1VTNC

Co-crystal structure of the hnf-3/fork head dna-recognition motif resembles histone h5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
HAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Co-Crystal Structure of the HNF-3/Fork Head DNA-Recognition Motif Resembles Histone H5
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*GP*AP*CP*TP*AP*AP*GP*TP*CP*AP*AP*CP*C)-3')
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1995-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1vtnC00
3HUGA 3MZHA 4M9XA 1PUEE 3E5XA 3T8TA 1MJBA 1YG2A 5AIPA 1C0WA 5HLIA 5LRRA 2M30A 3RYRA 3FM3A 2PMUA 3L9FA 3ERED 3TO6A 4EJUA 3RDIA 4U7BA 2ACJA 2VC0A 4H0EA 1FC3A 2L02A 3TO9A 1HSJA 2EV5A 2F5FA 3F6VA 2DK8A 3BDDA 5HS7A 1HW5A 1XN7A 5DYMA 4L9TA 2ZMEB 3KP6A 5FLXK 2WV0A 4BYYA 2FMYA 2H27A 1KU7A 4ENNA 1IN8A 2O03A 3JAMK 2H6CA 3MWMA 3LFKA 3V8LA 4RGRA 4U88A 1HW1A 3L00A 3BROA 2DPUA 3E5UA 1W7PA 2H6BA 5LHIA 2F5EA 2RVCA 5LGTA 1V4RA 3TKYA 2IT0A 4NB5A 3FHZA 3HRTA 2IVMA 4N0BA 1ODDA 3WTUC 5E20A 3TOAA 1AOYA 4EM1A 1SD6A 3D0SA 1G6NA 1XGSA 3V7RA 3ZMSA 5D5WB 3NQOA 1SMYF 4GYIA 3E6BA 1OYIA 2NAZA 3VEPA 3ULQB 3HOTA 1CF7B 4L9VA 5CVJA 3HRSA 4S04A 3V8JA 2QBYA 3U9GA 1TLHB 1B1BA 1B4AA 2K7LA 4HQEA 4KYWA 4GYGA 2FBHA 2STWA 1V3FA 4KIFA 4N9IA 2XUBA 2WTEA 4HDVA 1O7FA 2VT3A 4EVIA 3OV8A 2RC4A 1FLIA 1FSHA 2V9VA 2HKOA 2DLLA 2EWNA 1W5TA 4UV9A 1WSUA 4LLNA 1S3JA 2BEOA 1BIBA 1BI0A 5ICGA 2R7DA 2W25A 2HDCA 3ISPA 4G8XA 2V6CA 1SD7A 4XLPF 2FRHA 1IW7F 3D5LA 2HQNA 2P4WA 5JVTA 1S7AA 1G3TA 4FHTA 2EB7A 3SQNA 1USSA 3CO6C 2G7UA 3ABTA 2VC1A 5HDGA 4KT5C 4ESFA 5D5VB 2XAJA 1R1VA 4LG0B 5DCMA 2A6HF 5DD4A 2A07F 3W6KB 3ZN1A 4P96A 5CLSA 3WTTC 3SFZA 4WWCA 1JE8A 3E97A 4M6XA 3VFZA 1O57A 4A5NA 4KUMA 5LGNA 2V79A 1IRFA 2DBBA 1U2WA 3F8NA 3E5QA 1Z7UA 2XAFA 2D1VA 3O2PE 1KA8A 4LLLA 4EM2A 4IRHA 1XSVA 3F8FA 3FXQA 3BP8A 2BGCA 2XHKA 2XKOA 3HHHA 3KCCA 3WTSC 2F5DA 3I59A 4HX7A 1P4AA 1Z9CA 3HSEA 3ZMUA 1IN5A 2Z99A 4HDUA 2Z3YA 5CYVA 1RZ4A 2YU3A 5F64A 1LQ1A 3GZ6A 2MD5A 4I01A 4LD5A 5E1ZB 4Y17A 2PN6A 1T0FA 1XGNA 3JTHA 3MQ0A 4KFCA 2FNPA 2IPQX 4HOBA 2M5WA 5E17F 4HX4A 2GXBA 1EH7A 1FY7A 3H3UA 1HXDA 3M8FA 2KJCA 4Y15A 1UB9A 2EK5A 3IL2A 3K1PA 2QVOA 1ZHFA 3HOSA 1F5TA 1HW2A 3ABUA 3WG9A 1BI3A 2FU4A 1REPC 4MTEA 4BH9A 1IN6A 1ZYRF 3DXJF 4XBFA 3WTZA 3IRRA 1O7LA 5FGMA 2E1CA 4MNUA 4P9FA 3I5UA 2R7FA 1ZGJA 2VBZA 1XB4A 3VB2A 3BY6A 3NRVA 5F6FA 3P7NA 2GAUA 3GYHX 4AIKA 2GIVA 3EYIA 5BS6A 3QP5A 3QU3A 4ZZDA 4L5JA 3CUOA 2P5VA 1U6GA 3KE2A 5HOOA 1K79A 1R00A 4O5VA 4HF0A 3BZ6A 3BPXA 2MBFA 5IT9Z 4ZYEA 3HHGA 1IN7A 2V1DA 3GLXA 1JXSA 1H9GA 1D3YA 4XRFA 3L2CA 1IAWA 5KK1A 5DCFA 2ZBKA 4BAYA 3KP4A 2RKHA 1IXRC 3AAFA 2M8EA 5BMZA 3TGNA 3LQRA 5BOXA 2YPRA 3FXUA 3HIFA 2D2WA 2GWRA 1ZRFA 3LSTA 2ISZA 2ELHA 2IA2A 2HR3A 2OU2A 5L3FA 2XRNA 1QQIA 5JI6A 1FBSA 1J5YA 1UHWA 1HQCA 2K02A 4P5OA 2FE3A 5DUKA 3TOBA 1ZGAA 2EJRA 4CXFA 1YYVA 3R0AA 1ZG1A 4LK0F 3G73A 1OYWA 1YS6A 1LB2A 1B9MA 2CW0F 4JQFA 1ONVA 2WC2A 2PMHA 4ZZLA 3F3XA 1J7KA 2KRFA 1J0RA 2QYOA 3DPTA 2XASA 5DUIA 5D8KB 3CJNA 2VONA 1USTA 3C3WA 1BI1A 2ZXJA 2OZUA 2RQPA 4ON0A 2JRTA 3WE3A 5HVQC 2FMLA 4U0WA 3JSPA 3T5XA 1XMAA 3R4KA 5BPIA 4KMUX 1ZARA 3O3KA 3HTUA 4G94A 2GA1A 5A2QZ 2QM3A 2FNAA 1FBUA 2VN2A 2NS0A 4MEYF 1Q1HA 4EJVA 2B0LA 5LEKA 1E2XA 2ZO4A 5D6EA 3T0YA 3Q9SA 5ERIA 4L18B 2J5PA 3WTXC 2O3FA 4ESJA 1G3WA 3BJOA 1FSEA 5L3GA 5HDKA 2Q2EA 1CF7A 1DPUA 2PFBA 3CUQC 5D6FA 1FYMA 2HOEA 4P9UA 4BQAA 3N97A 3RIRA 4OIRF 2RN7A 4RAZA 3MZYA 3SXYA 3WGHA 1MDMA 2Q0OA 3HRMA 4ETSA 1JHFA 4PZJA 2CO5A 5L3EA 2QENA 2VE9A 2L3DA 2NRAC 2EFPA 2O6GE 5CVUA 4KMFA 2G7HA 1LDDA 3MCZA 2FQ3A 2HWVA 4YFNF 1T38A 4KDPA 4CZZA 1KU9A 1G4DA 2FEZA 1TW3A 5FLXZ 1MDMB 4UXNA 2G9WA 4XLNF 3KLOA 2DQRA 2MLKA 4UVCA 4KNYA 5TJJA 2ADUA 2NNYA 1H9TA 3J81Z 1MGTA 2JSCA 4G7OF 3JTGA 5HS8A 4PCQA 3WU0A 5FD6A 1OMIA 3K69A 2VBXA 3HRUA 4MGRA 1J59A 4DQ2A 4R79A 3F21A 4FX4A 3IRQA 4IPAA 2X4HA 3ECHA 2EA4A 4GGGA 2FF4A 3P9KA 2PJPA 2IA1A 3I64A 1TQIA 4I2OA 2BE5F 5D8LB 1R58A 1U5TB 2BYVE 2QBYB 2Y0MA 1R1UA 1KQ8A 1YQAA 1ZN2A 5ICFA 3I0TA 1BC8C 4NHJA 5CVIA 3ELKA 1XDSA 2KJBA 3FMRA 2R3SA 3TDZC 4Y13A 3I4PA 5LGUA 3JSOA 1QGPA 1WRJA 3J7AO 1EH8A 2A69F 1XCVA 2HKXA 2KKOA 2OBPA 5E1WA 4KA4A 4M71A 5D4SA 1KU2A 3EUHA 1O3QA 1K6OA 4BHCA 4WXCA 4EJWA 1YS7A 1ZLJA 2YSRA 5LHHA 2FOKA 2RGVA 3RKWA 1QZYA 4L0YB 4LB5A 4HQMA 5J8CA 1BM9A 3S2WA 4CGZA 3WGGA 4U0VA 1YO5C 3QPHA 1LNWA 3E6CC 3HYIA 4RGXA 3GFLA 3R60A 4EJTA 5L3BA 2HTJA 3VODA 4LB6B 4EGYA 4KIGA 3FMQA 2UXNA 3WGIA 3EYYA 2CYYA 4IF4A 3IKVA 2ZMEA 4YFKF 2JZYA 2P5LC 5LLQA 3WU1B 3O6BB 1G3YA 3QAHA 1S7OA 2ZNYA 1R23A 1QO0D 5H6QA 3WTVC 3FF5A 1A04A 3IHUA 1DPRA 2PBIA 5HLHA 3IWFA 5AONA 5BPDA 5BQTA 3BWGA 1Z6TA 3KP7A 1GXQA 4ENJA 2HS5A 4OINF 1YFHA 3KP3A 1SMTA 1IF1A 1UCRA 5K5OA 4XSZF 3J80K 1S6LA 1BJAA 4YIFA 3MEXA 4I0BA 1SFUA 2LF8A 3GW2A 3Q9VA 3WTWC 4EM0B 4G6QA 3KLNA 1Z6RA 3TDUC 4CO8A 4M74A 2XKPA 2RV8A 1ULYA 4M73A 5ILSA 4L0ZB 2NNNA 1BBYA 5EEGA 5EEHA 2DO7A 2ZFWA 5A2QK 4KN7X 3I71A 2HGCA 4IRGA 1ON1A 4B8XA 3BOQA 1KYWA 2PG4A 1P92A 1F1ZA 2HZTA 5K5QA 1I1GA 2QQAA 5FFZA 1SAXA 3GUDA 3PQJA 5FB2A 2A68F 3F8BA 5H20A 3WE2A 3HSFA 2D45A 4EGZA 5FD5A 2P6SA 1TW2A 3M9AA 2EFQA 2M45A 2QUFA 1D8JA 1O3RA 1P6RA 3K0LA 2VODA 1XSXA 1AWCA 3NEUA 3KZZA 3DV8A 4ESBA 1DDNA 2VE8A 3C18A 5JR3A 4HBLA 1QPMA 2IA0A 4G6DA 1T6SA 1TBXA 3QRFF 2RDPA 3M1EA 2M87A 5FFXA 1QBJA 3LAJA 4I7HA 3COAC 4JK1X 1H0MA 4OIQF 4K2EA 2XAQA 2KIFA 4HV5A 1I1SA 2UXXA 3KZYA 1OPCA 4L9JA 2MH2A 1UFMA 2D1HA 1XD7A 3F23A 1XMKA 4CYDA 4BXUA 1RIOH 3HSRA 3P9CA 4M9ZA 5ILVA 1WI9A 4A0XA 1TTYA 1HKTA 3J80Z 2EV6A 2W57A 3GXOA 1OR7A 1F4KA 3V7SA 3ML6A 4WXHA 1STZA 3F6OA 2AS5F 4UVAA 4RS8A 4UVBA 5ICEA 4R8HA 1TQPA 4RAYA 1ZH5A 1EV7A 2STTA 4BHPA 4HLYA 2ESNA 3E6DA 2XGXA 1R5HA 4MTDA 4YFXF 2E7WA 4A2UA 4LG0A 4XSXF 4Q48A 1B9NA 5DEQA 2ISYA 5HLGA 3I53A 3RPQA 4Z2YA 4FX0A 4G9YA 2ZNZA 5ILUA 3TQNA 2LSOA 1MZBA 4Q4ZF 4LGWA 1HSTA 2MLGA 4U7DA 4WF2A 3V4GA 2DTRA 1EH6A 3R0JA 2K4JA 1FNNA 1L3LA 1TQMA 1T39A 5L3DA 1JGSA 3GWZA 2P7CB 4A5MA 2OQGA 3WODF 1LEBA 1B59A 1ZG3A 3RKXA 5E8GA 4PGHA 2MH9A 2P5KA 2A6EF 2IJLA 2TDXA 1IXCA 1XGMA 1F9NA 1BOAA 3KETA 1CGPA 3DPLC 5HS9A 2LNBA 4MHGA 3R61A 4LFUA 4O6JA 1UHMA 2L4MA 2KIMA 4I02A 3GO5A 3LA7A 4RGUA 2MC3A 1U78A 1SD4A 1PP7U 4QLCU 2UZKA 5D5XB 1ZG5A 2EFNA 2F5CA 4Q47A 3DF8A 4IXAA 3DFGA 4WCGA 3LA2A 1FWZA 4RB0A 1ON2A 2O8XA 2PI0A 1IRGA 1LDKB 3K9TA 1YLFA 4AIJA 4M72A 2HYGD 1GHCA 2EFOA 1R22A 1WQ2A 2IP2A 4CICA 1KGSA 2DQLA 2VOOA 3F8MA 2OAZA 2C6YA 1Z1DA 2FBKA 1IXSB 1K78A 4IHSA 2GZWA 1K7AA 3IKTA 1HKQA 1NHAA 2CSOA 4F7ZA 1RUOA 3VOEA 2FSWA 3RYPA 1LJ9A 3ZMVA 4EQQA 1U8RA 4I98B 4RB3C 2H09A 4AWXB 3V8KA 4E70A 2FXAA 1I6XA 1QZZA 1Z05A 5DDGA 4G7HF 2XAHA 2CQKA 3TO7A 1IN4A 2IRFG 2OD5A 4MQVA 2JTVA 4MQ9F 5CVVA 1OKRA 2L54A 3L7WA 2XVCA 3M7GA 2MA3A 3CO7C 1I27A 4GXOA 2GXGA 1OYYA 4ENKA 2CFXA 4HF1A 4AIHA 1Y0UA 1E17A 3FXRA 3JW4A 2K4BA 2DFIA 3RI4A 1PP8F 4U0YA 4OMYA 3R6SA 3ZMDA 1YW8A 4M9SA 2BV6A 2UWMA 2ZJ2A 3PQKA 2W84A 3MFKA 4G7ZF 3KEQA 1HKSA 1RNLA 5FO5A 4A12A 3CUQA 5DCMB 1FYKA 2VOPA 3P9IA 1LVAA 4MEXF 5K5RA 2YX4A 3RJPA 3SHFA 3V7CA 2V1XA 4RB2C 4DNCA 1W7PD 2HFHA 4OIOF 3K1MA 2QQBA 1B6AA 3ZQ7A 2HEOA 4EJOA 1BC7C 3CUQB 1SFEA 3FM5A 5LEJA 1FYLA 3EDPA 1MJAA 3L09A 2K27A 1PDNC 1L0OC 2Z9OA 2QQ9A 1KQ9A 2RNJA 2P7VB 5HDNA 4ENMA 2O61A 2PLYA 2JPBA 3GFIA 2Q8KA 1R36A 4UHTA 3KEOA 3ZN0A 4CHUA 1MKMA 4NQWA 5LBQA 2DPDA 1T98A 3BJAA 1QNTA 4OU0A 3RTRA 2BBYA 1U5TA 2GA2A 1YIOA 2VXZA 2V1UA 3I59B 4YIIA 2EFWA 3BPVA 1RI7A 6PAXA 4LK1F 2A3SA 1R1TA 2JT1A 4LLGF 4A6EA 1S8NA 1G3SA 2DU9A 5E8IA 4JBAA 4IJAA 2YX7A 4L5IA 3C7JA 2AXLA 3I54A 3KP2A 3H3ZA 3DP7A 1XCBA 2A61A 3U2RA 4HZFA 3DQVC 4AVPA 1ZRDA 3ZPLA 4FT8A 3GFMA 2XROA 2PEXA 3JAMZ 4O3MA 2OZ6A 3F22A 1FBQA 3CTAA 5ICCA 1W7PB 4OIPF 2VT2A 4ZYHA 3ZMZA 4KICA 2NYXA 1BI2A 2COMA 4GO1A 2LF7A 3RKYA 4BHBA 3G3ZA 2PQ8A 4WX9A 5LHGA 4R1HA 3T1BA 3GF2A 1YTYA 2GQQA 5E18F 3M8EA 2Y75A 1SD5A 2Z5UA 1J75A 5CJ9A 2DK5A 4WK8F 4LJZF 2Z33A 4EV0A 1XSDA 1P4XA 1FP1D 3LQQA 5AIQA 5ED4A 5JFRA 3FMSA 2EV0A 1ZRCA 3GFJA 4IRIA 2QZ8A 3EETA 2QWWA 2HTSA 3IC7A 4UUVA 5K1YA 2KIUA 1FT9A 3BJ6A 1XDUA 2YR2A 5D4RA 2CG4A 4HV6A 5H6RA 4HYEA 3E3VA 4ZYGA 1O3TA 3PFIA 1T2KA 2DAOA 5JHUA 2P6TA 2K86A 4I09A 3IWZA 1S29A 1O3SA 3K2ZA 3MAJA 1W4MA 2XAGA 4D0PA 1MD0A 1LEAA 1SFXA 3C1DA 2P8TA 2DT5A 4S05A 1RUNA 4M6YA 2LDUA 3ROUA 2ZKZA 2CWEA 2DW4A 3QU6A 4AD9A 1IZ1A 2LKPA 3B02A 1KU3A 4GCVA 4A0ZA 3REOA 4ASNA 1FPQA 1DUXC 3SZPA 3ECOA 5IT3A 3K1NA 2WWYA 3SZTA 4CDGA 1FX7A 4Q5SF 2JPCA 3LAPA 2IW5A 3DEUA 3GZ5A 4IHTA 5CVRA 4P55A 5KVRA 4BNCA 3QPTA 1FZPB 1W5SA 1WWXA 2CGPA 4UNOA 5DD8A 4EMSA 1IUYA 3HTSB 4HX8A 4OMZA 4LMYA 2ESHA 2J5OA 3J81K 4UV8A 4HW0A 3FX3A 5D5UB 1R7JA 1D5VA 1MJ9A 3QP6A 3DKWA 4PDKA 3F8CA 4YG2F 3CDHA 1JHHA 3U1DA 1R5GA 4OOIA 4ZYDA 1XGOA 3EQLF 3T8RA 5TRDA 2W85A 5L3CA 1VTNC 4PGGA 1P2FA 4HA8A 1ZREA 3E6MA 4IVNA 1ZAOA 2OA4A 1WKMA 1FP2A 2FA5A 1BN5A 1X3UA 2XV4S 4I0AA 2L4AA 2QLZA 5LRSA 2DI3A 1YW9A 1I5ZA 2XIGA 1KYZA 4A6DA 3QOPA 4A0YA 4HLXA 4RGSA 3CLOA 3LWFA 1TNTA 3GVAA 3H92A 2VBYA 2HQRA 1P4WA 3W6JB 2OQRA 3RPUA 1ZLKA 3Q5FA 1KQ0A 3LA3A 2ETHA 1K78B 2L01A 2H94A 3KFWX 4RB1A 1D8KA 2Y48A 1Z91A 2F2EA 5DV5A 1U5TC 4KN4X 2EA2A 2A5YB 4WXDA 3GX4X 1J2XA 1YW7A 2VBWA 4HAMA 3FWEA 5E1XA 4KIBA 1BIAA 4B09A 1TNSA 3KP5A 1DP7P 1GVJA 2ZCWA 2E7XA 3GEZA 3ZMTA 1GXPA 3ZP5A 3WTYC 3N4MA 3FZVA 2M1BA 3B73A 5F1RA 2X0LA 1U3EM 1HBXG 5IT9K 2HYFA 4HF2A 1J9IA 2O0YA 3F72A 4L9NA 1LDJA 5J6XA 4QWQA 2FBIA 4N9HA 3I58A 4ZH4F 2E1NA 5J8FA 4TV7A 3OOPA 2W24A 1FOKA
