3 A;  3A0B C;  1YW7 A;  1I1S A;  3U1D A;  2A68 F;  2IPQ X;  2ELJ A;  2ZCW A;  2E60 A;  3EUH A;  4KMU X;  1VQL I;  1HLV A;  1ORK A;  3HTS B;  2FOW A;  1ZLK A;  4BL0 B;  2A07 F;  3KP4 A;  2BGC A;  4HW0 A;  4EQQ A;  2KJB A;  4FX0 A;  3FMQ A;  1IN6 A;  2VN2 A;  5L3C A;  2FE3 A;  2LBF B;  3K70 C;  2DLL A;  3GX4 X;  4RGU A;  1A35 A;  3BT9 A;  4HF2 A;  1D0X A;  2DU9 A;  5FJ8 J;  4BXF A;  3SFZ A;  3FX3 A;  4XN0 A;  5A2Q Z;  3CJN A;  4QSH A;  3BTI A;  3G1M A;  2X0L A;  5E79 C;  3GVA A;  5HS7 A;  1Y0N A;  4GRI A;  1QZZ A;  4BS9 A;  3JTG A;  2W84 A;  3CLQ A;  4BJ6 C;  1SAN A;  5FLM J;  3D5R C;  4MEX F;  3J7A Y;  1LE8 B;  1A04 A;  4LJZ F;  4NDL A;  3BPV A;  1BJZ A;  3OL4 A;  4N4O B;  2PJR A;  2H8R A;  2PEX A;  2K9L A;  3OYH A;  1QZY A;  1E0E A;  3S32 A;  1XSX A;  2ZO4 A;  1P4X A;  3CUQ C;  3S2D J;  2LOO A;  2P7C B;  5IP7 J;  2CSO A;  1D1C A;  2M5W A;  5DUK A;  2HKO A;  3O8H A;  5B3S H;  4G8X A;  2J5P A;  3ELK A;  1XGS A;  4C3J J;  4IHT A;  4QPQ A;  1QQI A;  2GXG A;  5IY5 H;  2A69 F;  1SAU A;  4PGH A;  3WTX C;  1GVD A;  1PDN C;  1Q1H A;  3KP3 A;  3CF2 A;  1YIJ I;  3DEE A;  2R7V A;  2LR8 A;  2XAG A;  4I02 A;  4M3E A;  2EJR A;  3CMM A;  4CDG A;  4HPQ A;  1QBJ A;  3QU3 A;  3GBG A;  4HNV A;  3H3U A;  3PIP F;  3JR9 A;  3JRH A;  4BE2 A;  3CCY A;  5FGM A;  2F4M B;  4EAT A;  4S0H B;  4MFD A;  4JX5 A;  3F72 A;  5D6F A;  4OIQ F;  1JJ8 C;  3DKW A;  3JRF A;  3HOY J;  3L00 A;  3FXQ A;  2IGN A;  4HQE A;  5CVU A;  3HG9 A;  1VTN C;  3G1O A;  4X0G A;  3WOD F;  1TQP A;  4A3F J;  1RUO A;  3RZO J;  1R58 A;  4RAG A;  1BOB A;  3SEQ A;  1TLH B;  2BZT A;  3MKW B;  2J5O A;  4JK1 X;  1SVM A;  4E7K A;  3I4M J;  1RES A;  3K2Z A;  2YX4 A;  5CLS A;  4CH7 A;  5IOY A;  2FBH A;  2GIV A;  5IYC J;  2IGK A;  5KHD A;  3CO6 C;  4D5F A;  2EV0 A;  3GTJ J;  2X6X A;  4DJA A;  1WCM J;  1GDT A;  4J00 A;  4QLC U;  1JKO C;  3F8C A;  4CCO A;  1QA6 A;  2CQN A;  1Z3Y A;  2OAZ A;  2XGX A;  2B63 J;  1F43 A;  4KIB A;  3ASN H;  3FK7 A;  2VKH A;  4OIO F;  4JP0 A;  3FXO A;  2Z5U A;  4PDK A;  1X4P A;  4QIW N;  3LFK A;  3QPL A;  1VQN I;  3C3W A;  4YFN F;  1K61 A;  3GLX A;  5FRO A;  3MN2 A;  2H09 A;  3KEO A;  2PQ8 A;  5L3G A;  1YJ9 I;  4UB6 C;  2Y31 A;  3IUO A;  4CCJ A;  1RRJ A;  2E7W A;  2VE9 A;  1PP8 F;  3OMY A;  2HVQ A;  5FRN A;  2GA1 A;  3RJP A;  3OV8 A;  3F23 A;  2COB A;  2K5C A;  2VBX A;  3OYA A;  3ZCO A;  2RQP A;  3DKX A;  3QP5 A;  2JA5 J;  2O8K A;  5JHU A;  5FLX K;  4C2M J;  3ERM A;  2IS6 A;  1E17 A;  2EV5 A;  2D2W A;  2M4K A;  3DLA A;  1FEX A;  4E7S A;  2X85 A;  3WE3 A;  5HVQ C;  1VQ6 I;  4IHX A;  4O3M A;  3K9T A;  2KIQ A;  4HV6 A;  5GPA A;  5KNL A;  3D0S A;  1H9G A;  4RB3 C;  4D0P A;  1UAA A;  4BY1 J;  4IPA A;  3HPG A;  2KP6 A;  2Q8K A;  1ZRD A;  4YFX F;  1KZH A;  1MZB A;  5KAF C;  1OKR A;  3I3L A;  2XRL A;  5J1U A;  2DYS H;  1TNT A;  2E71 A;  3OYL A;  2VI6 A;  4U0W A;  3S17 J;  5CVJ A;  2LLK A;  5J8F A;  3LSI A;  3GWZ A;  1L0O C;  3K4L A;  2MAB A;  4CHU A;  1LDJ A;  4XOT A;  1ZAO A;  4ZTF A;  3E6B A;  4BHC A;  1XB4 A;  3DF8 A;  2DDA A;  2PJR B;  5ICF A;  3RTR A;  4PGG A;  1W7P D;  3FMS A;  4FIS A;  3WG9 A;  4MQV A;  4IOC F;  3I53 A;  2W1O A;  3TKY A;  3PSI A;  4V2G A;  2VC0 A;  2AQE A;  1A6Q A;  2F4O B;  3WTW C;  3VYR B;  5FFX A;  1G6N A;  4XL9 A;  2V7F A;  5BPI A;  4OIR F;  5H6Q A;  3E0J B;  3DBL B;  3GO5 A;  3W2W A;  1YI2 I;  1Y0U A;  1X19 A;  2E5N A;  3WU2 C;  1S3J A;  2LKS A;  1MNE A;  2XF6 A;  4DZJ A;  4EMS A;  3CD6 I;  2KIM A;  3TOA A;  4IQJ A;  3FDY A;  1CQT A;  2IS1 A;  2D1V A;  2QF7 A;  5ICG A;  2W85 A;  2ME6 A;  1X1A A;  2QSH X;  5CKT A;  5EG0 A;  3RKW A;  3FXM A;  4ZZD A;  1E3P A;  4X1E A;  3SZG A;  5C44 J;  3FKI J;  1WGX A;  1WJ5 A;  2Q0O A;  2BOL A;  3K1N A;  1O4X A;  1XSV A;  2XF5 A;  3F8M A;  5K7F A;  1Z0X A;  1SVL A;  4NQW A;  1S8N A;  5F0C A;  3GTQ J;  1ERD A;  1WZ2 A;  3K1M A;  1Z77 A;  3CES A;  2O0Y A;  1JJ6 C;  2WAE A;  1MMS A;  1K6O A;  3GUD A;  4RS8 A;  1R71 A;  2LF8 A;  1RI7 A;  2MYS A;  4FE7 A;  1ZR4 A;  4II3 A;  1WH5 A;  4FQG A;  1IGN A;  2V9V A;  4BKX A;  5HOO A;  1RKW A;  2VUM J;  2ESH A;  1BC8 C;  2E34 A;  4XLE A;  5JLW A;  3F21 A;  1RIO H;  5FRM A;  5E3M A;  1HKT A;  2WAF A;  2YU3 A;  3FXL A;  1QPM A;  5L3E A;  2PLY A;  2HU9 A;  5HDN A;  1WJE A;  4JX6 A;  1RUN A;  3GTK J;  4B1R A;  5IP6 A;  4BAC A;  1HKQ A;  2JTV A;  3KPH A;  2CU7 A;  1IW7 F;  4XR6 A;  2KLO A;  3N97 A;  3CO7 C;  4Z6Y A;  4UUV A;  2ZJ2 A;  4LG0 B;  2TCT A;  1FOW A;  2BY0 A;  3V4G A;  3K6G A;  1B8I A;  3R0J A;  5J1Y A;  4DZP A;  3HTU A;  5H2F C;  2HWV A;  2LF7 A;  3BG5 A;  2F5V A;  1RR8 C;  1O7F A;  2V1D A;  3HUG A;  2R7T A;  4A3I J;  3FM3 A;  1D1A A;  3BTJ A;  3LSP A;  1T8I A;  1WPK A;  3WGG A;  1TWA J;  4KJZ A;  1SMY F;  2R3S A;  3SYT A;  3PNT A;  1VQ4 I;  1TWC J;  3CME I;  4DYQ A;  4I09 A;  1YJN I;  3W6V A;  2K9N A;  4L5J A;  4RGS A;  1NK3 P;  2KIS A;  4RB0 A;  4QWQ A;  1Z6R A;  1GV5 A;  1U8R A;  1G3Y A;  1V4R A;  3MVP A;  4PUS A;  3VEP A;  3OYN A;  4G12 A;  3PUF A;  4L0Z B;  3CZ6 A;  2VON A;  3QPT A;  1HW2 A;  4A3K J;  2A6H F;  2ZXI A;  1VQK I;  3C2B A;  3WTY C;  3HOZ J;  3KP5 A;  3FM5 A;  4PJJ A;  2RQQ A;  3OY9 A;  3K0L A;  4AWX B;  4XNF A;  2LC2 A;  2YSR A;  4WXC A;  3E5Q A;  3PFI A;  4EGZ A;  4W97 A;  1D8K A;  1T08 B;  3F22 A;  2DA2 A;  1T2K A;  3SZT A;  4BE0 A;  3OOP A;  3HHG A;  1KYW A;  3DEW A;  5HLI A;  2XAH A;  1KGS A;  3OR1 C;  2BHY A;  4PFP A;  2DTR A;  2KJC A;  3C2G A;  4C30 A;  1WFX A;  2VLA A;  4PJN A;  2CS3 A;  3MCZ A;  1K4S A;  3ABU A;  1N75 A;  4WXD A;  5ILS A;  1HXD A;  3DPL C;  4HST A;  3SZP A;  3TDZ C;  2VOO A;  5GPC A;  1REP C;  2CYY A;  4WXH A;  4XIC A;  3A4C A;  1PUF A;  1Z05 A;  2EFQ A;  3DKY A;  3V8J A;  4U7B A;  1F4K A;  2JUG A;  2QCO A;  3HL2 A;  1MMD A;  1G4D A;  3C18 A;  1KU2 A;  3QPH A;  5EG0 B;  2L4A A;  1HQC A;  3U2R A;  4GFB A;  1FWZ A;  4B3A A;  4RMN A;  3OYF A;  2FNA A;  3LSG A;  1BC7 C;  4A3L J;  5EEG A;  1TWF J;  3DPU A;  1V5E A;  4NQW B;  4IF4 A;  1T0F C;  1Z7U A;  2DOF A;  2VJJ A;  4UB8 C;  1BI2 A;  4HDU A;  2BXY A;  2OU2 A;  4OIN F;  2JVG A;  3HOX J;  2K9S A;  2NOG A;  1S7O A;  5CQG A;  4HV5 A;  3EUK L;  2MBF A;  3A02 A;  4IEJ A;  4E7L A;  2XAQ A;  1GXP A;  5JHF A;  4ZDO A;  1SD4 A;  2NS0 A;  5IOZ A;  3IL2 A;  3PQJ A;  4KA4 A;  3RKQ A;  1F1Z A;  2XKP A;  4UNO A;  2V79 A;  2DN0 A;  4ENN A;  4G9Y A;  1KU7 A;  2JWT A;  1DQU A;  1BR2 A;  3O8G A;  4XLF A;  5E1Z B;  4E70 A;  3DU5 A;  3CDL A;  2A3S A;  2K4B A;  3L9F A;  1UCR A;  2CFX A;  4AU7 A;  2XV4 S;  4PSW A;  1ZQ3 P;  2HZD A;  4QTR A;  1CF7 A;  3M3Y J;  2ZNZ A;  1FP2 A;  4C3I J;  3V42 A;  1ZRC A;  2HGC A;  2EIM H;  2QWW A;  1AWC A;  3I59 B;  3MEX A;  3CDH A;  4A2U A;  4M72 A;  2ESN A;  4XKV A;  3ZQG A;  3HKZ A;  5C3E J;  2CV1 A;  2PJP A;  4Y3O A;  3D1N I;  1ZYR F;  4BAY A;  2CUJ A;  4OMY A;  2QQ8 A;  2MLG A;  2YS9 A;  4I76 A;  2MW8 A;  4MTE A;  2IRF G;  3BDD A;  2CJJ A;  2ZJQ F;  3CTA A;  3HSR A;  4IQ4 A;  3G71 I;  2HPM A;  3DEU A;  3MKZ A;  4BU2 A;  1R22 A;  1JXS A;  1O3T A;  1MMG A;  2GZW A;  5EYR A;  5ED4 A;  3BG3 A;  2PMH A;  3I71 A;  5IT3 A;  1XDU A;  2KIF A;  3BJA A;  4A12 A;  3ZP5 A;  2VE8 A;  4A3M J;  2CG4 A;  5CVI A;  1R4M B;  1XCB A;  4HDV A;  3B73 A;  3VB2 A;  3LWF A;  1PVE A;  2LY1 A;  3EDP A;  3DLL F;  5FB2 A;  3BRO A;  5ILV A;  1D5V A;  2WBM A;  1VI0 A;  3CCV I;  1KON A;  3M1C A;  2PMU A;  2KIU A;  2DQR A;  1W0U A;  3QAH A;  1O57 A;  2MD5 A;  1K78 B;  3VSK A;  3IAS 2;  1ETW A;  2JUC A;  2L9R A;  1FIP A;  3OS1 A;  1STZ A;  2LTP A;  3F6O