chains in the Genus database with same CATH superfamily
4XKCA 3HUGA 3NWSA 3K4BA 5CQGA 3MZHA 4M9XA 4RM3A 1PUEE 2OUMA 3E5XA 3T8TA 4CSWA 1MJBA 1YG2A 3K7AJ 2R0QC 5AIPA 2R7RA 1C0WA 5FLVA 4Z6YA 1YJ9I 5HLIA 5LRRA 2M30A 1ZR4A 3RYRA 2NVXJ 3VSKA 2QKLB 3FM3A 1RETA 2PMUA 3Q3SA 3L9FA 1VQ4I 2KRHA 3ERED 3TO6A 4EJUA 5FKMA 3RDIA 4U7BA 2ACJA 2ZB9A 2VC0A 2VKVA 4UB8C 2CUFA 4H0EA 1FC3A 2JSPA 2L02A 4D7NA 2E60A 3CF2A 3TO9A 1HSJA 1KZHA 1E3OC 2EV5A 2H1KA 2X48A 3I3LA 2F5FA 3F6VA 3QQAA 4XKWA 2DK8A 3BDDA 5HS7A 5M5YJ 1HW5A 1XN7A 1U0JA 5DYMA 4L9TA 2ZMEB 3KP6A 5FLXK 5KAFC 2WV0A 1F43A 1VF9A 2DA3A 3OYFA 2BY2A 5KNLA 4XL9A 4BYYA 3N05A 2FMYA 2H27A 1D0ZA 1KU7A 4ENNA 1TWCJ 1P7JA 1IN8A 2O03A 3DCFA 3JAMK 4IHWA 2H6CA 3CESA 3MWMA 3LFKA 4W1UA 3V8LA 4RGRA 4U88A 2VQCA 1HW1A 3L00A 4BXFA 3CLQA 4Y33A 5TISC 3A1YA 3OS1A 3BROA 2DPUA 1QU3A 3H1CA 3E5UA 1WJAA 3C2HA 1W7PA 5IP7J 2H6BA 2QGUA 3LSGA 5LHIA 2F5EA 2RVCA 2UUZA 3CMEI 3S1RJ 5LGTA 2CMPA 3CD6I 1V4RA 5FROA 3IUOA 3TKYA 4M3DA 2IT0A 3V42A 3LNQA 4NB5A 3FHZA 1AU7A 3GTKJ 3HRTA 2E2HJ 3CMMA 2IVMA 4N0BA 1ODDA 5FRNA 1E3PA 2LLKA 5E20A 3TOAA 3WTUC 3HOVJ 1AOYA 3PSIA 4EM1A 1SD6A 2EIJH 3S3NA 3D0SA 3QWLA 1G6NA 1XGSA 3V7RA 3WU2C 1A5JA 4KISA 3ZMSA 3H9QA 3NQOA 5D5WB 1AKHA 1SMYF 4GYIA 3VYSB 4F52A 2BY0A 2P0WA 3CDIA 2DFFA 2BVLA 2XRLA 3E6BA 4ITVA 3M07A 1MMDA 1OYIA 2NAZA 4DYCA 3VEPA 3ULQB 1R49A 3HOTA 3K4MA 5K7FA 2ZSHB 4L9VA 5CVJA 4DGWB 1CF7B 3HRSA 4S04A 4G6TB 3V8JA 2E71A 5F04A 1OCTC 2QBYA 3U9GA 1TLHB 2DA4A 1B1BA 1B4AA 4YELA 2K7LA 1VQLI 4HQEA 1OR7C 3OMYA 4KYWA 3M8JA 1LKXA 4GYGA 2FBHA 2FUG2 2STWA 1V3FA 2CU7A 2Q1ZB 4PJJA 2QSGX 2DXIA 4KIFA 3HOYJ 4N9IA 2XUBA 2WTEA 1ETXA 4V2GA 4HDVA 1O7FA 4E7HA 2VT3A 4EVIA 3OV8A 3CZ6A 3L1PA 3PFYA 2RC4A 3HL2A 1ETYA 2X1DA 1FLIA 1FSHA 2V9VA 2HKOA 2DLLA 2QQ8A 1Y56A 2EWNA 1W5TA 4UV9A 4RA2A 1WSUA 5CKTA 2E19A 1TWGJ 3FXMA 4LLNA 1S3JA 2BEOA 2WAQA 2KP6A 1BIBA 1BI0A 5F1JA 5ICGA 2R7DA 2W25A 4IX7A 2HDCA 2M7BA 1AKHB 3ISPA 5IPAA 4G8XA 5JLWA 1O4XA 4HSRA 2V6CA 4D9JA 1SD7A 1X4OA 4XLPF 4NC7A 3RSNA 2FRHA 1IW7F 4B44A 3D5LA 2HQNA 4CA0A 3ERMA 3JRHA 1NG6A 1JJ8C 2P4WA 4PSWA 2I8DA 4B48A 3CC4I 3HDDA 3H5AA 1UG0A 1D1BA 5JVTA 1S7AA 2M0CA 4BQOA 1UAAA 1G3TA 4FHTA 2EB7A 3K4CA 3SQNA 1MNDA 4ZYAA 1VQKI 1USSA 3CO6C 2G7UA 3ABTA 1SVMA 3G2BA 2VC1A 4QSHA 1Y8QB 3QPSA 3OYBA 1PUFA 1BR2A 5HDGA 1UZCA 4KT5C 5J47A 2LOOA 4ESFA 2ZJRF 5D5VB 2XAJA 2LY2A 3FHNA 1R1VA 4LG0B 5DCMA 2A6HF 1SVOA 2GBYA 3HM5A 4Y52J 3AG3H 5DD4A 2A07F 3S2DJ 3W6KB 4F93B 1P9QC 3ZN1A 2HU9A 1WVRA 1Z67A 4P96A 2ELKA 5CLSA 1BOBA 3GBGA 3WTTC 1GT0C 3SFZA 1R5ID 3HPGA 4WWCA 1JE8A 4FQGA 3E97A 2ZSIB 4M6XA 1D0XA 3H35A 4M3BA 2KQRA 4NNJA 3VFZA 1O57A 4QTRA 2F4OB 4UUTA 4A5NA 2NXNB 4KUMA 5LGNA 2V79A 1IRFA 2DBBA 1U2WA 4BE2A 1VQ6I 5DM7F 3F8NA 4RMNA 4Y7NJ 2DA6A 3E5QA 1Z7UA 2XAFA 1QPIA 2D1VA 3O2PE 1KA8A 2R92J 1X1CA 1VQMI 2GOXB 3K4NA 4LLLA 2VB6A 4EM2A 1W5CC 4IRHA 1X3WB 2VIXA 1XX5A 5B66C 1XSVA 4FETA 3HOWJ 3F8FA 3FXQA 3OYDA 3BP8A 2COBA 2BGCA 2X6WA 2XHKA 2YU9J 2XKOA 3HHHA 3KCCA 3WTSC 3CMAI 2F5DA 3I59A 4HX7A 1P4AA 1Z9CA 3HSEA 4I6ZA 4N4OB 4HRIA 3ZMUA 5B1BH 2WA0A 1IN5A 2Z99A 1D5YA 4U87A 4A69C 3ESWB 4HDUA 2Z3YA 5CYVA 3J7ZI 3DLAA 1RZ4A 2YU3A 3ZQGA 3FBNB 2K9QA 2IEKA 3SZGA 5F64A 1NK3P 1LQ1A 3JR9A 2HZDA 3GZ6A 2MD5A 2Z16A 4I01A 3QYBA 4LD5A 5E1ZB 4BEHB 3HUGB 1YJWI 3L2VA 2LRDA 4DOZA 2M34A 5C4XJ 4Y17A 2PN6A 1T0FA 1XGNA 5DTDA 3JTHA 1T33A 3MQ0A 4KFCA 2VJ5A 4PFPA 2FNPA 2IPQX 4HOBA 2DT6A 1Y39A 2M5WA 2WADA 5E17F 4HX4A 3A01A 1EH7A 2GXBA 4M6VA 1UELB 3PO3J 1LFPA 1FY7A 3KX2A 2OF7A 3H3UA 1HXDA 4E7KA 3M8FA 2KJCA 4Y15A 1UB9A 3OYNA 2EK5A 5F0FA 3IL2A 3AL0C 2DA5A 4IL6C 3K1PA 3CDLA 2QVOA 1ZHFA 2ID3A 3HOSA 3QYEA 4X6AJ 1F5TA 3ABUA 3WG9A 1BI3A 2FU4A 2I5UA 1HW2A 1REPC 1DU6A 1J09A 3DTEA 3IP4B 3VWBA 4MTEA 4BH9A 1SFOJ 1IN6A 1ZYRF 3DXJF 2HVSA 1T95A 4XBFA 2R7WA 1YRNB 3WTZA 4E4HA 4M3GA 2ICWG 3IRRA 1O7LA 3B6CA 2FX0A 5FGMA 4II3A 5IYBJ 2E1CA 4MNUA 4P9FA 5EZHA 2E2IJ 5GTHC 2A5WA 3I5UA 2XGDA 3BQZA 2LBFA 2R7FA 1HDPA 1ZGJA 2VBZA 1WCMJ 1XB4A 3VB2A 3A03A 3BY6A 3LMMA 3NRVA 5F6FA 3HOZJ 3DBHB 2KHMA 3P7NA 2GAUA 3GYHX 1PYVA 4AIKA 2GIVA 3EYIA 2NVQJ 4QIWN 3MKLA 5BS6A 3QP5A 3QU3A 3OIOA 4ZZDA 4L5JA 3CUOA 2P5VA 1U6GA 2JA6J 4QPOA 2XPWA 1DP3A 2ZXHA 3KE2A 4B1RA 3HG9A 1R00A 3OR1C 4O5VA 5HOOA 1K79A 4HF0A 3IH2A 3OYIA 1X2NA 4E7SA 3BZ6A 1A36A 3H5NA 3BPXA 3S16J 1H89C 2MBFA 4AU7A 2LTPA 5IT9Z 4ZYEA 2R7XA 2LFBA 3HHGA 4IKFA 2KZVA 2W00A 4LITA 4BEHA 1IN7A 2V1DA 3GLXA 3I4NJ 1JXSA 2DYRH 2JA7J 2MYSA 2X6YA 2BOLA 1H9GA 1ORKA 1D3YA 1I39A 1MH3A 4XRFA 4BBRJ 3L2CA 5J1UA 1IAWA 5KK1A 2Y69H 5DCFA 2PMZA 2X6OA 3VSLA 2ZBKA 2H8RA 4BAYA 3KP4A 2RKHA 2IGKA 1IXRC 2ELJA 2CUJA 2F4MB 3AAFA 4XRSG 3GTLJ 2M8EA 3HGGA 5GPCA 5BMZA 1IDZA 3TGNA 3LQRA 2L5QA 5BOXA 2YPRA 4BUPA 3FXUA 4EATA 3HIFA 2AQFA 5C44J 2D2WA 3ZOBA 2B7EA 1FOYA 2GWRA 1I3QJ 2M4KA 3LSTA 1ZRFA 2ISZA 2ELHA 3GZNB 2IA2A 2DYSH 2HR3A 2OU2A 1S9HA 5L3FA 3FDYA 2DFHA 2XRNA 1QQIA 3DKYA 5JI6A 1FBSA 1J5YA 3LSPA 1UHWA 3IAM2 3BLYA 3OSFA 3FK7A 1HQCA 2HPIA 5JVGF 2VI6A 3TEDA 2WV1A 1VQ7I 1A31A 2K02A 1T08B 2HQ5A 4P5OA 5JLXA 2FE3A 5DUKA 3TOBA 2R5YB 4XOTA 2KMUA 1ZGAA 2EJRA 4C3IJ 4CXFA 2VJJA 2QEXI 1YYVA 3R0AA 1ZG1A 1LFBA 2HI3A 4LK0F 3G73A 1OYWA 4JYKA 2L7FP 2V7FA 1WH7A 5EGOA 1YS6A 1LB2A 2CW7A 1B9MA 1JT0A 3BC8A 2OC6A 3IH3A 2CW0F 4XMYA 4JQFA 2JMWA 1ONVA 4Y3OA 2WC2A 2PMHA 4ZZLA 1YIJI 3FISA 2H1LA 4PJLA 5F0CA 4CUGA 3F3XA 5E3LA 1J7KA 2R5ZB 1WGXA 2KRFA 1J0RA 4CH7A 4XLCA 3GCMA 2M3AA 2QYOA 3CMYA 3FXLA 4AC0A 1Y8RB 3DPTA 5B1AH 2XASA 5DUIA 1Z21A 2Y2ZA 1APLC 3JCUC 2X6XA 5D8KB 1IRXA 3CJNA 2V9KA 3S3MA 2IGNA 2VONA 3PNYA 1USTA 3HXLA 2XC7A 3C3WA 4B4CA 4XQFA 1BI1A 1ETKA 2ZXJA 2OZUA 3H0DA 4GRIA 3BR2A 1JKQC 2RQPA 4ON0A 2JRTA 2KRCA 3WE3A 3EUKL 4AVZA 5HVQC 2FMLA 4U0WA 3JSPA 3T5XA 1BR4A 3KYCB 1XMAA 1WH5A 1MNMC 3R4KA 4D7MA 5BPIA 4KMUX 3DBLB 1GLNA 1ZARA 2L9NA 3O3KA 3HTUA 4G94A 2LVSA 4L5EA 1V55H 4ZDPA 3HKZN 2GA1A 2W48A 2VQHA 2AO9A 5A2QZ 2OJED 3L2QA 2QM3A 1QHHD 2BZTA 2FNAA 1K6YA 1FBUA 2VN2A 2EIKH 2NS0A 4MEYF 1Q1HA 4NC6A 2DA1A 2EBIA 4BE0A 3QYFA 4EJVA 2LREA 1IG7A 4XM3A 2B0LA 5LEKA 3MKYB 1E2XA 1F36A 2ZO4A 3HJEA 5D6EA 4CYCB 4IOAF 3T0YA 2XF5A 3TW6A 2Z1DA 3KYDB 3Q9SA 1XC5A 3LSIA 2J5PA 2W82A 5ERIA 4L18B 1FJLA 3WTXC 2NVTJ 3ZQQA 2HDDA 1Z7LA 2O3FA 2WY7Q 3OYJA 4ESJA 3TW7A 1SAUA 1G3WA 3BJOA 5M5XJ 1FSEA 2LH9A 4A3BJ 3PIPF 5L3GA 5HDKA 3G1OA 2Q2EA 1CF7A 1DPUA 3OYMA 3MN2A 2PFBA 1AHDP 3CUQC 5D6FA 1FYMA 2HOEA 2JUGA 4P9UA 4BQAA 5H2FC 3H3VK 3N97A 3RIRA 1ZK8A 4XK4A 3CCUI 2R7OA 4OIRF 4UUSA 1YHQI 2IBDA 1QRYA 2RN7A 3ABLH 3KEYA 4RAZA 3MZYA 3SXYA 5FKKA 3WGHA 4NDLA 1MDMA 2Q0OA 2JVHA 3HRMA 4ETSA 1JHFA 3LFUA 1GUUA 4PZJA 2CO5A 5L3EA 1ETOA 1W0UA 1ACIA 4RBOA 2QENA 2A6TA 1LUJB 5IOZA 2VE9A 2L3DA 2ID6A 2NRAC 1QZEA 2EFPA 2O6GE 2XF6A 1TZLA 2DMQA 2R5ZA 1A6QA 1OCPA 5CVUA 4KMFA 2G7HA 4DZJA 1LDDA 1VQ5I 3MCZA 2FD5A 2FQ3A 2HWVA 3H5RA 2W1OA 3BCAA 4YFNF 1T38A 4KDPA 4CZZA 1IO2A 1KU9A 3OYGA 2E34A 1G4DA 2FEZA 3FIWA 2EZLA 1WZ2A 5GP9A 1TW3A 1TC3C 4MIMA 3CJQB 2CQNA 5FLXZ 2MABA 3D1NI 1WJEA 3PM1A 4DBQA 3SEZA 1MDMB 2E1MB 4UXNA 2G9WA 1B72B 1E3HA 5M3FJ 4XLNF 1Z3XA 2FOWA 3KLOA 1WHUA 2DQRA 2MLKA 4UVCA 2K3FA 4KNYA 5TJJA 2ADUA 2NNYA 4A93J 1H9TA 3J81Z 1MGTA 2JSCA 2YUSA 3D5SC 4CCOA 4G7OF 3JTGA 2LG4A 2K9NA 5HS8A 4PCQA 1MMSA 1ITYA 3I55I 3CQZJ 3WU0A 5FD6A 1YOVB 1OMIA 3H36A 1GV5A 2M8GX 2MG4A 3MKWB 1YI2I 1X58A 3K69A 1Y1VJ 5F08A 3OSGA 3AKZA 2VBXA 1RR7A 3HRUA 4MGRA 3FKIJ 5BNGA 1J59A 1Z0XA 4OAYA 4DQ2A 4R79A 3CC2I 3F21A 3EUHC 4FX4A 3RZOJ 3IRQA 1FIAA 4XORA 4IPAA 2X4HA 1G59A 3ECHA 2EA4A 4GGGA 2FF4A 3P9KA 4F55A 4DJAA 2PJPA 2XSDC 1MBGA 1X19A 2DDAA 2IA1A 3I64A 1FTZA 4PJ0C 1TQIA 2DA2A 4I2OA 4NUBA 1HCRA 2BE5F 5D8LB 3H9JA 1R58A 1U5TB 2BYVE 2LKSA 3F9KA 3G71I 2QBYB 3F0CA 1MW7A 4PSXA 2Y0MA 3I4MJ 2M9HA 1BL0A 4LIUA 2EQRA 1R1UA 2BVMA 1ERDA 2JA2A 1YQAA 1KQ8A 1ZN2A 5ICFA 3I0TA 1BC8C 4V19K 3C2GA 4NHJA 5KCMA 5CVIA 1VQ9I 3A02A 3ELKA 1S7EA 1XDSA 2KJBA 3FMRA 2IS2A 2R3SA 1Q1VA 3TDZC 3VYUB 4Y13A 3I4PA 5LGUA 3JSOA 1QGPA 1WRJA 3J7AO 4FE4A 3OYHA 1GV2A 1EH8A 2A69F 1XCVA 3IV5A 3BG6A 2HKXA 1ZKGA 2KKOA 2OBPA 4RAFA 5E1WA 4XKBA 3ZQIA 4KA4A 4M71A 5D4SA 1KU2A 1Y0NA 2LK2A 1QVUA 1WJBA 3EUHA 1O3QA 1K6OA 4BHCA 4WXCA 2L2OA 2OTLI 4EJWA 1YS7A 1ZLJA 2YSRA 5LHHA 2FOKA 4BE1A 2RGVA 3RKWA 1QZYA 3DU6A 2KL4A 4L0YB 4LB5A 4HQMA 5J8CA 1BM9A 3S2WA 5KHDA 4QPQA 4CGZA 3KYLA 2KIQA 1XS9A 3WGGA 4U0VA 1MBEA 2R7ZJ 1YO5C 3QPHA 1LNWA 3E6CC 3I56I 5J3LA 3HYIA 4RGXA 3GFLA 4IHXA 3R60A 4CZCA 1TWAJ 2EPFA 4HNVA 3JRGA 1QVTA 4EJTA 1UJ8A 5L3BA 5C3EJ 2HTJA 3VODA 4LB6B 1RC9A 2XPVA 4AIDA 2R5YA 4NBQA 1OCCH 4EGYA 4KIGA 2RQQA 2CJJA 3FMQA 2UXNA 3WGIA 3VDXA 4RM2A 5EEAA 3EYYA 2CYYA 4IF4A 3FXJA 3IKVA 3HBLA 3ZQLA 2WY8Q 2ZMEA 4YFKF 1LPQA 2JZYA 2P5LC 5LLQA 3WU1B 3O6BB 2QA4I 1G3YA 4HNTA 3QAHA 1S7OA 2ZNYA 5HLTA 1OQYA 5M5WJ 1VNDA 1D1AA 1R23A 4BKXA 1QO0D 5H6QA 1JT6A 3WTVC 3FF5A 2WAEA 4D5FA 1A04A 3IHUA 1IRZA 1DPRA 1G8XA 2PBIA 5HLHA 1W36C 3IWFA 1TL8A 2V26A 3OL4A 5AONA 1POGA 4CCMA 5BPDA 5BQTA 5FLMJ 3BWGA 1Z6TA 3KP7A 1GXQA 4ENJA 2HS5A 2XB0X 4OINF 4XONA 4AUXA 1YFHA 2CV1A 4G12A 1OCRH 3KP3A 1SMTA 1IF1A 1UCRA 2E2JJ 2MFZA 5K5OA 4XSZF 1MBHA 3J80K 3QOEA 1S6LA 1BJAA 4YIFA 4MLOA 3MEXA 3BG3A 1PVEA 4J19A 2MC4A 3G1LA 2LF8A 3Q0VA 4I0BA 1SFUA 2VKEA 4A3EJ 1MMNA 2VXDA 3GW2A 3Q9VA 3WTWC 2QF7A 