A;  2OPT A;  3FHN A;  1XCV A;  1JKR C;  3OIP A;  3GTP J;  3JRC A;  1QNT A;  3Q0W A;  5D6E A;  4S05 A;  2XPU A;  2FU4 A;  3PQK A;  2X6W A;  3MMY B;  1VQ7 I;  2PBI A;  1O3Q A;  3G3Z A;  1EKE A;  4J19 A;  3MQ0 A;  1R23 A;  1P92 A;  2FX0 A;  3MAJ A;  2HI3 A;  5LGN A;  3M07 A;  2Y9Z A;  1DPR A;  4IRH A;  2Y2Z A;  1LE8 A;  1MW7 A;  2K7L A;  2V1U A;  3TMO A;  3ECH A;  5JR3 A;  2DFF A;  3O2P E;  4MEY F;  2M3A A;  3RPU A;  4MO7 A;  5IPA A;  5C4X J;  4RAF A;  3ZMU A;  1MH3 A;  2JA8 J;  1XN7 A;  2F2E A;  1L3L A;  1NTC A;  1JGS A;  2ZB9 A;  2L4M A;  2NNY A;  2QBY B;  1P9Q C;  3TP3 A;  5EZH A;  4I6Z A;  3UKG A;  3QOD A;  3EYI A;  4ETS A;  3CCR I;  4XSZ F;  5IT9 Z;  3HM5 A;  2DA5 A;  2H94 A;  1BIB A;  1SFO J;  2AS5 F;  4RLQ A;  4BQQ A;  5D4R A;  2VQC A;  3QRF F;  4X6A J;  2F5D A;  5JLX A;  1HBX G;  3SDB A;  1G2H A;  5GAG J;  5LEJ A;  1A6I A;  1VF9 A;  2Z3Y A;  2LVS A;  2V4J C;  2JSC A;  3QPS A;  3HHH A;  2HXO A;  1Z6T A;  1KQ8 A;  2ZXJ A;  1JHH A;  4DYC A;  1P7I A;  1U3E M;  1FBS A;  2CUF A;  2P4W A;  2P6T A;  3ML6 A;  4I7H A;  1B9M A;  1BI3 A;  3C7J A;  3MKY B;  2E1N A;  1MH4 A;  3F8B A;  1KA8 A;  2OQG A;  1FSE A;  1XTA A;  1NG7 A;  3F8F A;  2XRO A;  1ZG5 A;  1IUY A;  3CUQ B;  1HW1 A;  2NS8 A;  4YFK F;  3LSH A;  3JSO A;  5M3F J;  2EFO A;  3E3V A;  1W0T A;  2WTE A;  1FY7 A;  4HNU A;  3GFJ A;  4Q5S F;  4A3B J;  4JOM A;  3JSP A;  2GOM A;  1PP7 U;  1UST A;  5B1A H;  5FD6 A;  2RN7 A;  4EJO A;  1WQ2 A;  5F0F A;  3U21 A;  3CQZ J;  3GEZ A;  2QA4 I;  3LNQ A;  2G7U A;  1S7E A;  2ZXW H;  1USS A;  4M73 A;  3H0D A;  5J8C A;  4RB1 A;  4P96 A;  3J7Y J;  2L01 A;  1Z67 A;  1R1V A;  2HTJ A;  2LY2 A;  3OR2 C;  5E1W A;  3S15 J;  4XOP A;  2P0W A;  4AIK A;  3JRI A;  2F6C A;  1TW3 A;  2H6B A;  3F9K A;  2X1D A;  2NAZ A;  3D5S C;  1T39 A;  2QQB A;  4CSW A;  3OYM A;  1EA3 A;  2JSP A;  2XC7 A;  3TW6 A;  4NNJ A;  5K5O A;  3GYH X;  3KIO A;  2JN6 A;  2IW5 A;  4D5C A;  4C2T A;  3DP7 A;  4XLC A;  1BR4 A;  1PJR A;  2HKX A;  2M0M A;  4NUB A;  3OYD A;  4KNY A;  2OJE D;  4BBS J;  4HSR A;  2GOX B;  3ULQ B;  3RYP A;  1OCO H;  1MMA A;  1AHD P;  1OR7 C;  4HF1 A;  3K4J A;  2AHQ A;  3BQY A;  1SD6 A;  1FT9 A;  1ZTR A;  4BBR J;  2CQK A;  3KET A;  2R7R A;  4DGW B;  1KYZ A;  3VSL A;  2WY7 Q;  2R7U A;  1WRJ A;  1QVU A;  2WC2 A;  4KT5 C;  3JCU C;  1XGN A;  3LSJ A;  2CGP A;  3S3M A;  2DI3 A;  3C1D A;  3ESW B;  5CJ9 A;  2E5Z A;  3PO2 J;  2VT3 A;  2CMP A;  2DOA A;  4OAZ A;  1DDN A;  3ZQI A;  3VYT B;  2D45 A;  2VBZ A;  3L2V A;  3E7L A;  2R4G A;  4YII A;  3BY6 A;  3QU6 A;  1OLT A;  4PJ0 C;  4ZZL A;  4R8H A;  4ENM A;  2R92 J;  2XB0 X;  5E20 A;  3LFU A;  5KAI C;  1U5T C;  3BJO A;  2ZSI B;  5D5X B;  1XD7 A;  2V6C A;  4AM3 A;  1U78 A;  4C3H J;  2F5C A;  3PL8 A;  3ZQL A;  2WWY A;  4XLH A;  4PCQ A;  3CCL I;  1IZ1 A;  3COA C;  3HZJ A;  1D0Y A;  2OUM A;  2RV8 A;  2JPB A;  1E3O C;  1GV2 A;  2P5V A;  3I4P A;  2CFO A;  3GXO A;  4HF0 A;  4XON A;  2PFB A;  2IXS A;  3HOT A;  1J75 A;  2DDB A;  4Q48 A;  2K86 A;  3BCA A;  4OIP F;  1VFC A;  4CUG A;  2GA2 A;  3KYC B;  4N9I A;  4A69 C;  4HBL A;  2MFZ A;  1EF4 A;  2LSO A;  1R4N B;  2HQN A;  4MTD A;  5ICE A;  5BS6 A;  3I55 I;  4BUP A;  2DK8 A;  3JRA A;  5CVV A;  2ID3 A;  4IX7 A;  4L9J A;  2FQ4 A;  1X1C A;  2A6E F;  4M9Z A;  2HR3 A;  3CCJ I;  2JRT A;  3ECO A;  3S2W A;  4A0Y A;  2FMY A;  4D7M A;  1BI0 A;  3B02 A;  3R0A A;  4AVZ A;  4G7H F;  2M1B A;  4XLA A;  2X4H A;  1BOA A;  3I9V 2;  3L2R A;  1OPC A;  4XRM A;  4ZYE A;  1KU9 A;  1Z1D A;  3UR3 C;  4B47 A;  4E6K G;  2W7N A;  2I10 A;  4ITV A;  4ZH4 F;  1N77 A;  3UNG C;  1XSD A;  1MJ9 A;  3PJR A;  1IN4 A;  2EIL H;  3QYB A;  2EV6 A;  3GFL A;  3MZH A;  2GLO A;  1NK2 P;  2X6Y A;  1PUE E;  4AUX A;  4BXU A;  3S3N A;  4I0B A;  4U88 A;  4BHP