3IH4A 3WG7H 4EM0B 4G6QA 3BR0A 4LG3A 3TMOA 3JRFA 1FIPA 3UNGC 3KLNA 3X2QH 1Z6RA 3TDUC 4CO8A 3JRCA 4M74A 3OYLA 2XKPA 2R7TA 2RV8A 3ABMH 3CJTB 1ULYA 2HOSA 1MMGA 2TCTA 1IGNA 2L0KA 4M73A 3BQYA 5ILSA 5DS9A 4L0ZB 4A3MJ 1JTYA 1BBYA 2NNNA 1ENHA 5EEGA 1I6HJ 5EEHA 3A2KA 2DO7A 2PX9A 2ZFWA 3DWLE 5A2QK 4KN7X 3E0JB 2HGCA 3I71A 3OYKA 4IRGA 1ON1A 2CQQA 1ZELA 4B8XA 2JN6A 2XGEA 4B3AA 1P7IA 3BOQA 3TBIA 3PIOF 1KYWA 1S5LC 4FCYA 2PG4A 1P92A 1OCZH 2OCCH 1F1ZA 1MBFA 1VFCA 2HZTA 1I1GA 2QQAA 5FFZA 5K5QA 3GTJJ 1EJ9A 2ZJQF 2VPLA 4C2UA 3DBRB 1SAXA 3GUDA 3PQJA 2KZGA 1FMVA 5FB2A 2A68F 3F8BA 5H20A 3WE2A 3HSFA 3QPLA 1Y6IA 1W0TA 1K83J 5EF6A 2D45A 4EGZA 5FD5A 1V5FA 2AHQA 1MBKA 4A3IJ 1BJZA 2P6SA 1TW2A 3M9AA 2EFQA 1Z3YA 2M45A 2QUFA 1A35A 1D8JA 1O3RA 1P6RA 3AFHA 3K0LA 2EZIA 2VODA 3CF5F 1XSXA 2W7NA 4BXXJ 4IEJA 1X1DA 1AWCA 3NEUA 3NWTA 1TWFJ 3KZZA 3C2BA 3W2WA 4BJ6C 4II2A 2L9RA 3H9GA 3DV8A 2XB5A 3L2WA 3PNVA 4ESBA 1DDNA 2HVRA 3ZR8X 2WB1N 3U1KA 5FJ8J 4BGDA 2EIMH 1HDDC 1EKEA 2VE8A 3C18A 5JR3A 3OYCA 4F91B 4HBLA 3O8HA 4C2MJ 5B3SH 1QPMA 4I76A 2IA0A 2XF7A 3S15J 3ONQA 4G6DA 2TRTA 1T6SA 1TBXA 4RAGA 2HDWA 3QRFF 1HOMA 2RDPA 3M1EA 1U9OA 2HXIA 2DMTA 2L9SA 2M87A 1D0YA 5FFXA 4JX6A 1QBJA 3SYTA 3LAJA 4I7HA 3HPHA 3COAC 4JK1X 1H0MA 4OIQF 4K2EA 2DJIA 2XAQA 2KIFA 1Y1WJ 4HV5A 1I1SA 1T0FC 2KDOA 3BG7A 2UXXA 3KZYA 1OPCA 4L9JA 2MH2A 1UFMA 2D1HA 1XD7A 2HYJA 1LVKA 3F23A 1XMKA 1DGWY 4BDZA 4CYDA 1NK2P 4BXUA 1RIOH 3AG4H 3HSRA 3JRBA 3P9CA 4M9ZA 2M7AA 5ILVA 1WI9A 1JTXA 4XNFA 2LY9A 4DW6A 4A0XA 1TTYA 2VL8A 1HKTA 3CP2A 3BTLA 2V9PA 4OAZA 3J80Z 2EV6A 2W57A 1WI3A 3GXOA 3L2RA 1OR7A 2EZKA 1F4KA 3V7SA 3ML6A 1UG2A 4WXHA 1STZA 2WAQN 3F6OA 2AS5F 4UVAA 4RS8A 1N78A 4W97A 5F0HA 1W1WE 3QODA 4UVBA 5ICEA 4R8HA 1TQPA 3GTPJ 4RAYA 1ZH5A 3NARA 1EV7A 3S17J 2L7MP 1NH3A 4BHPA 2STTA 4HLYA 2Y31A 2ESNA 2MW8A 4IO9F 3JRDA 4XLEA 3E6DA 4J00A 1HF0A 2XGXA 4PJNA 4BBSJ 3BR5A 1R5HA 2JWTA 1MNEA 3M1CA 3AG2H 4MTDA 2ZXIA 3OOUA 3BG9A 4YFXF 3DU5A 2E7WA 2K9LA 3IAS2 3ZXSA 4A2UA 4LG0A 4XSXF 4Q48A 1B9NA 2K9MA 3AG1H 5DEQA 2ISYA 5HLGA 2GM4A 1X1BA 3H0GJ 3W6VA 3I53A 1MBJA 1ZTRA 4Z2YA 3RPQA 4FX0A 2JRMA 4G9YA 2ZNZA 5ILUA 4AM3A 3TQNA 2LSOA 1MZBA 2YS9A 3CCQI 4Q4ZF 1X3ZB 1JKPC 4MO7A 3G6EI 2LC2A 3G1MA 5GADJ 4LGWA 3HEFA 1HSTA 2MLGA 2ME0A 4U7DA 4WF2A 2Q2EB 1U8BA 2RREA 1MMAA 3V4GA 2DTRA 2K85A 1EH6A 3R0JA 2K4JA 5J4YA 1FNNA 1L3LA 1ETQA 2QSHX 1TQMA 2V4JC 4M3EA 4UB6C 3GTMJ 1JGGA 1T39A 5L3DA 1OLTA 1JGSA 3VPRA 2DMNA 4CYCA 4A3FJ 3GWZA 1ETVA 1JUMA 2P7CB 4A5MA 3BT9A 2OQGA 3WODF 1LEBA 1B59A 1ZG3A 1H8AC 3RKXA 3MZ8A 5E8GA 4PGHA 5GPAA 3G4SI 4PUSA 3RZDJ 2MH9A 2P5KA 4BDYA 4FTHA 2A6EF 2IJLA 2TDXA 1V5EA 4HSTA 2PJRA 4DBRA 1IXCA 2IXSA 1XGMA 1F9NA 1BOAA 3LSJA 3KETA 3DKXA 1QHGA 4F3QA 1CGPA 3LSRA 1MSEC 3DPLC 5EZGA 2KPMA 5HS9A 2LNBA 4MHGA 3R61A 4LFUA 4O6JA 1UHMA 4A3JJ 2DA7A 2L4MA 4F92B 2KIMA 1HLVA 4I02A 2EILH 2L7ZA 3GO5A 3LA7A 4RGUA 2MC3A 1U78A 3DLLF 1SD4A 4X0GA 2L7KA 1PP7U 2HOTA 4QLCU 2UZKA 5EYRA 1NG7A 2EH3A 2Y30A 1SVLA 3A0BC 1B8IB 3U21A 5D5XB 1ZG5A 3HOUJ 2EFNA 1TT5B 2B9SA 4BS9A 4B3XA 4FISA 1DGRM 2KISA 3O8GA 5JHFA 2F5CA 4Q47A 3OY9A 2Y9ZA 3DF8A 4IXAA 3DFGA 2DOFA 1A6IA 4WCGA 9ANTA 3LA2A 4BQQA 1FWZA 1YX5A 3BR3A 2IAIA 4RB0A 1RR8C 1ON2A 2MGQA 2O8XA 2PI0A 3OR2C 1IRGA 1LDKB 1YRNA 1NTCA 3K9TA 1DU0A 4DYQA 1YLFA 4AIJA 4M72A 1IJWC 4A3DJ 1Z77A 2BW3A 4Y4RA 4ANJA 2HYGD 2LD5A 5TGTA 1GHCA 4XN3A 1UHSA 1R22A 1WQ2A 2EFOA 2CS3A 2IP2A 5FKLA 3W3CA 4CICA 2O9LA 1KGSA 2DQLA 3FXKA 2VKHA 3BR6A 2VOOA 5EGOB 1M1EB 3F8MA 3FK6A 2OAZA 2C6YA 2R7QA 1Z1DA 3RQ4A 2FBKA 1IXSB 1K78A 4IHSA 4OWRB 4A3GJ 2GZWA 1K7AA 1WJ5A 2DTZA 3IKTA 1HKQA 2R7UA 3DPUA 1NHAA 2CSOA 1YJNI 4XICA 1BW6A 2FQ4A 3PNTA 2R7SA 2ME6A 4F7ZA 3S93A 3CCRI 1RUOA 1XTAA 3CC7I 3SDGA 3AL0B 3VOEA 3SDBA 2HQAA 2OPTA 2FSWA 3RYPA 2WAFA 1LJ9A 3ZMVA 1VQPI 1XG1A 4EQQA 1U8RA 4I98B 4RB3C 2H09A 2NVUB 4AWXB 2EZHA 1LE8B 3V8KA 4E70A 2FXAA 1I6XA 1W36D 3ZQFA 2VLAA 1QZZA 1Z05A 2VKDA 5DDGA 5E79C 3K4KA 4G7HF 2XAHA 2CQKA 3TO7A 5K7ZA 1IN4A 3BTJA 3PL8A 1S72I 2IRFG 2OD5A 4MQVA 2Z2SB 2JTVA 4MQ9F 5CQEA 4JOMA 4XLHA 5CVVA 1OKRA 2L54A 3L7WA 1TT0A 4CCKA 1TWHJ 2XVCA 2IGMA 2QSFX 3M7GA 5IYDJ 3OYEA 2I10A 4HNUA 2MA3A 4CCNA 1I27A 3CO7C 2B63J 2EINH 3GLLA 4GXOA 2VJIA 2GXGA 5FRMA 4C3HJ 1OYYA 4ENKA 4V2FA 2CFXA 2V6EA 3A0HC 2JA5J 1IUFA 2FJ1A 1OISA 4FASD 5IP9J 5C4JJ 3S32A 3ZQCA 2PMZN 3PO2J 4HF1A 4AIHA 2K3PA 1Y0UA 2MSYA 1TP4A 2F6CA 2K40A 1E17A 1MH4A 3FXRA 1LE8A 1XMXA 1V5GA 3JW4A 2K4BA 4C3JJ 4E7ZA 2ECCA 4BL0B 1T8IA 1QA6A 2DFIA 3RI4A 2ZXWH 1PP8F 5LD2C 4U0YA 4OMYA 3R6SA 3ZMDA 3DEWA 1YW8A 4M9SA 2BV6A 3L2UA 2X9DA 5DM6F 2UWMA 1K4SA 2ZJ2A 2ZMEC 3OIQA 3BTCA 2VQLA 3E1SA 2BY1A 2X85A 4XLAA 2P81A 1OJLA 3PQKA 2DDBA 2W84A 3MFKA 2O7OA 4G7ZF 3KEQA 3B6AA 3SFIA 1HKSA 1RNLA 5FO5A 3VYRB 4A12A 2CQ7A 2ZC2A 3HKZA 3CUQA 5DCMB 1FYKA 2VOPA 3P9IA 1LVAA 3DTKA 4ABZA 5K5RA 4MEXF 2YX4A 3RJPA 2E1OA 1X2MA 3M4OJ 1AA7A 3SHFA 3V7CA 4BU2A 2IS4A 2V1XA 4RB2C 3OS2A 4DNCA 1W7PD 1BW5A 2HFHA 2XAUA 2V1NA 4OIOF 2BW3B 1X1PA 3K1MA 4D1QA 4E7LA 2X1EA 4BJ5C 4IHYA 2QQBA 1SFKA 3ASNH 4BQNA 1B6AA 3ZQ7A 2HEOA 2DOAA 4EJOA 1BC7C 2F4IA 3CUQB 1SFEA 3ZGKA 1SANA 5GTIC 1ZGWA 3FM5A 4CCJA 5LEJA 2DN0A 3W2AA 3A01B 2HNHA 1FYLA 1CQTA 4GDFA 3EDPA 1MJAA 1WJDA 3E7LA 3L09A 2K27A 1PDNC 1L0OC 2Z9OA 2QQ9A 2BHZA 1KQ9A 1I3AA 2RNJA 1YX3A 2P7VB 5HDNA 4ENMA 2O61A 4P1WA 2PLYA 2JPBA 3GFIA 3HC7A 2Q8KA 4PJMA 1R36A 4UHTA 4E6KG 1MSFC 1N77A 4IHVA 3KEOA 5IP6A 3ZN0A 4CHUA 3FBIB 1MKMA 4NQWA 5LBQA 2ECBA 5HNHA 1K61A 2DPDA 5K7HA 1T98A 3SEQA 3BJAA 1QNTA 4OU0A 3RTRA 2BBYA 1BR1A 1U5TA 2NS7A 4BJTA 2GA2A 4KJZA 1BA5A 5EDNA 4JX4A 4RLQA 2CUEA 5E3MA 4D5CA 1X4PA 1YIOA 2VXZA 2LR8A 4DZPA 2V1UA 2IS1A 2LYCA 3I59B 2X1CA 4FE7A 4XR6A 4YIIA 2F5VA 2EFWA 3UKGA 3BPVA 1RI7A 2K5CA 6PAXA 4LK1F 2A3SA 1R1TA 2JT1A 2QCOA 5J1RA 4LLGF 4A6EA 3W2VA 4JP0A 1S8NA 1G3SA 3PJRA 2DU9A 4E7JA 2GLOA 5E8IA 2WB1A 3S2HJ 4JBAA 3CCSI 3EPZA 4IJAA 2QKMB 1JUPA 2YX7A 2OCEA 4L5IA 2VPRA 3C7JA 3CCEI 2AXLA 5E3NA 4UY8I 2XDVA 1JKOC 2OTJI 3GTOJ 3I54A 4XOPA 1B72A 3KP2A 3H3ZA 3DP7A 1XCBA 2A61A 3U2RA 4HZFA 4PK4A 4IZZA 5HNFA 1WJFA 2KLOA 3EUAA 4J01A 1WPKA 3FXOA 3DQVC 4AVPA 1ZRDA 3ZPLA 4FT8A 1JKRC 3GFMA 2XROA 2PEXA 3JAMZ 2BHYA 4O3MA 1ZQ3P 2OZ6A 2GXAA 3F22A 1FOWA 3OWTA 3J7AY 5KAIC 1FBQA 3CTAA 5ICCA 1W7PB 2M4GA 4E7IA 4OIPF 3GMEA 3RQIA 2VT2A 5CPRB 4DIQA 2A05A 1R4NB 2JVGA 4ZYHA 2JQ7A 3ZMZA 5J40A 4KICA 5J4VA 5FKOA 4N4NB 5J1YA 2NYXA 1BI2A 2OV7A 2H8WA 5M3MJ 2COMA 4GO1A 5FKNA 2LF7A 3RCOA 3Q0WA 1PUFB 3RKYA 4C2TA 4BHBA 3G3ZA 2PQ8A 2X51A 4YEJA 4WX9A 3WHBA 2BY3A 4AYBN 4UUSB 5LHGA 4R1HA 1IDYA 3T1BA 3GF2A 4NC8A 1YTYA 2GQQA 1HC8A 2UV1A 5E18F 2VASA 1RKTA 3M8EA 2HXOA 2Y75A 2R7VA 1SD5A 1X1AA 4LOCA 3OYAA 1FTTA 2Z5UA 3BZKA 1R6RA 1J75A 5CJ9A 2Y9YA 1N25A 2R4GA 2DK5A 4WK8F 2E5ZA 4LJZF 4BY7J 1VQ8I 2LMDA 1RKWA 2Z33A 4EV0A 1XSDA 1P4XA 1FP1D 3LQQA 1B8IA 5AIQA 5ED4A 3A4CA 5IOYA 2JJ7A 3FMSA 5JFRA 2EV0A 1DQUA 1RRJA 1RESA 2CQXA 1ZRCA 2E5NA 4S0HB 1SEUA 4B47A 3GFJA 4IRIA 2CFOA 2QZ8A 2JK3A 4B43A 3S14J 3S3OA 2DFEA 3EETA 2QWWA 2HTSA 2AXTC 3CCVI 3IC7A 4ZJZA 4UUVA 4HEA2 4IQ4A 3K70C 5K1YA 2KIUA 5F27A 1FT9A 2O8KA 4GFBA 3BJ6A 1XDUA 2YR2A 5D4RA 2CG4A 2DODA 2E36A 2ZFUA 4HV6A 5H6RA 2PJRB 4C30A 3ASOH 2CUZA 4HYEA 4A3CJ 3E3VA 1E0EA 4ZYGA 1IC8A 1O3TA 3PFIA 4XKVA 1T2KA 4ZTFA 2DAOA 1ZR2A 1T56A 5JHUA 2ZJPF 2P6TA 2K86A 4H4KC 3JRAA 4I09A 3RKQA 3S1QJ 3IWZA 4LIVA 3K70D 1WJCA 1S29A 2RNGA 1O3SA 1EA3A 3K2ZA 1R9TJ 2G0EA 3I9V2 3MAJA 3OIPA 4A3LJ 4X1EA 2BXZA 1W4MA 2XAGA 2D5VA 3BTIA 4D0PA 1MD0A 2O5RA 4IQJA 1K4TA 1LEAA 4BACA 3RPUD 1SFXA 2NOJB 3C1DA 1XPXA 2P8TA 2DT5A 4S05A 1WFXA 4RDUA 1RUNA 2HOAA 2LKXA 4M6YA 2LDUA 4JX5A 2ZKZA 3ROUA 3WHCA 4C9YA 2DMUA 2CWEA 2DW4A 3QU6A 1YE9A 3FKJA 4AD9A 1N75A 1IZ1A 3LL7A 1FOXA 2LKPA 3B02A 1JJ6C 1KU3A 4GCVA 3KIOA 3SJMA 1JI8A 4A0ZA 2CW8A 3REOA 4ASNA 1FPQA 1DUXC 2E1MC 3SZPA 1KONA 3ECOA 5IT3A 3K1NA 2CV0A 2MD0A 4MFDA 2WWYA 2DJNA 3SZTA 2KDZA 1R71A 2DMPA 2RAEA 4CDGA 1FX7A 4AYBA 4Q5SF 1FEXA 2JPCA 5EG0A 3LAPA 2M2EA 2IW5A 3DEUA 1D1CA 2R93J 2VJ4A 3GZ5A 3K4LA 4ZDLA 5CVRA 4P55A 4IHTA 3LOCA 5KVRA 4BNCA 3QPTA 3LSHA 1FZPB 3GTQJ 1W5SA 1WWXA 2E35A 4HG2A 2XPUA 3MKZA 2CGPA 3MMYB 3PUFA 5DD8A 4EMSA 1IV6A 4UNOA 3HTSB 2AQEA 1IUYA 1VQOI 3ZRGA 2IGOA 4HX8A 2CRGA 4OMZA 3HOXJ 4LMYA 3LSKA 2ESHA 2J5OA 3S8PA 3J81K 4UV8A 2IS6A 3NAUA 4HW0A 5E3OA 4IOCF 2CH0A 2L9VA 3KPHA 4ZTJA 3GTGJ 3FX3A 1I50J 5D5UB 3CCYA 1YITI 1R7JA 1D5VA 1MJ9A 4M3FA 2HPMA 3QP6A 1LFUP 5IYCJ 2DT7B 3DKWA 2K9SA 4PDKA 3F8CA 4YG2F 3CDHA 1JHHA 3U1DA 1R5GA 2XSJC 4YIRX 3JREA 4OOIA 3OS0A 3PSFA 4ZYDA 2WBMA 1XGOA 3EQLF 3T8RA 5L3CA 2W85A 1GVDA 5TRDA 3CCJI 1VTNC 4PGGA 4YRVA 1H88C 3MVPA 4I99C 5GAEJ 4RLFA 4A3KJ 3HZJA 1JUSA 5EJCA 1P2FA 2CV2A 5IY5H 4MFEA 2DOEA 4HA8A 2M0MA 2GIZA 1ZREA 4XN0A 1VQNI 3E6MA 4IVNA 1ZAOA 3BCBA 4XRSA 3K4JA 3TP0A 4ZDOA 2OA4A 1WKMA 3JRIA 1FP2A 2FA5A 3ZCOA 1BN5A 1X3UA 2XV4S 4I0AA 2Y0SN 2L4AA 2QLZA 3DTIA 5LRSA 2DI3A 1YW9A 1I5ZA 4NQWB 3M3YJ 2XIGA 3P5JA 1KYZA 4CCLA 4A6DA 1V54H 1MIJA 3QOPA 4A0YA 1IV8A 2NOGA 3ZQHA 1GDTA 4HLXA 4RGSA 4HPQA 3S1MJ 3CLOA 3LWFA 3K6GA 4DYRA 2KT0A 1TNTA 3ABKH 3GVAA 2F48A 3H92A 2VBYA 4EEFG 2HQRA 1VI0A 1P4WA 3W6JB 1SC7A 4XIDA 2OQRA 3RPUA 3CCLI 1ZLKA 2KFDA 3Q5FA 2LBFB 3HGYA 3MD2A 1KQ0A 3LA3A 5EG0B 2ETHA 3TL4X 5GAHJ 3K10A 1K78B 2L01A 3D5RC 1PJRA 2N8GA 3CP8A 2H94A 2LY1A 2JA8J 3KFWX 4RB1A 3BR1A 1D8KA 2Y48A 3OL3A 4XRMA 1R4MB 1Z91A 2F2EA 5DV5A 3UR3C 5GAGJ 3KZIC 1U9NA 3S1NJ 1U5TC 5B5EC 3J7YJ 2W4SA 4KN4X 2EA2A 2A5YB 4WXDA 3GX4X 1J2XA 1YW7A 2JUCA 2VBWA 3DEEA 4KITB 1OCOH 4HAMA 2NS8A 3FWEA 4ZC3A 5E1XA 2LP0A 3PUBA 4KIBA 1OFCX 5LFAA 1BIAA 4KT6A 4B09A 1TNSA 3KP5A 1DP7P 1GVJA 3Q0UA 2ZCWA 1ETWA 2E7XA 3GEZA 3ZMTA 1GXPA 3ZP5A 3WTYC 3N4MA 3FZVA 2M1BA 3B73A 2HVQA 4XLFA 3CJRB 5F1RA 2X0LA 1U3EM 1HBXG 2NVYJ 1EF4A 3LSMA 3TP3A 5IT9K 2HYFA 3K2AA 4PFOA 2BXYA 4HF2A 4BY1J 1J9IA 2O0YA 2Y0SA 3VYTB 2DCEA 3F72A 4L9NA 5HODA 1FMWA 1LDJA 3HB9A 3CCMI 2VUMJ 1G2HA 1UMQA 1VZ0A 4QWQA 5J6XA 2GOMA 2FBIA 4N9HA 3I58A 4ZH4F 1RPWA 3BZCA 2XGCA 2E1NA 5J8FA 3BG5A 3OOPA 4TV7A 1HA8A 2W24A 2VQGA 1FOKA