A;  4HQM A;  5BQT A;  3M7G A;  2ELH A;  1YTY A;  2FOK A;  2Y69 H;  2FBI A;  3HJE A;  1HW5 A;  3FIS A;  2AXL A;  1MDM B;  1SD5 A;  3I0T A;  2DMN A;  4LG0 A;  4UVC A;  1EV7 A;  1WVR A;  3RQI A;  5EZG A;  3Q9S A;  3HKZ N;  4A6D A;  3FWE A;  4XOR A;  2K85 A;  4S04 A;  2L0K A;  3RI4 A;  1D1B A;  1DGR M;  2KQR A;  4M71 A;  1D3Y A;  5EJC A;  3VOE A;  1S72 I;  2M7B A;  2F5F A;  1T38 A;  1X1P A;  4B8X A;  2BXZ A;  3OYJ A;  1B6A A;  1Q1V A;  2V1X A;  3DV8 A;  3H5R A;  1IDZ A;  2VQL A;  1BM9 A;  1Z3X A;  4LG3 A;  4LFU A;  2CW0 F;  1J9I A;  3DQV C;  1ZRF A;  3G2B A;  4A5M A;  5F6F A;  1BR1 A;  1XGM A;  4N4N B;  3ZOB A;  1SEU A;  3ABM H;  3I5U A;  3ZPL A;  2VC1 A;  2MG4 A;  2KMU A;  2O5R A;  5EEH A;  2JA2 A;  4XRF A;  2LK2 A;  1RR7 A;  4A93 J;  3ZMT A;  4I0A A;  3ISP A;  4PFO A;  4P9F A;  4YIF A;  1R7J A;  1ETV A;  3JTH A;  1D5Y A;  4G94 A;  3W6K B;  2H27 A;  1R5H A;  3EUA A;  4A3J J;  3BR0 A;  3G1L A;  1W5T A;  3PNY A;  2ACJ A;  2XF7 A;  3R60 A;  4R1H A;  5J40 A;  3HOS A;  3ABT A;  3OS2 A;  3Q3S A;  3EPZ A;  4G6T B;  2HDC A;  3MKL A;  1JGG A;  3WTV C;  2DA7 A;  2CQQ A;  4IHY A;  1IRZ A;  2YX7 A;  2DFH A;  3KEY A;  2CW8 A;  3CMY A;  1QVT A;  4MLO A;  3OYG A;  4HX4 A;  4Y4R A;  2RVC A;  3ZQ7 A;  5BNG A;  3O3K A;  3OIO A;  1FP1 D;  3K4N A;  2H1K A;  4HNT A;  2KHM A;  2K4J A;  2PMZ A;  1BIA A;  3J81 Z;  1AOY A;  5E17 F;  1FPQ A;  1MBH A;  2EBI A;  2Y9Y A;  1IXR C;  5H20 A;  2XPV A;  1TT0 A;  1WJA A;  1SFX A;  1IG7 A;  3P7N A;  1UEL B;  4XKW A;  3DBH B;  5HNF A;  2JPC A;  3N4M A;  4O6J A;  1ZG3 A;  1B72 A;  1MNM C;  1X3U A;  5DD8 A;  2BV6 A;  5E8G A;  1WJD A;  5JI6 A;  3HOW J;  1YE9 A;  2FQ3 A;  2AO9 A;  1U9O A;  2IBD A;  4WK8 F;  3J7A O;  4HLY A;  1J5Y A;  4M3G A;  3VFZ A;  4UVB A;  4FHT A;  4BE1 A;  2LFB A;  2M34 A;  3RQ4 A;  4OU0 A;  3OSG A;  3HYI A;  3L2C A;  1UB9 A;  3IKV A;  4P5O A;  2BVL A;  4UV9 A;  2CQ7 A;  5DCM B;  2Y48 A;  1X3Z B;  2XAS A;  3I64 A;  3RKY A;  1H8A C;  5FKK A;  1VND A;  2TDX A;  3CLO A;  5LFA A;  4U7D A;  1JE8 A;  1MBJ A;  1RZ4 A;  3A0H C;  3L2U A;  2KKO A;  4DYR A;  1TL8 A;  1WH7 A;  1X58 A;  3IWZ A;  3KZI C;  5FKN A;  1FSH A;  2RKH A;  1QO0 D;  4FT8 A;  4I98 B;  3KZZ A;  1ZHF A;  2RDP A;  5TGT A;  1W1W E;  1R36 A;  2OC6 A;  2OZ6 A;  3FZV A;  5D5W B;  1BN5 A;  2VKD A;  2HOT A;  5DD4 A;  5F08 A;  2X6O A;  3I59 A;  3F8N A;  3L09 A;  4R79 A;  1XC5 A;  1QHG A;  2Q2E B;  4YIR X;  3CC7 I;  1GVJ A;  1DP7 P;  3TOB A;  1T95 A;  2VIX A;  2ZJP F;  2FF4 A;  5IYB J;  1TT5 B;  3BR6 A;  3K4K A;  3OYE A;  3ZMZ A;  2L7Z A;  1A31 A;  2O61 A;  2JJ7 A;  5E18 F;  2BEO A;  4J01 A;  3AL0 C;  4LLG F;  2DYR H;  3QYE A;  2QGU A;  3GZN B;  3LSR A;  1LNW A;  3GTL J;  1Z21 A;  3DFG A;  3WG7 H;  3ONQ A;  2FNP A;  1ON2 A;  4HX8 A;  4E7Z A;  4D1Q A;  3MZY A;  1XMX A;  4L9V A;  2XAF A;  3WTT C;  4Y17 A;  3ZGK A;  4L18 B;  1W7P A;  3BR3 A;  1MD0 A;  1K78 A;  2DW4 A;  1ETX A;  3ZQF A;  2DJI A;  1OIS A;  2EFN A;  2HVR A;  3U9G A;  4F92 B;  5LGU A;  1LVK A;  1JTX A;  3EET A;  4BHB A;  5J4V A;  3ERE D;  3H92 A;  1YIO A;  1JI8 A;  4EJW A;  5DUI A;  2I5U A;  2OZU A;  5CYV A;  3GTM J;  2W24 A;  1RC9 A;  3TO7 A;  1YO5 C;  2DPU A;  3OWT A;  2DA1 A;  2R5Y B;  1FBU A;  2P6S A;  2VL8 A;  1YW8 A;  2ZBK A;  1I5Z A;  4H4K C;  1Y56 A;  3BG6 A;  1BI1 A;  2LKX A;  5A2Q K;  4XMY A;  5DM6 F;  5GAH J;  2KL4 A;  2MD0 A;  1RNL A;  1W5C C;  2DPD A;  1A5J A;  1DU6 A;  4D7N A;  4DIQ A;  1WI9 A;  4UV8 A;  1OFC X;  5M5W J;  2K3F A;  3S8P A;  2DOE A;  4OOI A;  4FX4 A;  1DP3 A;  1BW6 A;  1MMN A;  1B72 B;  3RPQ A;  2YR2 A;  2Z9O A;  5FLV A;  3CCM I;  4XM3 A;  4MNU A;  1UZC A;  2QSG X;  1YLF A;  2QBY A;  1FX7 A;  3OOU A;  4ZTJ A;  5F1R A;  2ECC A;  2HYG D;  4AYB A;  2CO5 A;  4AD9 A;  3LMM A;  4HLX A;  5GP9 A;  3T1B A;  1MSE C;  2GXA A;  1YFH A;  2ID6 A;  3ZN1 A;  2NOJ B;  1YRN B;  3HRM A;  5BOX A;  1V55 H;  2BY2 A;  1HCR A;  2DCE A;  3FXK A;  4LIV A;  3HC7 A;  4A5N A;  2IA1 A;  4RAZ A;  1MBE A;  3RPU D;  3PFY A;  1M1E B;  3K2A A;  2KT0 A;  3H5N A;  3N05 A;  1ONV A;  1V54 H;  1ZKG A;  4IZZ A;  1LB2 A;  2VKE A;  1ODD A;  1S7A A;  1X4O A;  1JUM A;  1ZGJ A;  1HF0 A;  4UUT A;  2CRG A;  2E1M B;  3WHB A;  1S29 A;  1ZN2 A;  2EA4 A;  2PN6 A;  3CUQ A;  3SXY A;  1NHA A;  4NC7 A;  2IGM A;  2BW3 B;  2HXI A;  3CF5 F;  2HYF A;  2OBP A;  2IS2 A;  1WJB A;  1J0R A;  2BYV E;  2FBK A;  3IHU A;  1WJF A;  3ZQH A;  3GFI A;  3B6C A;  2NS7 A;  1O7L A;  5KCM A;  5HOD A;  1U9N A;  1VQO I;  1K83 J;  2WAQ A;  4AIJ A;  1EH7 A;  3CJT B;  2RGV A;  1A36 A;  3K4C A;  1WJC A;  3VOD A;  5EGO B;  1FZP B;  3HBL A;  4ZYG A;  1V3F A;  1LQ1 A;  5KVR A;  1FOX A;  5L3F A;  3HPH A;  1FLI A;  2XSD C;  1Y1V J;  2E1O A;  2HOS A;  4BDY A;  2DK5 A;  1HDD C;  1E2X A;  4U0V A;  4OMZ A;  3V8L A;  2QQA A;  2HOE A;  1FMV A;  2VAS A;  5D5V B;  2YUS A;  1UMQ A;  3WGI A;  2LYC A;  3KP6 A;  2E7X A;  3ZR8 X;  1EJ9 A;  1LJ9 A;  1TBX A;  2E2I J;  4XKB A;  2M0C A;  3G6E I;  4EM1 A;  4M74 A;  5FFZ A;  2X1C A;  3OS0 A;  3ABL H;  3KE2 A;  4G7Z F;  3S93 A;  1BA5 A;  1TZL A;  4BJ5 C;  1W7P B;  3RCO A;  2LMD A;  3BR5 A;  1AKH B;  3P5J A;  2A6T A;  2DAO A;  2PX9 A;  2M8G X;  3NEU A;  2DMU A;  5L3D A;  1ENH A;  1IN7 A;  3M8J A;  1ZR2 A;  2EZH A;  1JHF A;  2VJI A;  4EVI A;  3HOU J;  2FEZ A;  3VWB A;  2VXD A;  3KLN A;  3H9Q A;  4HRI A;  4A0Z A;  3DU6 A;  3MWM A;  2V9P A;  3AG4 H;  3O6B B;  3TP0 A;  1I50 J;  2GQQ A;  4CO8 A;  5LHI A;  4CXF A;  4E7H A;  5BMZ A;  1FYL A;  1TP4 A;  2BHZ A;  5J3L A;  2DA6 A;  2B9S A;  1RET A;  1D0Z A;  1K4T A;  3AAF A;  4WWC A; 
#chains in the Genus database with same CATH homology
 4ENK A;  2P7V B;  1TW2 A;  4GGG A;  3JW4 A;  3T0Y A;  2QEN A;  2IT0 A;  5AON A;  2XAJ A;  2L3D A;  1YQA A;  1F9N A;  1BJA A;  2ZNY A;  3ZMV A;  4GYI A;  4EJU A;  4M9S A;  3J81 K;  1ZG1 A;  5K1Y A;  3LA2 A;  1HKS A;  2OA4 A;  3Q9V A;  4I2O A;  4MGR A;  1IN5 A;  5TJJ A;  2HS5 A;  2A5Y B;  1IN8 A;  4MQ9 F;  2MC3 A;  3T5X A;  3GZ6 A;  2OD5 A;  3I54 A;  4IVN A;  5HDG A;  5HS8 A;  2HFH A;  3K69 A;  4KN4 X;  4KN7 X;  2E1C A;  1U5T B;  4BH9 A;  4IRG A;  4B09 A;  3RKX A;  2IA2 A;  3E5U A;  4KUM A;  2Y75 A;  5AIP A;  4DNC A;  1SFU A;  3K1P A;  1R1T A;  4Z2Y A;  1P2F A;  3J80 Z;  3MFK A;  2L02 A;  4EJV A;  4L9N A;  1MDM A;  4G7O F;  5JVT A;  3GF2 A;  4HOB A;  3TO6 A;  1CGP A;  2VXZ A;  2HTS A;  1OMI A;  3HRU A;  2GAU A;  3GZ5 A;  1TTY A;  2DQL A;  2MH9 A;  4BNC A;  3Q5F A;  1SMT A;  1YS7 A;  3HIF A;  3ZMD A;  2EK5 A;  2K27 A;  3KEQ A;  1WSU A;  3HRT A;  2ETH A;  1KQ9 A;  2P5K A;  3E6M A;  4I01 A;  4KDP A;  3GFM A;  5AIQ A;  2FML A;  3E97 A;  1GHC A;  5DCF A;  5E8I A;  1R5G A;  1QGP A;  4HZF A;  2QLZ A;  3LQQ A;  3SQN A;  4JQF A;  1LDK B;  2ZME B;  3WTS C;  4M6Y A;  2BE5 F;  4GCV A;  3IKT A;  3WGH A;  1YW9 A;  4RB2 C;  4GYG A;  2XIG A;  3IRQ A;  3ROU A;  4ESF A;  3P9K A;  1IF1 A;  3E6C C;  3WTU C;  1YYV A;  2XHK A;  4AIH A;  2XRN A;  1W4M A;  1SD7 A;  2ZFW A;  2EA2 A;  5DCM A;  4PZJ A;  3JAM Z;  2JZY A;  3EQL F;  3ZMS A;  4LK0 F;  4ZYD A;  2LDU A;  4O5V A;  1K79 A;  3T8R A;  2RNJ A;  2G9W A;  3HSF A;  1Z9C A;  2M45 A;  1KU3 A;  1F5T A;  2F5E A;  4CYD A;  1YS6 A;  2PI0 A;  2ZKZ A;  1Z91 A;  2O6G E;  2UXX A;  5HLH A;  1ZRE A;  2O8X A;  2HZT A;  3LAJ A;  4TV7 A;  5HDK A;  3TGN A;  2P5L C;  1T0F A;  2Q2E A;  1O3S A;  2COM A;  4L0Y B;  5LRS A;  2WV0 A;  5D4S A;  5F64 A;  5LBQ A;  2Z33 A;  5KK1 A;  4ASN A;  1T98 A;  1OYW A;  3D5L A;  5K5Q A;  1IRG A;  3L7W A;  4LLN A;  1MGT A;  2EFP A;  1R1U A;  1U2W A;  1MJA