chains in the Genus database with same CATH topology
3HUGA 3MZHA 4M9XA 1PUEE 3E5XA 3T8TA 1MJBA 1YG2A 5AIPA 1C0WA 5HLIA 5LRRA 2M30A 3RYRA 3FM3A 2PMUA 3L9FA 3ERED 3TO6A 4EJUA 3RDIA 4U7BA 2ACJA 2VC0A 4H0EA 1FC3A 2L02A 3TO9A 1HSJA 2EV5A 2F5FA 3F6VA 2DK8A 3BDDA 5HS7A 1HW5A 1XN7A 5DYMA 4L9TA 2ZMEB 3KP6A 5FLXK 2WV0A 4BYYA 2FMYA 2H27A 1KU7A 4ENNA 1IN8A 2O03A 3JAMK 2H6CA 3MWMA 3LFKA 3V8LA 4RGRA 4U88A 1HW1A 3L00A 3BROA 2DPUA 3E5UA 1W7PA 2H6BA 5LHIA 2F5EA 2RVCA 5LGTA 1V4RA 3TKYA 2IT0A 4NB5A 3FHZA 3HRTA 2IVMA 4N0BA 1ODDA 3WTUC 5E20A 3TOAA 1AOYA 4EM1A 1SD6A 3D0SA 1G6NA 1XGSA 3V7RA 3ZMSA 5D5WB 3NQOA 1SMYF 4GYIA 3E6BA 1OYIA 2NAZA 3VEPA 3ULQB 3HOTA 1CF7B 4L9VA 5CVJA 3HRSA 4S04A 3V8JA 2QBYA 3U9GA 1TLHB 1B1BA 1B4AA 2K7LA 4HQEA 4KYWA 4GYGA 2FBHA 2STWA 1V3FA 4KIFA 4N9IA 2XUBA 2WTEA 4HDVA 1O7FA 2VT3A 4EVIA 3OV8A 2RC4A 1FLIA 1FSHA 2V9VA 2HKOA 2DLLA 2EWNA 1W5TA 4UV9A 1WSUA 4LLNA 1S3JA 2BEOA 1BIBA 1BI0A 5ICGA 2R7DA 2W25A 2HDCA 3ISPA 4G8XA 2V6CA 1SD7A 4XLPF 2FRHA 1IW7F 3D5LA 2HQNA 2P4WA 5JVTA 1S7AA 1G3TA 4FHTA 2EB7A 3SQNA 1USSA 3CO6C 2G7UA 3ABTA 2VC1A 5HDGA 4KT5C 4ESFA 5D5VB 2XAJA 1R1VA 4LG0B 5DCMA 2A6HF 5DD4A 2A07F 3W6KB 3ZN1A 4P96A 5CLSA 3WTTC 3SFZA 4WWCA 1JE8A 3E97A 4M6XA 3VFZA 1O57A 4A5NA 4KUMA 5LGNA 2V79A 1IRFA 2DBBA 1U2WA 3F8NA 3E5QA 1Z7UA 2XAFA 2D1VA 3O2PE 1KA8A 4LLLA 4EM2A 4IRHA 1XSVA 3F8FA 3FXQA 3BP8A 2BGCA 2XHKA 2XKOA 3HHHA 3KCCA 3WTSC 2F5DA 3I59A 4HX7A 1P4AA 1Z9CA 3HSEA 3ZMUA 1IN5A 2Z99A 4HDUA 2Z3YA 5CYVA 1RZ4A 2YU3A 5F64A 1LQ1A 3GZ6A 2MD5A 4I01A 4LD5A 5E1ZB 4Y17A 2PN6A 1T0FA 1XGNA 3JTHA 3MQ0A 4KFCA 2FNPA 2IPQX 4HOBA 2M5WA 5E17F 4HX4A 2GXBA 1EH7A 1FY7A 3H3UA 1HXDA 3M8FA 2KJCA 4Y15A 1UB9A 2EK5A 3IL2A 3K1PA 2QVOA 1ZHFA 3HOSA 1F5TA 1HW2A 3ABUA 3WG9A 1BI3A 2FU4A 1REPC 4MTEA 4BH9A 1IN6A 1ZYRF 3DXJF 4XBFA 3WTZA 3IRRA 1O7LA 5FGMA 2E1CA 4MNUA 4P9FA 3I5UA 2R7FA 1ZGJA 2VBZA 1XB4A 3VB2A 3BY6A 3NRVA 5F6FA 3P7NA 2GAUA 3GYHX 4AIKA 2GIVA 3EYIA 5BS6A 3QP5A 3QU3A 4ZZDA 4L5JA 3CUOA 2P5VA 1U6GA 3KE2A 5HOOA 1K79A 1R00A 4O5VA 4HF0A 3BZ6A 3BPXA 2MBFA 5IT9Z 4ZYEA 3HHGA 1IN7A 2V1DA 3GLXA 1JXSA 1H9GA 1D3YA 4XRFA 3L2CA 1IAWA 5KK1A 5DCFA 2ZBKA 4BAYA 3KP4A 2RKHA 1IXRC 3AAFA 2M8EA 5BMZA 3TGNA 3LQRA 5BOXA 2YPRA 3FXUA 3HIFA 2D2WA 2GWRA 1ZRFA 3LSTA 2ISZA 2ELHA 2IA2A 2HR3A 2OU2A 5L3FA 2XRNA 1QQIA 5JI6A 1FBSA 1J5YA 1UHWA 1HQCA 2K02A 4P5OA 2FE3A 5DUKA 3TOBA 1ZGAA 2EJRA 4CXFA 1YYVA 3R0AA 1ZG1A 4LK0F 3G73A 1OYWA 1YS6A 1LB2A 1B9MA 2CW0F 4JQFA 1ONVA 2WC2A 2PMHA 4ZZLA 3F3XA 1J7KA 2KRFA 1J0RA 2QYOA 3DPTA 2XASA 5DUIA 5D8KB 3CJNA 2VONA 1USTA 3C3WA 1BI1A 2ZXJA 2OZUA 2RQPA 4ON0A 2JRTA 3WE3A 5HVQC 2FMLA 4U0WA 3JSPA 3T5XA 1XMAA 3R4KA 5BPIA 4KMUX 1ZARA 3O3KA 3HTUA 4G94A 2GA1A 5A2QZ 2QM3A 2FNAA 1FBUA 2VN2A 2NS0A 4MEYF 1Q1HA 4EJVA 2B0LA 5LEKA 1E2XA 2ZO4A 5D6EA 3T0YA 3Q9SA 5ERIA 4L18B 2J5PA 3WTXC 2O3FA 4ESJA 1G3WA 3BJOA 1FSEA 5L3GA 5HDKA 2Q2EA 1CF7A 1DPUA 2PFBA 3CUQC 5D6FA 1FYMA 2HOEA 4P9UA 4BQAA 3N97A 3RIRA 4OIRF 2RN7A 4RAZA 3MZYA 3SXYA 3WGHA 1MDMA 2Q0OA 3HRMA 4ETSA 1JHFA 4PZJA 2CO5A 5L3EA 2QENA 2VE9A 2L3DA 2NRAC 2EFPA 2O6GE 5CVUA 4KMFA 2G7HA 1LDDA 3MCZA 2FQ3A 2HWVA 4YFNF 1T38A 4KDPA 4CZZA 1KU9A 1G4DA 2FEZA 1TW3A 5FLXZ 1MDMB 4UXNA 2G9WA 4XLNF 3KLOA 2DQRA 2MLKA 4UVCA 4KNYA 5TJJA 2ADUA 2NNYA 1H9TA 3J81Z 1MGTA 2JSCA 4G7OF 3JTGA 5HS8A 4PCQA 3WU0A 5FD6A 1OMIA 3K69A 2VBXA 3HRUA 4MGRA 1J59A 4DQ2A 4R79A 3F21A 4FX4A 3IRQA 4IPAA 2X4HA 3ECHA 2EA4A 4GGGA 2FF4A 3P9KA 2PJPA 2IA1A 3I64A 1TQIA 4I2OA 2BE5F 5D8LB 1R58A 1U5TB 2BYVE 2QBYB 2Y0MA 1R1UA 1KQ8A 1YQAA 1ZN2A 5ICFA 3I0TA 1BC8C 4NHJA 5CVIA 3ELKA 1XDSA 2KJBA 3FMRA 2R3SA 3TDZC 4Y13A 3I4PA 5LGUA 3JSOA 1QGPA 1WRJA 3J7AO 1EH8A 2A69F 1XCVA 2HKXA 2KKOA 2OBPA 5E1WA 4KA4A 4M71A 5D4SA 1KU2A 3EUHA 1O3QA 1K6OA 4BHCA 4WXCA 4EJWA 1YS7A 1ZLJA 2YSRA 5LHHA 2FOKA 2RGVA 3RKWA 1QZYA 4L0YB 4LB5A 4HQMA 5J8CA 1BM9A 3S2WA 4CGZA 3WGGA 4U0VA 1YO5C 3QPHA 1LNWA 3E6CC 3HYIA 4RGXA 3GFLA 3R60A 4EJTA 5L3BA 2HTJA 3VODA 4LB6B 4EGYA 4KIGA 3FMQA 2UXNA 3WGIA 3EYYA 2CYYA 4IF4A 3IKVA 2ZMEA 4YFKF 2JZYA 2P5LC 5LLQA 3WU1B 3O6BB 1G3YA 3QAHA 1S7OA 2ZNYA 1R23A 1QO0D 5H6QA 3WTVC 3FF5A 1A04A 3IHUA 1DPRA 2PBIA 5HLHA 3IWFA 5AONA 5BPDA 5BQTA 3BWGA 1Z6TA 3KP7A 1GXQA 4ENJA 2HS5A 4OINF 1YFHA 3KP3A 1SMTA 1IF1A 1UCRA 5K5OA 4XSZF 3J80K 1S6LA 1BJAA 4YIFA 3MEXA 4I0BA 1SFUA 2LF8A 3GW2A 3Q9VA 3WTWC 4EM0B 4G6QA 3KLNA 1Z6RA 3TDUC 4CO8A 4M74A 2XKPA 2RV8A 1ULYA 4M73A 5ILSA 4L0ZB 2NNNA 1BBYA 5EEGA 5EEHA 2DO7A 2ZFWA 5A2QK 4KN7X 3I71A 2HGCA 4IRGA 1ON1A 4B8XA 3BOQA 1KYWA 2PG4A 1P92A 1F1ZA 2HZTA 5K5QA 1I1GA 2QQAA 5FFZA 1SAXA 3GUDA 3PQJA 5FB2A 2A68F 3F8BA 5H20A 3WE2A 3HSFA 2D45A 4EGZA 5FD5A 2P6SA 1TW2A 3M9AA 2EFQA 2M45A 2QUFA 1D8JA 1O3RA 1P6RA 3K0LA 2VODA 1XSXA 1AWCA 3NEUA 3KZZA 3DV8A 4ESBA 1DDNA 2VE8A 3C18A 5JR3A 4HBLA 1QPMA 2IA0A 4G6DA 1T6SA 1TBXA 3QRFF 2RDPA 3M1EA 2M87A 5FFXA 1QBJA 3LAJA 4I7HA 3COAC 4JK1X 1H0MA 4OIQF 4K2EA 2XAQA 2KIFA 4HV5A 1I1SA 2UXXA 3KZYA 1OPCA 4L9JA 2MH2A 1UFMA 2D1HA 1XD7A 3F23A 1XMKA 4CYDA 4BXUA 1RIOH 3HSRA 3P9CA 4M9ZA 5ILVA 1WI9A 4A0XA 1TTYA 1HKTA 3J80Z 2EV6A 2W57A 3GXOA 1OR7A 1F4KA 3V7SA 3ML6A 4WXHA 1STZA 3F6OA 2AS5F 4UVAA 4RS8A 4UVBA 5ICEA 4R8HA 1TQPA 4RAYA 1ZH5A 1EV7A 2STTA 4BHPA 4HLYA 2ESNA 3E6DA 2XGXA 1R5HA 4MTDA 4YFXF 2E7WA 4A2UA 4LG0A 4XSXF 4Q48A 1B9NA 5DEQA 2ISYA 5HLGA 3I53A 3RPQA 4Z2YA 4FX0A 4G9YA 2ZNZA 5ILUA 3TQNA 2LSOA 1MZBA 4Q4ZF 4LGWA 1HSTA 2MLGA 4U7DA 4WF2A 3V4GA 2DTRA 1EH6A 3R0JA 2K4JA 1FNNA 1L3LA 1TQMA 1T39A 5L3DA 1JGSA 3GWZA 2P7CB 4A5MA 2OQGA 3WODF 1LEBA 1B59A 1ZG3A 3RKXA 5E8GA 4PGHA 2MH9A 2P5KA 2A6EF 2IJLA 2TDXA 1IXCA 1XGMA 1F9NA 1BOAA 3KETA 1CGPA 3DPLC 5HS9A 2LNBA 4MHGA 3R61A 4LFUA 4O6JA 1UHMA 2L4MA 2KIMA 4I02A 3GO5A 3LA7A 4RGUA 2MC3A 1U78A 1SD4A 1PP7U 4QLCU 2UZKA 5D5XB 1ZG5A 2EFNA 2F5CA 4Q47A 3DF8A 4IXAA 3DFGA 4WCGA 3LA2A 1FWZA 4RB0A 1ON2A 2O8XA 2PI0A 1IRGA 1LDKB 3K9TA 1YLFA 4AIJA 4M72A 2HYGD 1GHCA 2EFOA 1R22A 1WQ2A 2IP2A 4CICA 1KGSA 2DQLA 2VOOA 3F8MA 2OAZA 2C6YA 1Z1DA 2FBKA 1IXSB 1K78A 4IHSA 2GZWA 1K7AA 3IKTA 1HKQA 1NHAA 2CSOA 4F7ZA 1RUOA 3VOEA 2FSWA 3RYPA 1LJ9A 3ZMVA 4EQQA 1U8RA 4I98B 4RB3C 2H09A 4AWXB 3V8KA 4E70A 2FXAA 1I6XA 1QZZA 1Z05A 5DDGA 4G7HF 2XAHA 2CQKA 3TO7A 1IN4A 2IRFG 2OD5A 4MQVA 2JTVA 4MQ9F 5CVVA 1OKRA 2L54A 3L7WA 2XVCA 3M7GA 2MA3A 3CO7C 1I27A 4GXOA 2GXGA 1OYYA 4ENKA 2CFXA 4HF1A 4AIHA 1Y0UA 1E17A 3FXRA 3JW4A 2K4BA 2DFIA 3RI4A 1PP8F 4U0YA 4OMYA 3R6SA 3ZMDA 1YW8A 4M9SA 2BV6A 2UWMA 2ZJ2A 3PQKA 2W84A 3MFKA 4G7ZF 3KEQA 1HKSA 1RNLA 5FO5A 4A12A 3CUQA 5DCMB 1FYKA 2VOPA 3P9IA 1LVAA 4MEXF 5K5RA 2YX4A 3RJPA 3SHFA 3V7CA 2V1XA 4RB2C 4DNCA 1W7PD 2HFHA 4OIOF 3K1MA 2QQBA 1B6AA 3ZQ7A 2HEOA 4EJOA 1BC7C 3CUQB 1SFEA 3FM5A 5LEJA 1FYLA 3EDPA 1MJAA 3L09A 2K27A 1PDNC 1L0OC 2Z9OA 2QQ9A 1KQ9A 2RNJA 2P7VB 5HDNA 4ENMA 2O61A 2PLYA 2JPBA 3GFIA 2Q8KA 1R36A 4UHTA 3KEOA 3ZN0A 4CHUA 1MKMA 4NQWA 5LBQA 2DPDA 1T98A 3BJAA 1QNTA 4OU0A 3RTRA 2BBYA 1U5TA 2GA2A 1YIOA 2VXZA 2V1UA 3I59B 4YIIA 2EFWA 3BPVA 1RI7A 6PAXA 4LK1F 2A3SA 1R1TA 2JT1A 4LLGF 4A6EA 1S8NA 1G3SA 2DU9A 5E8IA 4JBAA 4IJAA 2YX7A 4L5IA 3C7JA 2AXLA 3I54A 3KP2A 3H3ZA 3DP7A 1XCBA 2A61A 3U2RA 4HZFA 3DQVC 4AVPA 1ZRDA 3ZPLA 4FT8A 3GFMA 2XROA 2PEXA 3JAMZ 4O3MA 2OZ6A 3F22A 1FBQA 3CTAA 5ICCA 1W7PB 4OIPF 2VT2A 4ZYHA 3ZMZA 4KICA 2NYXA 1BI2A 2COMA 4GO1A 2LF7A 3RKYA 4BHBA 3G3ZA 2PQ8A 4WX9A 5LHGA 4R1HA 3T1BA 3GF2A 1YTYA 2GQQA 5E18F 3M8EA 2Y75A 1SD5A 2Z5UA 1J75A 5CJ9A 2DK5A 4WK8F 4LJZF 2Z33A 4EV0A 1XSDA 1P4XA 1FP1D 3LQQA 5AIQA 5ED4A 5JFRA 3FMSA 2EV0A 1ZRCA 3GFJA 4IRIA 2QZ8A 3EETA 2QWWA 2HTSA 3IC7A 4UUVA 5K1YA 2KIUA 1FT9A 3BJ6A 1XDUA 2YR2A 5D4RA 2CG4A 4HV6A 5H6RA 4HYEA 3E3VA 4ZYGA 1O3TA 3PFIA 1T2KA 2DAOA 5JHUA 2P6TA 2K86A 4I09A 3IWZA 1S29A 1O3SA 3K2ZA 3MAJA 1W4MA 2XAGA 4D0PA 1MD0A 1LEAA 1SFXA 3C1DA 2P8TA 2DT5A 4S05A 1RUNA 4M6YA 2LDUA 3ROUA 2ZKZA 2CWEA 2DW4A 3QU6A 4AD9A 1IZ1A 2LKPA 3B02A 1KU3A 4GCVA 4A0ZA 3REOA 4ASNA 1FPQA 1DUXC 3SZPA 3ECOA 5IT3A 3K1NA 2WWYA 3SZTA 4CDGA 1FX7A 4Q5SF 2JPCA 3LAPA 2IW5A 3DEUA 3GZ5A 4IHTA 5CVRA 4P55A 5KVRA 4BNCA 3QPTA 1FZPB 1W5SA 1WWXA 2CGPA 4UNOA 5DD8A 4EMSA 1IUYA 3HTSB 4HX8A 4OMZA 4LMYA 2ESHA 2J5OA 3J81K 4UV8A 4HW0A 3FX3A 5D5UB 1R7JA 1D5VA 1MJ9A 3QP6A 3DKWA 4PDKA 3F8CA 4YG2F 3CDHA 1JHHA 3U1DA 1R5GA 4OOIA 4ZYDA 1XGOA 3EQLF 3T8RA 5TRDA 2W85A 5L3CA 1VTNC 4PGGA 1P2FA 4HA8A 1ZREA 3E6MA 4IVNA 1ZAOA 2OA4A 1WKMA 1FP2A 2FA5A 1BN5A 1X3UA 2XV4S 4I0AA 2L4AA 2QLZA 5LRSA 2DI3A 1YW9A 1I5ZA 2XIGA 1KYZA 4A6DA 3QOPA 4A0YA 4HLXA 4RGSA 3CLOA 3LWFA 1TNTA 3GVAA 3H92A 2VBYA 2HQRA 1P4WA 3W6JB 2OQRA 3RPUA 1ZLKA 3Q5FA 1KQ0A 3LA3A 2ETHA 1K78B 2L01A 2H94A 3KFWX 4RB1A 1D8KA 2Y48A 1Z91A 2F2EA 5DV5A 1U5TC 4KN4X 2EA2A 2A5YB 4WXDA 3GX4X 1J2XA 1YW7A 