A;  2QYO A;  3IC7 A;  2NNN A;  4XLP F;  2QM3 A;  3IWF A;  3KCC A;  2B0L A;  4LK1 F;  2IP2 A;  2LKP A;  2RC4 A;  3H3Z A;  5ERI A;  1XDS A;  1I1G A;  5D5U B;  5LEK A;  5HLG A;  1XMA A;  3WE2 A;  3BZ6 A;  3FXR A;  3DXJ F;  3FF5 A;  1UHW A;  4DQ2 A;  1G3W A;  1HST A;  3KFW X;  3V7C A;  1OYY A;  3SHF A;  4CZZ A;  2D1H A;  4U0Y A;  3WU1 B;  1TQM A;  2MLK A;  4HA8 A;  3NRV A;  4LD5 A;  1LDD A;  3QP6 A;  1MKM A;  1YG2 A;  3R61 A;  1XMK A;  3LST A;  4EV0 A;  2IVM A;  2M8E A;  3TO9 A;  2M30 A;  4H0E A;  2W57 A;  1IRF A;  2DO7 A;  1LEB A;  1R00 A;  4KIG A;  3BJ6 A;  4EJT A;  4RAY A;  5IT9 K;  3G73 A;  1H9T A;  1B9N A;  1IXC A;  1G3S A;  2Z99 A;  1B1B A;  4HAM A;  2KRF A;  3FMR A;  3ZN0 A;  2DT5 A;  5DV5 A;  4KYW A;  3M8E A;  3FHZ A;  1OYI A;  3REO A;  4Q4Z F;  2VT2 A;  5BPD A;  1ON1 A;  4P9U A;  1P4A A;  2JT1 A;  2DBB A;  3KP7 A;  2EFW A;  4NHJ A;  4UVA A;  2UWM A;  4A0X A;  5LHG A;  1FYK A;  2UXN A;  3GW2 A;  2GXB A;  1J7K A;  4YG2 F;  5ILU A;  1H0M A;  5FO5 A;  3J80 K;  3WTZ A;  1S6L A;  4GXO A;  3P9I A;  4G6Q A;  3CUO A;  3E5X A;  1DUX C;  2O3F A;  5D8K B;  1K7A A;  4A6E A;  4LB6 B;  1KQ0 A;  3KP2 A;  2GWR A;  3I58 A;  3M9A A;  4EM2 A;  2QZ8 A;  3W6J B;  1B59 A;  3RIR A;  3FXU A;  5DEQ A;  4HX7 A;  4IJA A;  3T8T A;  1U6G A;  5LLQ A;  1XGO A;  1MJB A;  1P6R A;  1TNS A;  3E6D A;  4F7Z A;  4ON0 A;  2EWN A;  3LA3 A;  1EH8 A;  2OQR A;  3EYY A;  5FD5 A;  4M6X A;  5L3B A;  3IRR A;  4KFC A;  3P9C A;  2VOP A;  2R7F A;  4EGY A;  1J2X A;  4BQA A;  4HYE A;  4LB5 A;  1EH6 A;  4GO1 A;  1OR7 A;  2Y0M A;  4KIC A;  5LGT A;  2FRH A;  3LAP A;  1IXS B;  4IHS A;  2R7D A;  2QVO A;  4RGR A;  3HRS A;  2A61 A;  2W25 A;  1UFM A;  2QQ9 A;  1ULY A;  1TQI A;  2QUF A;  3BWG A;  1B4A A;  4UXN A;  2P8T A;  2XKO A;  3RDI A;  5D8L B;  2L54 A;  1U5T A;  4IXA A;  1LEA A;  3F3X A;  2STT A;  3TQN A;  3KLO A;  1WKM A;  1J59 A;  3JAM K;  2YPR A;  1FBQ A;  5H6R A;  2ISZ A;  5J6X A;  1SAX A;  2VBY A;  1ZH5 A;  4XBF A;  2G7H A;  3M8F A;  5HS9 A;  5FLX Z;  3KZY A;  1FYM A;  1FOK A;  3V7R A;  4WF2 A;  1SFE A;  1ZGA A;  1D8J A;  4G6D A;  5JFR A;  1DPU A;  2ADU A;  2VBW A;  3V7S A;  2HQR A;  4M9X A;  1G3T A;  4AVP A;  1LVA A;  2LNB A;  4LGW A;  5ICC A;  4ENJ A;  2NYX A;  1T6S A;  3RYR A;  4ESB A;  5LRR A;  3V8K A;  4IRI A;  2BBY A;  2IJL A;  4Y15 A;  1WWX A;  1BBY A;  4L5I A;  3LA7 A;  1HSJ A;  1GXQ A;  3R6S A;  2EB7 A;  1ZAR A;  1O3R A;  4N9H A;  1C0W A;  2NRA C;  5DYM A;  2XVC A;  2STW A;  3WU0 A;  5LHH A;  1ZLJ A;  4WCG A;  2ZME A;  3BPX A;  3BP8 A;  5TRD A;  1I6X A;  5K5R A;  3R4K A;  4K2E A;  1W5S A;  4RGX A;  3BOQ A;  4UHT A;  3DPT A;  4LMY A;  4Q47 A;  4MHG A;  4CIC A;  2IA0 A;  4BYY A;  4EM0 B;  5CVR A;  4ESJ A;  2DFI A;  5E1X A;  3TDU C;  2VOD A;  1UHM A;  3LQR A;  3NQO A;  2CWE A;  2ISY A;  2M87 A;  4ZYH A;  2C6Y A;  4NB5 A;  2XUB A;  2MA3 A;  4JBA A;  6PAX A;  4XLN F;  2MH2 A;  4XSX F;  4KIF A;  2UZK A;  1P4W A;  4LLL A;  3QOP A;  2HEO A;  2FSW A;  1CF7 B;  1FC3 A;  4CGZ A;  2K02 A;  4WX9 A;  3M1E A;  1FNN A;  2PG4 A;  4Y13 A;  4L9T A;  2FA5 A;  3HSE A;  1IAW A;  5DDG A;  3F6V A;  2O03 A;  2H6C A;  4N0B A;  4KMF A;  1I27 A;  4P55 A;  2FXA A;  1YW7 A;  1I1S A;  3U1D A;  2A68 F;  2IPQ X;  2ZCW A;  3EUH A;  4KMU X;  3HTS B;  1ZLK A;  2A07 F;  3KP4 A;  2BGC A;  4HW0 A;  4EQQ A;  2KJB A;  4FX0 A;  3FMQ A;  1IN6 A;  2VN2 A;  5L3C A;  2FE3 A;  2DLL A;  3GX4 X;  4RGU A;  4HF2 A;  2DU9 A;  3SFZ A;  3FX3 A;  5A2Q Z;  3CJN A;  2X0L A;  3GVA A;  5HS7 A;  1QZZ A;  3JTG A;  2W84 A;  4MEX F;  1A04 A;  4LJZ F;  3BPV A;  2PEX A;  1QZY A;  1XSX A;  2ZO4 A;  1P4X A;  3CUQ C;  2P7C B;  2CSO A;  2M5W A;  5DUK A;  2HKO A;  4G8X A;  2J5P A;  3ELK A;  1XGS A;  4IHT A;  1QQI A;  2GXG A;  2A69 F;  4PGH A;  3WTX C;  1PDN C;  1Q1H A;  3KP3 A;  2XAG A;  4I02 A;  2EJR A;  4CDG A;  1QBJ A;  3QU3 A;  3H3U A;  5FGM A;  3F72 A;  5D6F A;  4OIQ F;  3DKW A;  3L00 A;  3FXQ A;  4HQE A;  5CVU A;  1VTN C;  3WOD F;  1TQP A;  1RUO A;  1R58 A;  1TLH B;  2J5O A;  4JK1 X;  3K2Z A;  2YX4 A;  5CLS A;  2FBH A;  2GIV A;  3CO6 C;  2EV0 A;  4QLC U;  3F8C A;  2OAZ A;  2XGX A;  4KIB A;  4OIO F;  2Z5U A;  4PDK A;  3LFK A;  3C3W A;  4YFN F;  3GLX A;  2H09 A;  3KEO A;  2PQ8 A;  5L3G A;  2E7W A;  2VE9 A;  1PP8 F;  2GA1 A;  3RJP A;  3OV8 A;  3F23 A;  2VBX A;  2RQP A;  3QP5 A;  5JHU A;  5FLX K;  1E17 A;  2EV5 A;  2D2W A;  3WE3 A;  5HVQ C;  4O3M A;  3K9T A;  4HV6 A;  3D0S A;  1H9G A;  4RB3 C;  4D0P A;  4IPA A;  2Q8K A;  1ZRD A;  4YFX F;  1MZB A;  1OKR A;  1TNT A;  4U0W A;  5CVJ A;  5J8F A;  3GWZ A;  1L0O C;  4CHU A;  1LDJ A;  1ZAO A;  3E6B A;  4BHC A;  1XB4 A;  3DF8 A;  5ICF A;  3RTR A;  4PGG A;  1W7P D;  3FMS A;  3WG9 A;  4MQV A;  3I53 A;  3TKY A;  2VC0 A;  3WTW C;  5FFX A;  1G6N A;  5BPI A;  4OIR F;  5H6Q A;  3GO5 A;  1Y0U A;  1S3J A;  4EMS A;  2KIM A;  3TOA A;  2D1V A;  5ICG A;  2W85 A;  3RKW A;  4ZZD A;  2Q0O A;  3K1N A;  1XSV A;  3F8M A;  4NQW A;  1S8N A;  3K1M A;  2O0Y A;  1K6O A;  3GUD A;  4RS8 A;  2LF8 A;  1RI7 A;  2V9V A;  5HOO A;  2ESH A;  1BC8 C;  3F21 A;  1RIO H;  1HKT A;  2YU3 A;  1QPM A;  5L3E A;  2PLY A;  5HDN A;  1RUN A;  1HKQ A;  2JTV A;  1IW7 F;  3N97 A;  3CO7 C;  4UUV A;  2ZJ2 A;  4LG0 B;  3V4G A;  3R0J A;  3HTU A;  2HWV A;  2LF7 A;  1O7F A;  2V1D A;  3HUG A;  3FM3 A;  3WGG A;  1SMY F;  2R3S A;  4I09 A;  4L5J A;  4RGS A;  4RB0 A;  4QWQ A;  1Z6R A;  1U8R A;  1G3Y A;  1V4R A;  3VEP A;  4L0Z B;  2VON A;  3QPT A;  1HW2 A;  2A6H F;  3WTY C;  3KP5 A;  3FM5 A;  3K0L A;  4AWX B;  2YSR A;  4WXC A;  3E5Q A;  3PFI A;  4EGZ A;  1D8K A;  3F22 A;  1T2K A;  3SZT A;  3OOP A;  3HHG A;  1KYW A;  5HLI A;  2XAH A;  1KGS A;  2DTR A;  2KJC A;  3MCZ A;  3ABU A;  4WXD A;  5ILS A;  1HXD A;  3DPL C;  3SZP A;  2VOO A;  3TDZ C;  1REP C;  2CYY A;  4WXH A;  1Z05 A;  2EFQ A;  3V8J A;  4U7B A;  1F4K A;  1G4D A;  3C18 A;  1KU2 A;  3QPH A;  2L4A A;  1HQC A;  3U2R A;  1FWZ A;  2FNA A;  1BC7 C;  5EEG A;  4IF4 A;  1Z7U A;  4HDU A;  1BI2 A;  2OU2 A;  4OIN F;  1S7O A;  4HV5 A;  2MBF A;  2XAQ A;  1GXP A;  1SD4 A;  2NS0 A;  3IL2 A;  3PQJ A;  4KA4 A;  1F1Z A;  2XKP A;  4UNO A;  2V79 A;  4ENN A;  4G9Y A;  1KU7 A;  5E1Z B;  4E70 A;  2A3S A;  2K4B A;  3L9F A;  1UCR A;  2CFX A;  2XV4 S;  1CF7 A;  2ZNZ A;  1FP2 A;  1ZRC A;  2HGC A;  2QWW A;  1AWC A;  3I59 B;  3MEX A;  3CDH A;  4A2U A;  4M72 A;  2ESN A;  2PJP A;  1ZYR F;  4BAY A;  4OMY A;  2MLG A;  4MTE A;  2IRF G;  3BDD A;  3CTA A;  3HSR A;  3DEU A;  1R22 A;  1JXS A;  1O3T A;  2GZW A;  5ED4 A;  2PMH A;  3I71 A;  5IT3 A;  4A12 A;  1XDU A;  2KIF A;  3BJA A;  3ZP5 A;  2VE8 A;  2CG4 A;  5CVI A;  1XCB A;  4HDV A;  3B73 A;  3VB2 A;  3LWF A;  3EDP A;  5FB2 A;  5ILV A;  3BRO A;  1D5V A;  2PMU A;  2KIU A;  2DQR A;  3QAH A;  1O57 A;  2MD5 A;  1K78 B;  1STZ A;  3F6O A;  1XCV A;  1QNT A;  5D6E A;  4S05 A;  2FU4 A;  3PQK A;  2PBI A;  1O3Q A;  3G3Z A;  3MQ0 A;  1R23 A;  1P92 A;  3MAJ A;  5LGN A;  1DPR A;  4IRH A;  2K7L A;  2V1U A;  3ECH A;  5JR3 A;  3O2P E;  4MEY F;  3RPU A;  3ZMU A;  1XN7 A;  2F2E A;  1L3L A;  1JGS A;  2L4M A;  2NNY A;  2QBY B;  3EYI A;  4ETS A;  5IT9 Z;  4XSZ F;  2H94 A;  1BIB A;  2AS5 F;  5D4R A;  3QRF F;  2F5D A;  1HBX G;  5LEJ A;  2Z3Y A;  2JSC A;  3HHH A;  1Z6T A;  1KQ8 A;  2ZXJ A;  1JHH A;  1U3E M;  1FBS A;  2P4W A;  2P6T A;  3ML6 A;  4I7H A;  1B9M A;  1BI3 A;  3C7J A;  2E1N A;  3F8B A;  1KA8 A;  2OQG A;  1FSE A;  3F8F A;  2XRO A;  1ZG5 A;  1IUY A;  3CUQ B;  1HW1 A;  4YFK F;  3JSO A;  2EFO A;  3E3V A;  2WTE A;  1FY7 A;  3GFJ A;  4Q5S F;  3JSP A;  