2VBWA 4HAMA 3FWEA 5E1XA 4KIBA 1BIAA 4B09A 1TNSA 3KP5A 1DP7P 1GVJA 2ZCWA 2E7XA 3GEZA 3ZMTA 1GXPA 3ZP5A 3WTYC 3N4MA 3FZVA 2M1BA 3B73A 5F1RA 2X0LA 1U3EM 1HBXG 5IT9K 2HYFA 4HF2A 1J9IA 2O0YA 3F72A 4L9NA 1LDJA 5J6XA 4QWQA 2FBIA 4N9HA 3I58A 4ZH4F 2E1NA 5J8FA 4TV7A 3OOPA 2W24A 1FOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUG A;  3MZH A;  4M9X A;  1PUE E;  3E5X A;  3T8T A;  1MJB A;  1YG2 A;  5AIP A;  1C0W A;  5HLI A;  5LRR A;  2M30 A;  3RYR A;  3FM3 A;  2PMU A;  3L9F A;  3ERE D;  3TO6 A;  4EJU A;  3RDI A;  4U7B A;  2ACJ A;  2VC0 A;  4H0E A;  1FC3 A;  2L02 A;  3TO9 A;  1HSJ A;  2EV5 A;  2F5F A;  3F6V A;  2DK8 A;  3BDD A;  5HS7 A;  1HW5 A;  1XN7 A;  5DYM A;  4L9T A;  2ZME B;  3KP6 A;  5FLX K;  2WV0 A;  4BYY A;  2FMY A;  2H27 A;  1KU7 A;  4ENN A;  1IN8 A;  2O03 A;  3JAM K;  2H6C A;  3MWM A;  3LFK A;  3V8L A;  4RGR A;  4U88 A;  1HW1 A;  3L00 A;  3BRO A;  2DPU A;  3E5U A;  1W7P A;  2H6B A;  5LHI A;  2F5E A;  2RVC A;  5LGT A;  1V4R A;  3TKY A;  2IT0 A;  4NB5 A;  3FHZ A;  3HRT A;  2IVM A;  4N0B A;  1ODD A;  3WTU C;  5E20 A;  3TOA A;  1AOY A;  4EM1 A;  1SD6 A;  3D0S A;  1G6N A;  1XGS A;  3V7R A;  3ZMS A;  5D5W B;  3NQO A;  1SMY F;  4GYI A;  3E6B A;  1OYI A;  2NAZ A;  3VEP A;  3ULQ B;  3HOT A;  1CF7 B;  4L9V A;  5CVJ A;  3HRS A;  4S04 A;  3V8J A;  2QBY A;  3U9G A;  1TLH B;  1B1B A;  1B4A A;  2K7L A;  4HQE A;  4KYW A;  4GYG A;  2FBH A;  2STW A;  1V3F A;  4KIF A;  4N9I A;  2XUB A;  2WTE A;  4HDV A;  1O7F A;  2VT3 A;  4EVI A;  3OV8 A;  2RC4 A;  1FLI A;  1FSH A;  2V9V A;  2HKO A;  2DLL A;  2EWN A;  1W5T A;  4UV9 A;  1WSU A;  4LLN A;  1S3J A;  2BEO A;  1BIB A;  1BI0 A;  5ICG A;  2R7D A;  2W25 A;  2HDC A;  3ISP A;  4G8X A;  2V6C A;  1SD7 A;  4XLP F;  2FRH A;  1IW7 F;  3D5L A;  2HQN A;  2P4W A;  5JVT A;  1S7A A;  1G3T A;  4FHT A;  2EB7 A;  3SQN A;  1USS A;  3CO6 C;  2G7U A;  3ABT A;  2VC1 A;  5HDG A;  4KT5 C;  4ESF A;  5D5V B;  2XAJ A;  1R1V A;  4LG0 B;  5DCM A;  2A6H F;  5DD4 A;  2A07 F;  3W6K B;  3ZN1 A;  4P96 A;  5CLS A;  3WTT C;  3SFZ A;  4WWC A;  1JE8 A;  3E97 A;  4M6X A;  3VFZ A;  1O57 A;  4A5N A;  4KUM A;  5LGN A;  2V79 A;  1IRF A;  2DBB A;  1U2W A;  3F8N A;  3E5Q A;  1Z7U A;  2XAF A;  2D1V A;  3O2P E;  1KA8 A;  4LLL A;  4EM2 A;  4IRH A;  1XSV A;  3F8F A;  3FXQ A;  3BP8 A;  2BGC A;  2XHK A;  2XKO A;  3HHH A;  3KCC A;  3WTS C;  2F5D A;  3I59 A;  4HX7 A;  1P4A A;  1Z9C A;  3HSE A;  3ZMU A;  1IN5 A;  2Z99 A;  4HDU A;  2Z3Y A;  5CYV A;  1RZ4 A;  2YU3 A;  5F64 A;  1LQ1 A;  3GZ6 A;  2MD5 A;  4I01 A;  4LD5 A;  5E1Z B;  4Y17 A;  2PN6 A;  1T0F A;  1XGN A;  3JTH A;  3MQ0 A;  4KFC A;  2FNP A;  2IPQ X;  4HOB A;  2M5W A;  5E17 F;  4HX4 A;  2GXB A;  1EH7 A;  1FY7 A;  3H3U A;  1HXD A;  3M8F A;  2KJC A;  4Y15 A;  1UB9 A;  2EK5 A;  3IL2 A;  3K1P A;  2QVO A;  1ZHF A;  3HOS A;  1F5T A;  1HW2 A;  3ABU A;  3WG9 A;  1BI3 A;  2FU4 A;  1REP C;  4MTE A;  4BH9 A;  1IN6 A;  1ZYR F;  3DXJ F;  4XBF A;  3WTZ A;  3IRR A;  1O7L A;  5FGM A;  2E1C A;  4MNU A;  4P9F A;  3I5U A;  2R7F A;  1ZGJ A;  2VBZ A;  1XB4 A;  3VB2 A;  3BY6 A;  3NRV A;  5F6F A;  3P7N A;  2GAU A;  3GYH X;  4AIK A;  2GIV A;  3EYI A;  5BS6 A;  3QP5 A;  3QU3 A;  4ZZD A;  4L5J A;  3CUO A;  2P5V A;  1U6G A;  3KE2 A;  5HOO A;  1K79 A;  1R00 A;  4O5V A;  4HF0 A;  3BZ6 A;  3BPX A;  2MBF A;  5IT9 Z;  4ZYE A;  3HHG A;  1IN7 A;  2V1D A;  3GLX A;  1JXS A;  1H9G A;  1D3Y A;  4XRF A;  3L2C A;  1IAW A;  5KK1 A;  5DCF A;  2ZBK A;  4BAY A;  3KP4 A;  2RKH A;  1IXR C;  3AAF A;  2M8E A;  5BMZ A;  3TGN A;  3LQR A;  5BOX A;  2YPR A;  3FXU A;  3HIF A;  2D2W A;  2GWR A;  1ZRF A;  3LST A;  2ISZ A;  2ELH A;  2IA2 A;  2HR3 A;  2OU2 A;  5L3F A;  2XRN A;  1QQI A;  5JI6 A;  1FBS A;  1J5Y A;  1UHW A;  1HQC A;  2K02 A;  4P5O A;  2FE3 A;  5DUK A;  3TOB A;  1ZGA A;  2EJR A;  4CXF A;  1YYV A;  3R0A A;  1ZG1 A;  4LK0 F;  3G73 A;  1OYW A;  1YS6 A;  1LB2 A;  1B9M A;  2CW0 F;  4JQF A;  1ONV A;  2WC2 A;  2PMH A;  4ZZL A;  3F3X A;  1J7K A;  2KRF A;  1J0R A;  2QYO A;  3DPT A;  2XAS A;  5DUI A;  5D8K B;  3CJN A;  2VON A;  1UST A;  3C3W A;  1BI1 A;  2ZXJ A;  2OZU A;  2RQP A;  4ON0 A;  2JRT A;  3WE3 A;  5HVQ C;  2FML A;  4U0W A;  3JSP A;  3T5X A;  1XMA A;  3R4K A;  5BPI A;  4KMU X;  1ZAR A;  3O3K A;  3HTU A;  4G94 A;  2GA1 A;  5A2Q Z;  2QM3 A;  2FNA A;  1FBU A;  2VN2 A;  2NS0 A;  4MEY F;  1Q1H A;  4EJV A;  2B0L A;  5LEK A;  1E2X A;  2ZO4 A;  5D6E A;  3T0Y A;  3Q9S A;  5ERI A;  4L18 B;  2J5P A;  3WTX C;  2O3F A;  4ESJ A;  1G3W A;  3BJO A;  1FSE A;  5L3G A;  5HDK A;  2Q2E A;  1CF7 A;  1DPU A;  2PFB A;  3CUQ C;  5D6F A;  1FYM A;  2HOE A;  4P9U A;  4BQA A;  3N97 A;  3RIR A;  4OIR F;  2RN7 A;  4RAZ A;  3MZY A;  3SXY A;  3WGH A;  1MDM A;  2Q0O A;  3HRM A;  4ETS A;  1JHF A;  4PZJ A;  2CO5 A;  5L3E A;  2QEN A;  2VE9 A;  2L3D A;  2NRA C;  2EFP A;  2O6G E;  5CVU A;  4KMF A;  2G7H A;  1LDD A;  3MCZ A;  2FQ3 A;  2HWV A;  4YFN F;  1T38 A;  4KDP A;  4CZZ A;  1KU9 A;  1G4D A;  2FEZ A;  1TW3 A;  5FLX Z;  1MDM B;  4UXN A;  2G9W A;  4XLN F;  3KLO A;  2DQR A;  2MLK A;  4UVC A;  4KNY A;  5TJJ A;  2ADU A;  2NNY A;  1H9T A;  3J81 Z;  1MGT A;  2JSC A;  4G7O F;  3JTG A;  5HS8 A;  4PCQ A;  3WU0 A;  5FD6 A;  1OMI A;  3K69 A;  2VBX A;  3HRU A;  4MGR A;  1J59 A;  4DQ2 A;  4R79 A;  3F21 A;  4FX4 A;  3IRQ A;  4IPA A;  2X4H A;  3ECH A;  2EA4 A;  4GGG A;  2FF4 A;  3P9K A;  2PJP A;  2IA1 A;  3I64 A;  1TQI A;  4I2O A;  2BE5 F;  5D8L B;  1R58 A;  1U5T B;  2BYV E;  2QBY B;  2Y0M A;  1R1U A;  1KQ8 A;  1YQA A;  1ZN2 A;  5ICF A;  3I0T A;  1BC8 C;  4NHJ A;  5CVI A;  3ELK A;  1XDS A;  2KJB A;  3FMR A;  2R3S A;  3TDZ C;  4Y13 A;  3I4P A;  5LGU A;  3JSO A;  1QGP A;  1WRJ A;  3J7A O;  1EH8 A;  2A69 F;  1XCV A;  2HKX A;  2KKO A;  2OBP A;  5E1W A;  4KA4 A;  4M71 A;  5D4S A;  1KU2 A;  3EUH A;  1O3Q A;  1K6O A;  4BHC A;  4WXC A;  4EJW A;  1YS7 A;  1ZLJ A;  2YSR A;  5LHH A;  2FOK A;  2RGV A;  3RKW A;  1QZY A;  4L0Y B;  4LB5 A;  4HQM A;  5J8C A;  1BM9 A;  3S2W A;  4CGZ A;  3WGG A;  4U0V A;  1YO5 C;  3QPH A;  1LNW A;  3E6C C;  3HYI A;  4RGX A;  3GFL A;  3R60 A;  4EJT A;  5L3B A;  2HTJ A;  3VOD A;  4LB6 B;  4EGY A;  4KIG A;  3FMQ A;  2UXN A;  3WGI A;  3EYY A;  2CYY A;  4IF4 A;  3IKV A;  2ZME A;  4YFK F;  2JZY A;  2P5L C;  5LLQ A;  3WU1 B;  3O6B B;  1G3Y A;  3QAH A;  1S7O A;  2ZNY A;  1R23 A;  1QO0 D;  5H6Q A;  3WTV C;  3FF5 A;  1A04 A;  3IHU A;  1DPR A;  2PBI A;  5HLH A;  3IWF A;  5AON A;  5BPD A;  5BQT A;  3BWG A;  1Z6T A;  3KP7 A;  1GXQ A;  4ENJ A;  2HS5 A;  4OIN F;  1YFH A;  3KP3 A;  1SMT A;  1IF1 A;  1UCR A;  5K5O A;  4XSZ F;  3J80 K;  1S6L A;  1BJA A;  4YIF A;  3MEX A;  4I0B A;  1SFU A;  2LF8 A;  3GW2 A;  3Q9V A;  3WTW C;  4EM0 B;  4G6Q A;  3KLN A;  1Z6R A;  3TDU C;  4CO8 A;  4M74 A;  2XKP A;  2RV8 A;  1ULY A;  4M73 A;  5ILS A;  4L0Z B;  2NNN A;  1BBY A;  5EEG A;  5EEH A;  2DO7 A;  2ZFW A;  5A2Q K;  4KN7 X;  3I71 A;  2HGC A;  4IRG A;  1ON1 A;  4B8X A;  3BOQ A;  1KYW A;  2PG4 A;  1P92 A;  1F1Z A;  2HZT A;  5K5Q A;  1I1G A;  2QQA A;  5FFZ A;  1SAX A;  3GUD A;  3PQJ A;  5FB2 A;  2A68 F;  3F8B A;  5H20 A;  3WE2 A;  3HSF A;  2D45 A;  4EGZ A;  5FD5 A;  2P6S A;  1TW2 A;  3M9A A;  2EFQ A;  2M45 A;  2QUF A;  1D8J A;  1O3R A;  1P6R A;  3K0L A;  2VOD A;  1XSX A;  1AWC A;  3NEU A;  3KZZ A;  3DV8 A;  4ESB A;  1DDN A;  2VE8 A;  3C18 A;  5JR3 A;  4HBL A;  1QPM A;  2IA0 A;  4G6D A;  1T6S A;  1TBX A;  3QRF F;  2RDP A;  3M1E A;  2M87 A;  5FFX A;  1QBJ A;  3LAJ A;  4I7H A;  3COA C;  4JK1 X;  1H0M A;  4OIQ F;  4K2E A;  2XAQ A;  2KIF A;  4HV5 A;  1I1S A;  2UXX A;  3KZY A;  1OPC A;  4L9J A;  2MH2 A;  1UFM A;  2D1H A;  1XD7 A;  3F23 A;  1XMK A;  4CYD A;  4BXU A;  1RIO H;  3HSR A;  3P9C A;  4M9Z A;  5ILV A;  1WI9 A;  4A0X A;  1TTY A;  1HKT A;  3J80 Z;  2EV6 A;  2W57 A;  3GXO A;  1OR7 A;  1F4K A;  3V7S A;  3ML6 A;  4WXH A;  1STZ A;  3F6O A;  2AS5 F;  4UVA A;  4RS8 A;  4UVB A;  5ICE A;  4R8H A;  1TQP A;  4RAY A;  1ZH5 A;  1EV7 A;  2STT A;  4BHP A;  4HLY A;  2ESN A;  3E6D A;  2XGX A;  1R5H A;  4MTD A;  4YFX F;  2E7W A;  4A2U A;  4LG0 A;  4XSX F;  4Q48 A;  1B9N A;  5DEQ A;  2ISY A;  5HLG A;  3I53 A;  3RPQ A;  4Z2Y A;  4FX0 A;  4G9Y A;  2ZNZ A;  5ILU A;  3TQN A;  2LSO A;  1MZB A;  4Q4Z F;  4LGW A;  1HST A;  2MLG A;  4U7D A;  4WF2 A;  3V4G A;  2DTR A;  1EH6 A;  3R0J A;  2K4J A;  1FNN A;  1L3L A;  1TQM A;  1T39 A;  5L3D A;  1JGS A;  3GWZ A;  2P7C B;  4A5M A;  2OQG A;  3WOD F;  1LEB A;  1B59 A;  1ZG3 A;  3RKX A;  5E8G A;  4PGH A;  2MH9 A;  2P5K A;  2A6E F;  2IJL A;  2TDX A;  1IXC A;  1XGM A;  1F9N A;  1BOA A;  3KET A;  1CGP A;  3DPL C;  5HS9 A;  2LNB A;  4MHG A;  3R61 A;  4LFU A;  4O6J A;  1UHM A;  2L4M A;  2KIM A;  4I02 A;  3GO5 A;  3LA7 A;  4RGU A;  2MC3 A;  1U78 A;  1SD4 A;  1PP7 U;  4QLC U;  2UZK A;  5D5X B;  1ZG5 A;  2EFN A;  2F5C A;  4Q47 A;  3DF8 A;  4IXA A;  3DFG A;  4WCG A;  3LA2 A;  1FWZ A;  4RB0 A;  1ON2 A;  2O8X A;  2PI0 A;  1IRG A;  1LDK B;  3K9T A;  1YLF A;  4AIJ A;  4M72 A;  2HYG D;  1GHC A;  2EFO A;  1R22 A;  1WQ2 A;  2IP2 A;  4CIC A;  1KGS A;  2DQL A;  2VOO A;  3F8M A;  2OAZ A;  2C6Y A;  1Z1D A;  2FBK A;  1IXS B;  1K78 A;  4IHS A;  2GZW A;  1K7A A;  3IKT A;  1HKQ A;  1NHA A;  2CSO A;  4F7Z A;  1RUO A;  3VOE