1PP7 U;  1UST A;  5FD6 A;  2RN7 A;  4EJO A;  1WQ2 A;  3GEZ A;  2G7U A;  1USS A;  4M73 A;  5J8C A;  4RB1 A;  4P96 A;  2L01 A;  2HTJ A;  1R1V A;  5E1W A;  4AIK A;  1TW3 A;  2H6B A;  2NAZ A;  1T39 A;  2QQB A;  5K5O A;  3GYH X;  2IW5 A;  3DP7 A;  2HKX A;  4KNY A;  3ULQ B;  3RYP A;  4HF1 A;  1SD6 A;  1FT9 A;  3KET A;  2CQK A;  1KYZ A;  1WRJ A;  2WC2 A;  4KT5 C;  1XGN A;  2CGP A;  2DI3 A;  3C1D A;  5CJ9 A;  2VT3 A;  1DDN A;  2D45 A;  2VBZ A;  4YII A;  3BY6 A;  3QU6 A;  4ZZL A;  4R8H A;  4ENM A;  5E20 A;  1U5T C;  3BJO A;  5D5X B;  1XD7 A;  2V6C A;  1U78 A;  2F5C A;  2WWY A;  4PCQ A;  1IZ1 A;  3COA C;  2RV8 A;  2JPB A;  2P5V A;  3I4P A;  3GXO A;  4HF0 A;  2PFB A;  3HOT A;  1J75 A;  4Q48 A;  4OIP F;  2K86 A;  2GA2 A;  4N9I A;  4HBL A;  2LSO A;  2HQN A;  4MTD A;  5ICE A;  5BS6 A;  2DK8 A;  5CVV A;  4L9J A;  2A6E F;  4M9Z A;  2HR3 A;  2JRT A;  3ECO A;  3S2W A;  4A0Y A;  2FMY A;  1BI0 A;  3B02 A;  3R0A A;  4G7H F;  2M1B A;  2X4H A;  1BOA A;  1OPC A;  4ZYE A;  1KU9 A;  1Z1D A;  4ZH4 F;  1XSD A;  1MJ9 A;  1IN4 A;  2EV6 A;  3GFL A;  3MZH A;  1PUE E;  4BXU A;  4I0B A;  4U88 A;  4BHP A;  4HQM A;  5BQT A;  3M7G A;  2ELH A;  1YTY A;  2FOK A;  2FBI A;  1HW5 A;  2AXL A;  1MDM B;  1SD5 A;  3I0T A;  4LG0 A;  4UVC A;  1EV7 A;  3Q9S A;  4A6D A;  3RI4 A;  3FWE A;  4S04 A;  4M71 A;  3VOE A;  1D3Y A;  2F5F A;  1T38 A;  4B8X A;  1B6A A;  2V1X A;  3DV8 A;  1BM9 A;  4LFU A;  2CW0 F;  1J9I A;  3DQV C;  1ZRF A;  4A5M A;  5F6F A;  1XGM A;  3I5U A;  3ZPL A;  2VC1 A;  5EEH A;  4XRF A;  3ZMT A;  4I0A A;  3ISP A;  4P9F A;  4YIF A;  1R7J A;  3JTH A;  2H27 A;  4G94 A;  3W6K B;  1R5H A;  1W5T A;  2ACJ A;  3R60 A;  4R1H A;  3HOS A;  3ABT A;  2HDC A;  3WTV C;  2YX7 A;  4HX4 A;  2RVC A;  3ZQ7 A;  3O3K A;  1FP1 D;  3J81 Z;  2K4J A;  1BIA A;  1AOY A;  5E17 F;  1FPQ A;  1IXR C;  5H20 A;  1SFX A;  3P7N A;  2JPC A;  3N4M A;  4O6J A;  1ZG3 A;  1X3U A;  5DD8 A;  2BV6 A;  5E8G A;  5JI6 A;  2FQ3 A;  4WK8 F;  3J7A O;  4HLY A;  1J5Y A;  3VFZ A;  4UVB A;  4FHT A;  4OU0 A;  3HYI A;  3L2C A;  1UB9 A;  3IKV A;  4P5O A;  5DCM B;  4UV9 A;  2Y48 A;  2XAS A;  3I64 A;  3RKY A;  2TDX A;  3CLO A;  4U7D A;  1JE8 A;  1RZ4 A;  2KKO A;  3IWZ A;  1FSH A;  2RKH A;  1QO0 D;  4FT8 A;  4I98 B;  3KZZ A;  1ZHF A;  2RDP A;  1R36 A;  2OZ6 A;  3FZV A;  5D5W B;  1BN5 A;  5DD4 A;  3I59 A;  3F8N A;  3L09 A;  4R79 A;  1GVJ A;  1DP7 P;  3TOB A;  2FF4 A;  3ZMZ A;  2O61 A;  5E18 F;  2BEO A;  4LLG F;  1LNW A;  3DFG A;  2FNP A;  1ON2 A;  4HX8 A;  3MZY A;  4L9V A;  2XAF A;  3WTT C;  4Y17 A;  4L18 B;  1W7P A;  1MD0 A;  1K78 A;  2DW4 A;  2EFN A;  3U9G A;  5LGU A;  3EET A;  4BHB A;  3ERE D;  3H92 A;  1YIO A;  4EJW A;  5DUI A;  2OZU A;  5CYV A;  2W24 A;  3TO7 A;  1YO5 C;  2DPU A;  1FBU A;  2P6S A;  1YW8 A;  2ZBK A;  1I5Z A;  1BI1 A;  5A2Q K;  1RNL A;  2DPD A;  1WI9 A;  4UV8 A;  4OOI A;  4FX4 A;  3RPQ A;  2YR2 A;  2Z9O A;  4MNU A;  1YLF A;  2QBY A;  1FX7 A;  5F1R A;  2HYG D;  2CO5 A;  4AD9 A;  4HLX A;  3T1B A;  1YFH A;  3ZN1 A;  3HRM A;  5BOX A;  4A5N A;  2IA1 A;  4RAZ A;  1ONV A;  1LB2 A;  1ODD A;  1S7A A;  1ZGJ A;  1S29 A;  1ZN2 A;  2EA4 A;  2PN6 A;  3CUQ A;  3SXY A;  1NHA A;  2HYF A;  2OBP A;  1J0R A;  2BYV E;  2FBK A;  3IHU A;  3GFI A;  1O7L A;  4AIJ A;  1EH7 A;  2RGV A;  3VOD A;  1FZP B;  4ZYG A;  1LQ1 A;  1V3F A;  5KVR A;  5L3F A;  1FLI A;  2DK5 A;  1E2X A;  4U0V A;  4OMZ A;  3V8L A;  2QQA A;  2HOE A;  5D5V B;  3WGI A;  3KP6 A;  2E7X A;  1LJ9 A;  1TBX A;  4EM1 A;  4M74 A;  5FFZ A;  3KE2 A;  4G7Z F;  1W7P B;  2DAO A;  3NEU A;  5L3D A;  1IN7 A;  1JHF A;  4EVI A;  2FEZ A;  3KLN A;  4A0Z A;  3MWM A;  3O6B B;  2GQQ A;  4CO8 A;  5LHI A;  4CXF A;  5BMZ A;  1FYL A;  3AAF A;  4WWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...