A;  2FSW A;  3RYP A;  1LJ9 A;  3ZMV A;  4EQQ A;  1U8R A;  4I98 B;  4RB3 C;  2H09 A;  4AWX B;  3V8K A;  4E70 A;  2FXA A;  1I6X A;  1QZZ A;  1Z05 A;  5DDG A;  4G7H F;  2XAH A;  2CQK A;  3TO7 A;  1IN4 A;  2IRF G;  2OD5 A;  4MQV A;  2JTV A;  4MQ9 F;  5CVV A;  1OKR A;  2L54 A;  3L7W A;  2XVC A;  3M7G A;  2MA3 A;  3CO7 C;  1I27 A;  4GXO A;  2GXG A;  1OYY A;  4ENK A;  2CFX A;  4HF1 A;  4AIH A;  1Y0U A;  1E17 A;  3FXR A;  3JW4 A;  2K4B A;  2DFI A;  3RI4 A;  1PP8 F;  4U0Y A;  4OMY A;  3R6S A;  3ZMD A;  1YW8 A;  4M9S A;  2BV6 A;  2UWM A;  2ZJ2 A;  3PQK A;  2W84 A;  3MFK A;  4G7Z F;  3KEQ A;  1HKS A;  1RNL A;  5FO5 A;  4A12 A;  3CUQ A;  5DCM B;  1FYK A;  2VOP A;  3P9I A;  1LVA A;  4MEX F;  5K5R A;  2YX4 A;  3RJP A;  3SHF A;  3V7C A;  2V1X A;  4RB2 C;  4DNC A;  1W7P D;  2HFH A;  4OIO F;  3K1M A;  2QQB A;  1B6A A;  3ZQ7 A;  2HEO A;  4EJO A;  1BC7 C;  3CUQ B;  1SFE A;  3FM5 A;  5LEJ A;  1FYL A;  3EDP A;  1MJA A;  3L09 A;  2K27 A;  1PDN C;  1L0O C;  2Z9O A;  2QQ9 A;  1KQ9 A;  2RNJ A;  2P7V B;  5HDN A;  4ENM A;  2O61 A;  2PLY A;  2JPB A;  3GFI A;  2Q8K A;  1R36 A;  4UHT A;  3KEO A;  3ZN0 A;  4CHU A;  1MKM A;  4NQW A;  5LBQ A;  2DPD A;  1T98 A;  3BJA A;  1QNT A;  4OU0 A;  3RTR A;  2BBY A;  1U5T A;  2GA2 A;  1YIO A;  2VXZ A;  2V1U A;  3I59 B;  4YII A;  2EFW A;  3BPV A;  1RI7 A;  6PAX A;  4LK1 F;  2A3S A;  1R1T A;  2JT1 A;  4LLG F;  4A6E A;  1S8N A;  1G3S A;  2DU9 A;  5E8I A;  4JBA A;  4IJA A;  2YX7 A;  4L5I A;  3C7J A;  2AXL A;  3I54 A;  3KP2 A;  3H3Z A;  3DP7 A;  1XCB A;  2A61 A;  3U2R A;  4HZF A;  3DQV C;  4AVP A;  1ZRD A;  3ZPL A;  4FT8 A;  3GFM A;  2XRO A;  2PEX A;  3JAM Z;  4O3M A;  2OZ6 A;  3F22 A;  1FBQ A;  3CTA A;  5ICC A;  1W7P B;  4OIP F;  2VT2 A;  4ZYH A;  3ZMZ A;  4KIC A;  2NYX A;  1BI2 A;  2COM A;  4GO1 A;  2LF7 A;  3RKY A;  4BHB A;  3G3Z A;  2PQ8 A;  4WX9 A;  5LHG A;  4R1H A;  3T1B A;  3GF2 A;  1YTY A;  2GQQ A;  5E18 F;  3M8E A;  2Y75 A;  1SD5 A;  2Z5U A;  1J75 A;  5CJ9 A;  2DK5 A;  4WK8 F;  4LJZ F;  2Z33 A;  4EV0 A;  1XSD A;  1P4X A;  1FP1 D;  3LQQ A;  5AIQ A;  5ED4 A;  5JFR A;  3FMS A;  2EV0 A;  1ZRC A;  3GFJ A;  4IRI A;  2QZ8 A;  3EET A;  2QWW A;  2HTS A;  3IC7 A;  4UUV A;  5K1Y A;  2KIU A;  1FT9 A;  3BJ6 A;  1XDU A;  2YR2 A;  5D4R A;  2CG4 A;  4HV6 A;  5H6R A;  4HYE A;  3E3V A;  4ZYG A;  1O3T A;  3PFI A;  1T2K A;  2DAO A;  5JHU A;  2P6T A;  2K86 A;  4I09 A;  3IWZ A;  1S29 A;  1O3S A;  3K2Z A;  3MAJ A;  1W4M A;  2XAG A;  4D0P A;  1MD0 A;  1LEA A;  1SFX A;  3C1D A;  2P8T A;  2DT5 A;  4S05 A;  1RUN A;  4M6Y A;  2LDU A;  3ROU A;  2ZKZ A;  2CWE A;  2DW4 A;  3QU6 A;  4AD9 A;  1IZ1 A;  2LKP A;  3B02 A;  1KU3 A;  4GCV A;  4A0Z A;  3REO A;  4ASN A;  1FPQ A;  1DUX C;  3SZP A;  3ECO A;  5IT3 A;  3K1N A;  2WWY A;  3SZT A;  4CDG A;  1FX7 A;  4Q5S F;  2JPC A;  3LAP A;  2IW5 A;  3DEU A;  3GZ5 A;  4IHT A;  5CVR A;  4P55 A;  5KVR A;  4BNC A;  3QPT A;  1FZP B;  1W5S A;  1WWX A;  2CGP A;  4UNO A;  5DD8 A;  4EMS A;  1IUY A;  3HTS B;  4HX8 A;  4OMZ A;  4LMY A;  2ESH A;  2J5O A;  3J81 K;  4UV8 A;  4HW0 A;  3FX3 A;  5D5U B;  1R7J A;  1D5V A;  1MJ9 A;  3QP6 A;  3DKW A;  4PDK A;  3F8C A;  4YG2 F;  3CDH A;  1JHH A;  3U1D A;  1R5G A;  4OOI A;  4ZYD A;  1XGO A;  3EQL F;  3T8R A;  5TRD A;  2W85 A;  5L3C A;  1VTN C;  4PGG A;  1P2F A;  4HA8 A;  1ZRE A;  3E6M A;  4IVN A;  1ZAO A;  2OA4 A;  1WKM A;  1FP2 A;  2FA5 A;  1BN5 A;  1X3U A;  2XV4 S;  4I0A A;  2L4A A;  2QLZ A;  5LRS A;  2DI3 A;  1YW9 A;  1I5Z A;  2XIG A;  1KYZ A;  4A6D A;  3QOP A;  4A0Y A;  4HLX A;  4RGS A;  3CLO A;  3LWF A;  1TNT A;  3GVA A;  3H92 A;  2VBY A;  2HQR A;  1P4W A;  3W6J B;  2OQR A;  3RPU A;  1ZLK A;  3Q5F A;  1KQ0 A;  3LA3 A;  2ETH A;  1K78 B;  2L01 A;  2H94 A;  3KFW X;  4RB1 A;  1D8K A;  2Y48 A;  1Z91 A;  2F2E A;  5DV5 A;  1U5T C;  4KN4 X;  2EA2 A;  2A5Y B;  4WXD A;  3GX4 X;  1J2X A;  1YW7 A;  2VBW A;  4HAM A;  3FWE A;  5E1X A;  4KIB A;  1BIA A;  4B09 A;  1TNS A;  3KP5 A;  1DP7 P;  1GVJ A;  2ZCW A;  2E7X A;  3GEZ A;  3ZMT A;  1GXP A;  3ZP5 A;  3WTY C;  3N4M A;  3FZV A;  2M1B A;  3B73 A;  5F1R A;  2X0L A;  1U3E M;  1HBX G;  5IT9 K;  2HYF A;  4HF2 A;  1J9I A;  2O0Y A;  3F72 A;  4L9N A;  1LDJ A;  5J6X A;  4QWQ A;  2FBI A;  4N9H A;  3I58 A;  4ZH4 F;  2E1N A;  5J8F A;  4TV7 A;  3OOP A;  2W24 A;  1FOK A; 
#chains in the Genus database with same CATH topology
 4XKC A;  3HUG A;  3NWS A;  3K4B A;  5CQG A;  3MZH A;  4M9X A;  4RM3 A;  1PUE E;  2OUM A;  3E5X A;  3T8T A;  4CSW A;  1MJB A;  1YG2 A;  3K7A J;  2R0Q C;  5AIP A;  2R7R A;  1C0W A;  5FLV A;  4Z6Y A;  1YJ9 I;  5HLI A;  5LRR A;  2M30 A;  1ZR4 A;  3RYR A;  2NVX J;  3VSK A;  2QKL B;  3FM3 A;  1RET A;  2PMU A;  3Q3S A;  3L9F A;  1VQ4 I;  2KRH A;  3ERE D;  3TO6 A;  4EJU A;  5FKM A;  3RDI A;  4U7B A;  2ACJ A;  2ZB9 A;  2VC0 A;  2VKV A;  4UB8 C;  2CUF A;  4H0E A;  1FC3 A;  2JSP A;  2L02 A;  4D7N A;  2E60 A;  3CF2 A;  3TO9 A;  1HSJ A;  1KZH A;  1E3O C;  2EV5 A;  2H1K A;  2X48 A;  3I3L A;  2F5F A;  3F6V A;  3QQA A;  4XKW A;  2DK8 A;  3BDD A;  5HS7 A;  5M5Y J;  1HW5 A;  1XN7 A;  1U0J A;  5DYM A;  4L9T A;  2ZME B;  3KP6 A;  5FLX K;  5KAF C;  2WV0 A;  1F43 A;  1VF9 A;  2DA3 A;  3OYF A;  2BY2 A;  5KNL A;  4XL9 A;  4BYY A;  3N05 A;  2FMY A;  2H27 A;  1D0Z A;  1KU7 A;  4ENN A;  1TWC J;  1P7J A;  1IN8 A;  2O03 A;  3DCF A;  3JAM K;  4IHW A;  2H6C A;  3CES A;  3MWM A;  3LFK A;  4W1U A;  3V8L A;  4RGR A;  4U88 A;  2VQC A;  1HW1 A;  3L00 A;  4BXF A;  3CLQ A;  4Y33 A;  5TIS C;  3A1Y A;  3OS1 A;  3BRO A;  2DPU A;  1QU3 A;  3H1C A;  3E5U A;  1WJA A;  3C2H A;  1W7P A;  5IP7 J;  2H6B A;  2QGU A;  3LSG A;  5LHI A;  2F5E A;  2RVC A;  2UUZ A;  3CME I;  3S1R J;  5LGT A;  2CMP A;  3CD6 I;  1V4R A;  5FRO A;  3IUO A;  3TKY A;  4M3D A;  2IT0 A;  3V42 A;  3LNQ A;  4NB5 A;  3FHZ A;  1AU7 A;  3GTK J;  3HRT A;  2E2H J;  3CMM A;  2IVM A;  4N0B A;  1ODD A;  5FRN A;  1E3P A;  2LLK A;  5E20 A;  3TOA A;  3WTU C;  3HOV J;  1AOY A;  3PSI A;  4EM1 A;  1SD6 A;  2EIJ H;  3S3N A;  3D0S A;  3QWL A;  1G6N A;  1XGS A;  3V7R A;  3WU2 C;  1A5J A;  4KIS A;  3ZMS A;  3H9Q A;  3NQO A;  5D5W B;  1AKH A;  1SMY F;  4GYI A;  3VYS B;  4F52 A;  2BY0 A;  2P0W A;  3CDI A;  2DFF A;  2BVL A;  2XRL A;  3E6B A;  4ITV A;  3M07 A;  1MMD A;  1OYI A;  2NAZ A;  4DYC A;  3VEP A;  3ULQ B;  1R49 A;  3HOT A;  3K4M A;  5K7F A;  2ZSH B;  4L9V A;  5CVJ A;  4DGW B;  1CF7 B;  3HRS A;  4S04 A;  4G6T B;  3V8J A;  2E71 A;  5F04 A;  1OCT C;  2QBY A;  3U9G A;  1TLH B;  2DA4 A;  1B1B A;  1B4A A;  4YEL A;  2K7L A;  1VQL I;  4HQE A;  1OR7 C;  3OMY A;  4KYW A;  3M8J A;  1LKX A;  4GYG A;  2FBH A;  2FUG 2;  2STW A;  1V3F A;  2CU7 A;  2Q1Z B;  4PJJ A;  2QSG X;  2DXI A;  4KIF A;  3HOY J;  4N9I A;  2XUB A;  2WTE A;  1ETX A;  4V2G A;  4HDV A;  1O7F A;  4E7H A;  2VT3 A;  4EVI A;  3OV8 A;  3CZ6 A;  3L1P A;  3PFY A;  2RC4 A;  3HL2 A;  1ETY A;  2X1D A;  1FLI A;  1FSH A;  2V9V A;  2HKO A;  2DLL A;  2QQ8 A;  1Y56 A;  2EWN A;  1W5T A;  4UV9 A;  4RA2 A;  1WSU A;  5CKT A;  2E19 A;  1TWG J;  3FXM A;  4LLN A;  1S3J A;  2BEO A;  2WAQ A;  2KP6 A;  1BIB A;  1BI0 A;  5F1J A;  5ICG A;  2R7D A;  2W25 A;  4IX7 A;  2HDC A;  2M7B A;  1AKH B;  3ISP A;  5IPA A;  4G8X A;  5JLW A;  1O4X A;  4HSR A;  2V6C A;  4D9J A;  1SD7 A;  1X4O A;  4XLP F;  4NC7 A;  3RSN A;  2FRH A;  1IW7 F;  4B44 A;  3D5L A;  2HQN A;  4CA0 A;  3ERM A;  3JRH A;  1NG6 A;  1JJ8 C;  2P4W A;  4PSW A;  2I8D A;  4B48 A;  3CC4 I;  3HDD A;  3H5A A;  1UG0 A;  1D1B A;  5JVT A;  1S7A A;  2M0C A;  4BQO A;  1UAA A;  1G3T A;  4FHT A;  2EB7 A;  3K4C A;  3SQN A;  1MND A;  4ZYA A;  1VQK I;  1USS A;  3CO6 C;  2G7U A;  3ABT A;  1SVM A;  3G2B A;  2VC1 A;  4QSH A;  1Y8Q B;  3QPS A;  3OYB A;  1PUF A;  1BR2 A;  5HDG A;  1UZC A;  4KT5 C;  5J47 A;  2LOO A;  4ESF A;  2ZJR F;  5D5V B;  2XAJ A;  2LY2 A;  3FHN A;  1R1V A;  4LG0 B;  5DCM A;  2A6H F;  1SVO A;  2GBY A;  3HM5 A;  4Y52 J;  3AG3 H;  5DD4 A;  2A07 F;  3S2D J;  3W6K B;  4F93 B;  1P9Q C;  3ZN1 A;  2HU9 A;  1WVR A;  1Z67 A;  4P96 A;  2ELK A;  5CLS A;  1BOB A;  3GBG A;  3WTT C;  1GT0 C;  3SFZ A;  1R5I D;  3HPG A;  4WWC A;  1JE8 A;  4FQG A;  3E97 A;  2ZSI B;  4M6X A;  1D0X A;  3H35 A;  4M3B A;  2KQR A;  4NNJ A;  3VFZ A;  1O57 A;  4QTR A;  2F4O B;  4UUT A;  4A5N A;  2NXN B;  4KUM A;  5LGN A;  2V79 A;  1IRF A;  2DBB A;  1U2W A;  4BE2 A;  1VQ6 I;  5DM7 F;  3F8N A;  4RMN A;  4Y7N J;  2DA6 A;  3E5Q A;  1Z7U A;  2XAF A;  1QPI A;  2D1V A;  3O2P E;  1KA8 A;  2R92 J;  1X1C A;  1VQM I;  2GOX B;  3K4N A;  4LLL A;  2VB6 A;  4EM2 A;  1W5C C;  4IRH A;  1X3W B;  2VIX A;  1XX5 A;  5B66 C;  1XSV A;  4FET A;  3HOW J;  3F8F A;  3FXQ A;  3OYD A;  3BP8 A;  2COB A;  2BGC A;  2X6W A;  2XHK A;  2YU9 J;  2XKO A;  3HHH A;  3KCC A;  3WTS C;  3CMA I;  2F5D A;  3I59 A;  4HX7 A;  1P4A A;  1Z9C A;  3HSE A;  4I6Z A;  4N4O B;  4HRI A;  3ZMU A;  5B1B H;  2WA0 A;  1IN5 A;  2Z99 A;  1D5Y A;  4U87 A;  4A69 C;  3ESW B;  4HDU A;  2Z3Y A;  5CYV A;  3J7Z I;  3DLA A;  1RZ4 A;  2YU3 A;  3ZQG A;  3FBN B;  2K9Q A;  2IEK A;  3SZG A;  5F64 A;  1NK3 P;  1LQ1 A;  3JR9 A;  2HZD A;  3GZ6 A;  2MD5 A;  2Z16 A;  4I01 A;  3QYB A;  4LD5 A;  5E1Z B;  4BEH B;  3HUG B;  1YJW I;  3L2V A;  2LRD A;  4DOZ A;  2M34 A;  5C4X J;  4Y17 A;  2PN6 A;  1T0F A;  1XGN A;  5DTD A;  3JTH A;  1T33 A;  3MQ0 A;  4KFC A;  2VJ5 A;  4PFP A;  2FNP A;  2IPQ X;  4HOB A;  2DT6 A;  1Y39 A;  2M5W A;  2WAD A;  5E17 F;  4HX4 A;  3A01 A;  1EH7 A;  2GXB A;  4M6V A;  1UEL B;  3PO3 J;  1LFP A;  1FY7 A;  3KX2 A;  2OF7 A;  3H3U A;  1HXD A;  4E7K A;  3M8F A;  2KJC A;  4Y15 A;  1UB9 A;  3OYN A;  2EK5 A;  5F0F A;  3IL2 A;  3AL0 C;  2DA5 A;  4IL6 C;  3K1P A;  3CDL A;  2QVO A;  1ZHF A;  2ID3 A;  3HOS A;  3QYE A;  4X6A J;  1F5T A;  3ABU A;  3WG9 A;  1BI3 A;  2FU4 A;  2I5U A;  1HW2 A;  1REP C;  1DU6 A;  1J09 A;  3DTE A;  3IP4 B;  3VWB A;  4MTE A;  4BH9 A;  1SFO J;  1IN6 A;  1ZYR F;  3DXJ F;  2HVS A;  1T95 A;  4XBF A;  2R7W A;  1YRN B;  3WTZ A;  4E4H A;  4M3G A;  2ICW G;  3IRR A;  1O7L A;  3B6C A;  2FX0 A;  5FGM A;  4II3 A;  5IYB J;  2E1C A;  4MNU A;  4P9F A;  5EZH A;  2E2I J;  5GTH C;  2A5W A;  3I5U A;  2XGD A;  3BQZ A;  2LBF A;  2R7F A;  1HDP A;  1ZGJ A;  2VBZ A;  1WCM J;  1XB4 A;  3VB2 A;  3A03 A;  3BY6 A;  3LMM A;  3NRV A;  5F6F A;  3HOZ J;  3DBH B;  2KHM A;  3P7N A;  2GAU A;  3GYH X;  1PYV A;  4AIK A;  2GIV A;  3EYI A;  2NVQ J;  4QIW N;  3MKL A;  5BS6 A;  3QP5 A;  3QU3 A;  3OIO A;  4ZZD A;  4L5J A;  3CUO A;  2P5V A;  1U6G A;  2JA6 J;  4QPO A;  2XPW A;  1DP3 A;  2ZXH A;  3KE2 A;  4B1R A;  3HG9 A;  1R00 A;  3OR1 C;  4O5V A;  5HOO A;  1K79 A;  4HF0 A;  3IH2 A;  3OYI A;  1X2N A;  4E7S A;  3BZ6 A;  1A36 A;  3H5N A;  3BPX A;  3S16 J;  1H89 C;  2MBF A;  4AU7 A;  2LTP A;  5IT9 Z;  4ZYE A;  2R7X A;  2LFB A;  3HHG A;  4IKF A;  2KZV A;  2W00 A;  4LIT A;  4BEH A;  1IN7 A;  2V1D A;  3GLX A;  3I4N J;  1JXS A;  2DYR H;  2JA7 J;  2MYS A;  2X6Y A;  2BOL A;  1H9G A;  1ORK A;  1D3Y A;  1I39 A;  1MH3 A;  4XRF A;  4BBR J;  3L2C A;  5J1U A;  1IAW A;  5KK1 A;  2Y69 H;  5DCF A;  2PMZ A;  2X6O A;  3VSL A;  2ZBK A;  2H8R A;  4BAY A;  3KP4 A;  2RKH A;  2IGK A;  1IXR C;  2ELJ A;  2CUJ A;  2F4M B;  3AAF A;  4XRS G;  3GTL J;  2M8E A;  3HGG A;  5GPC A;  5BMZ A;  1IDZ A;  3TGN A;  3LQR A;  2L5Q A;  5BOX A;  2YPR A;  4BUP A;  3FXU A;  4EAT A;  3HIF A;  2AQF A;  5C44 J;  2D2W A;  3ZOB A;  2B7E A;  1FOY A;  2GWR A;  1I3Q J;  2M4K A;  3LST A;  1ZRF A;  2ISZ A;  2ELH A;  3GZN B;  2IA2 A;  2DYS H;  2HR3 A;  2OU2 A;  1S9H A;  5L3F A;  3FDY A;  2DFH A;  2XRN A;  1QQI A;  3DKY A;  5JI6 A;  1FBS A;  1J5Y A;  3LSP A;  1UHW A;  3IAM 2;  3BLY A;  3OSF A;  3FK7 A;  1HQC A;  2HPI A;  5JVG F;  2VI6 A;  3TED A;  2WV1 A;  1VQ7 I;  1A31 A;  2K02 A;  1T08 B;  2HQ5 A;  4P5O A;  5JLX A;  2FE3 A;  5DUK A;  3TOB A;  2R5Y B;  4XOT A;  2KMU A;  1ZGA A;  2EJR A;  4C3I J;  4CXF A;  2VJJ A;  2QEX I;  1YYV A;  3R0A A;  1ZG1 A;  1LFB A;  2HI3 A;  4LK0 F;  3G73 A;  1OYW A;  4JYK A;  2L7F P;  2V7F A;  1WH7 A;  5EGO A;  1YS6 A;  1LB2 A;  2CW7 A;  1B9M A;  1JT0 A;  3BC8 A;  2OC6 A;  3IH3 A;  2CW0 F;  4XMY A;  4JQF A;  2JMW A;  1ONV A;  4Y3O A;  2WC2 A;  2PMH A;  4ZZL A;  1YIJ I;  3FIS A;  2H1L A;  4PJL A;  5F0C A;  4CUG A;  3F3X A;  5E3L A;  1J7K A;  2R5Z B;  1WGX A;  2KRF A;  1J0R A;  4CH7 A;  4XLC A;  3GCM A;  2M3A A;  2QYO A;  3CMY A;  3FXL A;  4AC0 A;  1Y8R B;  3DPT A;  5B1A H;  2XAS A;  5DUI A;  1Z21 A;  2Y2Z A;  1APL C;  3JCU C;  2X6X A;  5D8K B;  1IRX A;  3CJN A;  2V9K A;  3S3M A;  2IGN A;  2VON A;  3PNY A;  1UST A;  3HXL A;  2XC7 A;  3C3W A;  4B4C A;  4XQF A;  1BI1 A;  1ETK A;  2ZXJ A;  2OZU A;  3H0D A;  4GRI A;  3BR2 A;  1JKQ C;  2RQP A;  4ON0 A;  2JRT A;  2KRC A;  3WE3 A;  3EUK L;  4AVZ A;  5HVQ C;  2FML A;  4U0W A;  3JSP A;  3T5X A;  1BR4 A;  3KYC B;  1XMA A;  1WH5 A;  1MNM C;  3R4K A;  4D7M A;  5BPI A;  4KMU X;  3DBL B;  1GLN A;  1ZAR A;  2L9N A;  3O3K A;  3HTU A;  4G94 A;  2LVS A;  4L5E A;  1V55 H;  4ZDP A;  3HKZ N;  2GA1 A;  2W48 A;  2VQH A;  2AO9 A;  5A2Q Z;  2OJE D;  3L2Q A;  2QM3 A;  1QHH D;  2BZT A;  2FNA A;  1K6Y A;  1FBU A;  2VN2 A;  2EIK H;  2NS0 A;  4MEY F;  1Q1H A;  4NC6 A;  2DA1 A;  2EBI A;  4BE0 A;  3QYF A;  4EJV A;  2LRE A;  1IG7 A;  4XM3 A;  2B0L A;  5LEK A;  3MKY B;  1E2X A;  1F36 A;  2ZO4 A;  3HJE A;  5D6E A;  4CYC B;  4IOA F;  3T0Y A;  2XF5 A;  3TW6 A;  2Z1D A;  3KYD B;  3Q9S A;  1XC5 A;  3LSI A;  2J5P A;  2W82 A;  5ERI A;  4L18 B;  1FJL A;  3WTX C;  2NVT J;  3ZQQ A;  2HDD A;  1Z7L A;  2O3F A;  2WY7 Q;  3OYJ A;  4ESJ A;  3TW7 A;  1SAU A;  1G3W A;  3BJO A;  5M5X J;  1FSE A;  2LH9 A;  4A3B J;  3PIP F;  5L3G A;  5HDK A;  3G1O A;  2Q2E A;  1CF7 A;  1DPU A;  3OYM A;  3MN2 A;  2PFB A;  1AHD P;  3CUQ C;  5D6F A;  1FYM A;  2HOE A;  2JUG A;  4P9U A;  4BQA A;  5H2F C;  3H3V K;  3N97 A;  3RIR A;  1ZK8 A;  4XK4 A;  3CCU I;  2R7O A;  4OIR F;  4UUS A;  1YHQ I;  2IBD A;  1QRY A;  2RN7 A;  3ABL H;  3KEY A;  4RAZ A;  3MZY A;  3SXY A;  5FKK A;  3WGH A;  4NDL A;  1MDM A;  2Q0O A;  2JVH A;  3HRM A;  4ETS A;  1JHF A;  3LFU A;  1GUU A;  4PZJ A;  2CO5 A;  5L3E A;  1ETO A;  1W0U A;  1ACI A;  4RBO A;  2QEN A;  2A6T A;  1LUJ B;  5IOZ A;  2VE9 A;  2L3D A;  2ID6 A;  2NRA C;  1QZE A;  2EFP A;  2O6G E;  2XF6 A;  1TZL A;  2DMQ A;  2R5Z A;  1A6Q A;  1OCP A;  5CVU A;  4KMF A;  2G7H A;  4DZJ A;  1LDD A;  1VQ5 I;  3MCZ A;  2FD5 A;  2FQ3 A;  2HWV A;  3H5R A;  2W1O A;  3BCA A;  4YFN F;  1T38 A;  4KDP A;  4CZZ A;  1IO2 A;  1KU9 A;  3OYG A;  2E34 A;  1G4D A;  2FEZ A;  3FIW A;  2EZL A;  1WZ2 A;  5GP9 A;  1TW3 A;  1TC3 C;  4MIM A;  3CJQ B;  2CQN A;  5FLX Z;  2MAB A;  3D1N I;  1WJE A;  3PM1 A;  4DBQ A;  3SEZ A;  1MDM B;  2E1M B;  4UXN A;  2G9W A;  1B72 B;  1E3H A;  5M3F J;  4XLN F;  1Z3X A;  2FOW A;  3KLO A;  1WHU A;  2DQR A;  2MLK A;  4UVC A;  2K3F A;  4KNY A;  5TJJ A;  2ADU A;  2NNY A;  4A93 J;  1H9T A;  3J81 Z;  1MGT A;  2JSC A;  2YUS A;  3D5S C;  4CCO A;  4G7O F;  3JTG A;  2LG4 A;  2K9N A;  5HS8 A;  4PCQ A;  1MMS A;  1ITY A;  3I55 I;  3CQZ J;  3WU0 A;  5FD6 A;  1YOV B;  1OMI A;  3H36 A;  1GV5 A;  2M8G X;  2MG4 A;  3MKW B;  1YI2 I;  1X58 A;  3K69 A;  1Y1V J;  5F08 A;  3OSG A;  3AKZ A;  2VBX A;  1RR7 A;  3HRU A;  4MGR A;  3FKI J;  5BNG A;  1J59 A;  1Z0X A;  4OAY A;  4DQ2 A;  4R79 A;  3CC2 I;  3F21 A;  3EUH C;  4FX4 A;  3RZO J;  3IRQ A;  1FIA A;  4XOR A;  4IPA A;  2X4H A;  1G59 A;  3ECH A;  2EA4 A;  4GGG A;  2FF4 A;  3P9K A;  4F55 A;  4DJA A;  2PJP A;  2XSD C;  1MBG A;  1X19 A;  2DDA A;  2IA1 A;  3I64 A;  1FTZ A;  4PJ0 C;  1TQI A;  2DA2 A;  4I2O A;  4NUB A;  1HCR A;  2BE5 F;  5D8L B;  3H9J A;  1R58 A;  1U5T B;  2BYV E;  2LKS A;  3F9K A;  3G71 I;  2QBY B;  3F0C A;  1MW7 A;  4PSX A;  2Y0M A;  3I4M J;  2M9H A;  1BL0 A;  4LIU A;  2EQR A;  1R1U A;  2BVM A;  1ERD A;  2JA2 A;  1YQA A;  1KQ8 A;  1ZN2 A;  5ICF A;  3I0T A;  1BC8 C;  4V19 K;  3C2G A;  4NHJ A;  5KCM A;  5CVI A;  1VQ9 I;  3A02 A;  3ELK A;  1S7E A;  1XDS A;  2KJB A;  3FMR A;  2IS2 A;  2R3S A;  1Q1V A;  3TDZ C;  3VYU B;  4Y13 A;  3I4P A;  5LGU A;  3JSO A;  1QGP A;  1WRJ A;  3J7A O;  4FE4 A;  3OYH A;  1GV2 A;  1EH8 A;  2A69 F;  1XCV A;  3IV5 A;  3BG6 A;  2HKX A;  1ZKG A;  2KKO A;  2OBP A;  4RAF A;  5E1W A;  4XKB A;  3ZQI A;  4KA4 A;  4M71 A;  5D4S A;  1KU2 A;  1Y0N A;  2LK2 A;  1QVU A;  1WJB A;  3EUH A;  1O3Q A;  1K6O A;  4BHC A;  4WXC A;  2L2O A;  2OTL I;  4EJW A;  1YS7 A;  1ZLJ A;  2YSR A;  5LHH A;  2FOK A;  4BE1 A;  2RGV A;  3RKW A;  1QZY A;  3DU6 A;  2KL4 A;  4L0Y B;  4LB5 A;  4HQM A;  5J8C A;  1BM9 A;  3S2W A;  5KHD A;  4QPQ A;  4CGZ A;  3KYL A;  2KIQ A;  1XS9 A;  3WGG A;  4U0V A;  1MBE A;  2R7Z J;  1YO5 C;  3QPH A;  1LNW A;  3E6C C;  3I56 I;  5J3L A;  3HYI A;  4RGX A;  3GFL A;  4IHX A;  3R60 A;  4CZC A;  1TWA J;  2EPF A;  4HNV A;  3JRG A;  1QVT A;  4EJT A;  1UJ8 A;  5L3B A;  5C3E J;  2HTJ A;  3VOD A;  4LB6 B;  1RC9 A;  2XPV A;  4AID A;  2R5Y A;  4NBQ A;  1OCC H;  4EGY A;  4KIG A;  2RQQ A;  2CJJ A;  3FMQ A;  2UXN A;  3WGI A;  3VDX A;  4RM2 A;  5EEA A;  3EYY A;  2CYY A;  4IF4 A;  3FXJ A;  3IKV A;  3HBL A;  3ZQL A;  2WY8 Q;  2ZME A;  4YFK F;  1LPQ A;  2JZY A;  2P5L C;  5LLQ A;  3WU1 B;  3O6B B;  2QA4 I;  1G3Y A;  4HNT A;  3QAH A;  1S7O A;  2ZNY A;  5HLT A;  1OQY A;  5M5W J;  1VND A;  1D1A A;  1R23 A;  4BKX A;  1QO0 D;  5H6Q A;  1JT6 A;  3WTV C;  3FF5 A;  2WAE A;  4D5F A;  1A04 A;  3IHU A;  1IRZ A;  1DPR A;  1G8X A;  2PBI A;  5HLH A;  1W36 C;  3IWF A;  1TL8 A;  2V26 A;  3OL4 A;  5AON A;  1POG A;  4CCM A;  5BPD A;  5BQT A;  5FLM J;  3BWG A;  1Z6T A;  3KP7 A;  1GXQ A;  4ENJ A;  2HS5 A;  2XB0 X;  4OIN F;  4XON A;  4AUX A;  1YFH A;  2CV1 A;  4G12 A;  1OCR H;  3KP3 A;  1SMT A;  1IF1 A;  1UCR A;  2E2J J;  2MFZ A;  5K5O A;  4XSZ F;  1MBH A;  3J80 K;  3QOE A;  1S6L A;  1BJA A;  4YIF A;  4MLO A;  3MEX A;  3BG3 A;  1PVE A;  4J19 A;  2MC4 A;  3G1L A;  2LF8 A;  3Q0V A;  4I0B A;  1SFU A;  2VKE A;  4A3E J;  1MMN A;  2VXD A;  3GW2 A;  3Q9V A;  3WTW C;  2QF7 A;  3IH4 A;  3WG7 H;  4EM0 B;  4G6Q A;  3BR0 A;  4LG3 A;  3TMO A;  3JRF A;  1FIP A;  3UNG C;  3KLN A;  3X2Q H;  1Z6R A;  3TDU C;  4CO8 A;  3JRC A;  4M74 A;  3OYL A;  2XKP A;  2R7T A;  2RV8 A;  3ABM H;  3CJT B;  1ULY A;  2HOS A;  1MMG A;  2TCT A;  1IGN A;  2L0K A;  4M73 A;  3BQY A;  5ILS A;  5DS9 A;  4L0Z B;  4A3M J;  1JTY A;  1BBY A;  2NNN A;  1ENH A;  5EEG A;  1I6H J;  5EEH A;  3A2K A;  2DO7 A;  2PX9 A;  2ZFW A;  3DWL E;  5A2Q K;  4KN7 X;  3E0J B;  2HGC A;  3I71 A;  3OYK A;  4IRG A;  1ON1 A;  2CQQ A;  1ZEL A;  4B8X A;  2JN6 A;  2XGE A;  4B3A A;  1P7I A;  3BOQ A;  3TBI A;  3PIO F;  1KYW A;  1S5L C;  4FCY A;  2PG4 A;  1P92 A;  1OCZ H;  2OCC H;  1F1Z A;  1MBF A;  1VFC A;  2HZT A;  1I1G A;  2QQA A;  5FFZ A;  5K5Q A;  3GTJ J;  1EJ9 A;  2ZJQ F;  2VPL A;  4C2U A;  3DBR B;  1SAX A;  3GUD A;  3PQJ A;  2KZG A;  1FMV A;  5FB2 A;  2A68 F;  3F8B A;  5H20 A;  3WE2 A;  3HSF A;  3QPL A;  1Y6I A;  1W0T A;  1K83 J;  5EF6 A;  2D45 A;  4EGZ A;  5FD5 A;  1V5F A;  2AHQ A;  1MBK A;  4A3I J;  1BJZ A;  2P6S A;  1TW2 A;  3M9A A;  2EFQ A;  1Z3Y A;  2M45 A;  2QUF A;  1A35 A;  1D8J A;  1O3R A;  1P6R A;  3AFH A;  3K0L A;  2EZI A;  2VOD A;  3CF5 F;  1XSX A;  2W7N A;  4BXX J;  4IEJ A;  1X1D A;  1AWC A;  3NEU A;  3NWT A;  1TWF J;  3KZZ A;  3C2B A;  3W2W A;  4BJ6 C;  4II2 A;  2L9R A;  3H9G A;  3DV8 A;  2XB5 A;  3L2W A;  3PNV A;  4ESB A;  1DDN A;  2HVR A;  3ZR8 X;  2WB1 N;  3U1K A;  5FJ8 J;  4BGD A;  2EIM H;  1HDD C;  1EKE A;  2VE8 A;  3C18 A;  5JR3 A;  3OYC A;  4F91 B;  4HBL A;  3O8H A;  4C2M J;  5B3S H;  1QPM A;  4I76 A;  2IA0 A;  2XF7 A;  3S15 J;  3ONQ A;  4G6D A;  2TRT A;  1T6S A;  1TBX A;  4RAG A;  2HDW A;  3QRF F;  1HOM A;  2RDP A;  3M1E A;  1U9O A;  2HXI A;  2DMT A;  2L9S A;  2M87 A;  1D0Y A;  5FFX A;  4JX6 A;  1QBJ A;  3SYT A;  3LAJ A;  4I7H A;  3HPH A;  3COA C;  4JK1 X;  1H0M A;  4OIQ F;  4K2E A;  2DJI A;  2XAQ A;  2KIF A;  1Y1W J;  4HV5 A;  1I1S A;  1T0F C;  2KDO A;  3BG7 A;  2UXX A;  3KZY A;  1OPC A;  4L9J A;  2MH2 A;  1UFM A;  2D1H A;  1XD7 A;  2HYJ A;  1LVK A;  3F23 A;  1XMK A;  1DGW Y;  4BDZ A;  4CYD A;  1NK2 P;  4BXU A;  1RIO H;  3AG4 H;  3HSR A;  3JRB A;  3P9C A;  4M9Z A;  2M7A A;  5ILV A;  1WI9 A;  1JTX A;  4XNF A;  2LY9 A;  4DW6 A;  4A0X A;  1TTY A;  2VL8 A;  1HKT A;  3CP2 A;  3BTL A;  2V9P A;  4OAZ A;  3J80 Z;  2EV6 A;  2W57 A;  1WI3 A;  3GXO A;  3L2R A;  1OR7 A;  2EZK A;  1F4K A;  3V7S A;  3ML6 A;  1UG2 A;  4WXH A;  1STZ A;  2WAQ N;  3F6O A;  2AS5 F;  4UVA A;  4RS8 A;  1N78 A;  4W97 A;  5F0H A;  1W1W E;  3QOD A;  4UVB A;  5ICE A;  4R8H A;  1TQP A;  3GTP J;  4RAY A;  1ZH5 A;  3NAR A;  1EV7 A;  3S17 J;  2L7M P;  1NH3 A;  4BHP A;  2STT A;  4HLY A;  2Y31 A;  2ESN A;  2MW8 A;  4IO9 F;  3JRD A;  4XLE A;  3E6D A;  4J00 A;  1HF0 A;  2XGX A;  4PJN A;  4BBS J;  3BR5 A;  1R5H A;  2JWT A;  1MNE A;  3M1C A;  3AG2 H;  4MTD A;  2ZXI A;  3OOU A;  3BG9 A;  4YFX F;  3DU5 A;  2E7W A;  2K9L A;  3IAS 2;  3ZXS A;  4A2U A;  4LG0 A;  4XSX F;  4Q48 A;  1B9N A;  2K9M A;  3AG1 H;  5DEQ A;  2ISY A;  5HLG A;  2GM4 A;  1X1B A;  3H0G J;  3W6V A;  3I53 A;  1MBJ A;  1ZTR A;  4Z2Y A;  3RPQ A;  4FX0 A;  2JRM A;  4G9Y A;  2ZNZ A;  5ILU A;  4AM3 A;  3TQN A;  2LSO A;  1MZB A;  2YS9 A;  3CCQ I;  4Q4Z F;  1X3Z B;  1JKP C;  4MO7 A;  3G6E I;  2LC2 A;  3G1M A;  5GAD J;  4LGW A;  3HEF A;  1HST A;  2MLG A;  2ME0 A;  4U7D A;  4WF2 A;  2Q2E B;  1U8B A;  2RRE A;  1MMA A;  3V4G A;  2DTR A;  2K85 A;  1EH6 A;  3R0J A;  2K4J A;  5J4Y A;  1FNN A;  1L3L A;  1ETQ A;  2QSH X;  1TQM A;  2V4J C;  4M3E A;  4UB6 C;  3GTM J;  1JGG A;  1T39 A;  5L3D A;  1OLT A;  1JGS A;  3VPR A;  2DMN A;  4CYC A;  4A3F J;  3GWZ A;  1ETV A;  1JUM A;  2P7C B;  4A5M A;  3BT9 A;  2OQG A;  3WOD F;  1LEB A;  1B59 A;  1ZG3 A;  1H8A C;  3RKX A;  3MZ8 A;  5E8G A;  4PGH A;  5GPA A;  3G4S I;  4PUS A;  3RZD J;  2MH9 A;  2P5K A;  4BDY A;  4FTH A;  2A6E F;  2IJL A;  2TDX A;  1V5E A;  4HST A;  2PJR A;  4DBR A;  1IXC A;  2IXS A;  1XGM A;  1F9N A;  1BOA A;  3LSJ A;  3KET A;  3DKX A;  1QHG A;  4F3Q A;  1CGP A;  3LSR A;  1MSE C;  3DPL C;  5EZG A;  2KPM A;  5HS9 A;  2LNB A;  4MHG A;  3R61 A;  4LFU A;  4O6J A;  1UHM A;  4A3J J;  2DA7 A;  2L4M A;  4F92 B;  2KIM A;  1HLV A;  4I02 A;  2EIL H;  2L7Z A;  3GO5 A;  3LA7 A;  4RGU A;  2MC3 A;  1U78 A;  3DLL F;  1SD4 A;  4X0G A;  2L7K A;  1PP7 U;  2HOT A;  4QLC U;  2UZK A;  5EYR A;  1NG7 A;  2EH3 A;  2Y30 A;  1SVL A;  3A0B C;  1B8I B;  3U21 A;  5D5X B;  1ZG5 A;  3HOU J;  2EFN A;  1TT5 B;  2B9S A;  4BS9 A;  4B3X A;  4FIS A;  1DGR M;  2KIS A;  3O8G A;  5JHF A;  2F5C A;  4Q47 A;  3OY9 A;  2Y9Z A;  3DF8 A;  4IXA A;  3DFG A;  2DOF A;  1A6I A;  4WCG A;  9ANT A;  3LA2 A;  4BQQ A;  1FWZ A;  1YX5 A;  3BR3 A;  2IAI A;  4RB0 A;  1RR8 C;  1ON2 A;  2MGQ A;  2O8X A;  2PI0 A;  3OR2 C;  1IRG A;  1LDK B;  1YRN A;  1NTC A;  3K9T A;  1DU0 A;  4DYQ A;  1YLF A;  4AIJ A;  4M72 A;  1IJW C;  4A3D J;  1Z77 A;  2BW3 A;  4Y4R A;  4ANJ A;  2HYG D;  2LD5 A;  5TGT A;  1GHC A;  4XN3 A;  1UHS A;  1R22 A;  1WQ2 A;  2EFO A;  2CS3 A;  2IP2 A;  5FKL A;  3W3C A;  4CIC A;  2O9L A;  1KGS A;  2DQL A;  3FXK A;  2VKH A;  3BR6 A;  2VOO A;  5EGO B;  1M1E B;  3F8M A;  3FK6 A;  2OAZ A;  2C6Y A;  2R7Q A;  1Z1D A;  3RQ4 A;  2FBK A;  1IXS B;  1K78 A;  4IHS A;  4OWR B;  4A3G J;  2GZW A;  1K7A A;  1WJ5 A;  2DTZ A;  3IKT A;  1HKQ A;  2R7U A;  3DPU A;  1NHA A;  2CSO A;  1YJN I;  4XIC A;  1BW6 A;  2FQ4 A;  3PNT A;  2R7S A;  2ME6 A;  4F7Z A;  3S93 A;  3CCR I;  1RUO A;  1XTA A;  3CC7 I;  3SDG A;  3AL0 B;  3VOE A;  3SDB A;  2HQA A;  2OPT A;  2FSW A;  3RYP A;  2WAF A;  1LJ9 A;  3ZMV A;  1VQP I;  1XG1 A;  4EQQ A;  1U8R A;  4I98 B;  4RB3 C;  2H09 A;  2NVU B;  4AWX B;  2EZH A;  1LE8 B;  3V8K A;  4E70 A;  2FXA A;  1I6X A;  1W36 D;  3ZQF A;  2VLA A;  1QZZ A;  1Z05 A;  2VKD A;  5DDG A;  5E79 C;  3K4K A;  4G7H F;  2XAH A;  2CQK A;  3TO7 A;  5K7Z A;  1IN4 A;  3BTJ A;  3PL8 A;  1S72 I;  2IRF G;  2OD5 A;  4MQV A;  2Z2S B;  2JTV A;  4MQ9 F;  5CQE A;  4JOM A;  4XLH A;  5CVV A;  1OKR A;  2L54 A;  3L7W A;  1TT0 A;  4CCK A;  1TWH J;  2XVC A;  2IGM A;  2QSF X;  3M7G A;  5IYD J;  3OYE A;  2I10 A;  4HNU A;  2MA3 A;  4CCN A;  1I27 A;  3CO7 C;  2B63 J;  2EIN H;  3GLL A;  4GXO A;  2VJI A;  2GXG A;  5FRM A;  4C3H J;  1OYY A;  4ENK A;  4V2F A;  2CFX A;  2V6E A;  3A0H C;  2JA5 J;  1IUF A;  2FJ1 A;  1OIS A;  4FAS D;  5IP9 J;  5C4J J;  3S32 A;  3ZQC A;  2PMZ N;  3PO2 J;  4HF1 A;  4AIH A;  2K3P A;  1Y0U A;  2MSY A;  1TP4 A;  2F6C A;  2K40 A;  1E17 A;  1MH4 A;  3FXR A;  1LE8 A;  1XMX A;  1V5G A;  3JW4 A;  2K4B A;  4C3J J;  4E7Z A;  2ECC A;  4BL0 B;  1T8I A;  1QA6 A;  2DFI A;  3RI4 A;  2ZXW H;  1PP8 F;  5LD2 C;  4U0Y A;  4OMY A;  3R6S A;  3ZMD A;  3DEW A;  1YW8 A;  4M9S A;  2BV6 A;  3L2U A;  2X9D A;  5DM6 F;  2UWM A;  1K4S A;  2ZJ2 A;  2ZME C;  3OIQ A;  3BTC A;  2VQL A;  3E1S A;  2BY1 A;  2X85 A;  4XLA A;  2P81 A;  1OJL A;  3PQK A;  2DDB A;  2W84 A;  3MFK A;  2O7O A;  4G7Z F;  3KEQ A;  3B6A A;  3SFI A;  1HKS A;  1RNL A;  5FO5 A;  3VYR B;  4A12 A;  2CQ7 A;  2ZC2 A;  3HKZ A;  3CUQ A;  5DCM B;  1FYK A;  2VOP A;  3P9I A;  1LVA A;  3DTK A;  4ABZ A;  5K5R A;  4MEX F;  2YX4 A;  3RJP A;  2E1O A;  1X2M A;  3M4O J;  1AA7 A;  3SHF A;  3V7C A;  4BU2 A;  2IS4 A;  2V1X A;  4RB2 C;  3OS2 A;  4DNC A;  1W7P D;  1BW5 A;  2HFH A;  2XAU A;  2V1N A;  4OIO F;  2BW3 B;  1X1P A;  3K1M A;  4D1Q A;  4E7L A;  2X1E A;  4BJ5 C;  4IHY A;  2QQB A;  1SFK A;  3ASN H;  4BQN A;  1B6A A;  3ZQ7 A;  2HEO A;  2DOA A;  4EJO A;  1BC7 C;  2F4I A;  3CUQ B;  1SFE A;  3ZGK A;  1SAN A;  5GTI C;  1ZGW A;  3FM5 A;  4CCJ A;  5LEJ A;  2DN0 A;  3W2A A;  3A01 B;  2HNH A;  1FYL A;  1CQT A;  4GDF A;  3EDP A;  1MJA A;  1WJD A;  3E7L A;  3L09 A;  2K27 A;  1PDN C;  1L0O C;  2Z9O A;  2QQ9 A;  2BHZ A;  1KQ9 A;  1I3A A;  2RNJ A;  1YX3 A;  2P7V B;  5HDN A;  4ENM A;  2O61 A;  4P1W A;  2PLY A;  2JPB A;  3GFI A;  3HC7 A;  2Q8K A;  4PJM A;  1R36 A;  4UHT A;  4E6K G;  1MSF C;  1N77 A;  4IHV A;  3KEO A;  5IP6 A;  3ZN0 A;  4CHU A;  3FBI B;  1MKM A;  4NQW A;  5LBQ A;  2ECB A;  5HNH A;  1K61 A;  2DPD A;  5K7H A;  1T98 A;  3SEQ A;  3BJA A;  1QNT A;  4OU0 A;  3RTR A;  2BBY A;  1BR1 A;  1U5T A;  2NS7 A;  4BJT A;  2GA2 A;  4KJZ A;  1BA5 A;  5EDN A;  4JX4 A;  4RLQ A;  2CUE A;  5E3M A;  4D5C A;  1X4P A;  1YIO A;  2VXZ A;  2LR8 A;  4DZP A;  2V1U A;  2IS1 A;  2LYC A;  3I59 B;  2X1C A;  4FE7 A;  4XR6 A;  4YII A;  2F5V A;  2EFW A;  3UKG A;  3BPV A;  1RI7 A;  2K5C A;  6PAX A;  4LK1 F;  2A3S A;  1R1T A;  2JT1 A;  2QCO A;  5J1R A;  4LLG F;  4A6E A;  3W2V A;  4JP0 A;  1S8N A;  1G3S A;  3PJR A;  2DU9 A;  4E7J A;  2GLO A;  5E8I A;  2WB1 A;  3S2H J;  4JBA A;  3CCS I;  3EPZ A;  4IJA A;  2QKM B;  1JUP A;  2YX7 A;  2OCE A;  4L5I A;  2VPR A;  3C7J A;  3CCE I;  2AXL A;  5E3N A;  4UY8 I;  2XDV A;  1JKO C;  2OTJ I;  3GTO J;  3I54 A;  4XOP A;  1B72 A;  3KP2 A;  3H3Z A;  3DP7 A;  1XCB A;  2A61 A;  3U2R A;  4HZF A;  4PK4 A;  4IZZ A;  5HNF A;  1WJF A;  2KLO A;  3EUA A;  4J01 A;  1WPK A;  3FXO A;  3DQV C;  4AVP A;  1ZRD A;  3ZPL A;  4FT8 A;  1JKR C;  3GFM A;  2XRO A;  2PEX A;  3JAM Z;  2BHY A;  4O3M A;  1ZQ3 P;  2OZ6 A;  2GXA A;  3F22 A;  1FOW A;  3OWT A;  3J7A Y;  5KAI C;  1FBQ A;  3CTA A;  5ICC A;  1W7P B;  2M4G A;  4E7I A;  4OIP F;  3GME A;  3RQI A;  2VT2 A;  5CPR B;  4DIQ A;  2A05 A;  1R4N B;  2JVG A;  4ZYH A;  2JQ7 A;  3ZMZ A;  5J40 A;  4KIC A;  5J4V A;  5FKO A;  4N4N B;  5J1Y A;  2NYX A;  1BI2 A;  2OV7 A;  2H8W A;  5M3M J;  2COM A;  4GO1 A;  5FKN A;  2LF7 A;  3RCO A;  3Q0W A;  1PUF B;  3RKY A;  4C2T A;  4BHB A;  3G3Z A;  2PQ8 A;  2X51 A;  4YEJ A;  4WX9 A;  3WHB A;  2BY3 A;  4AYB N;  4UUS B;  5LHG A;  4R1H A;  1IDY A;  3T1B A;  3GF2 A;  4NC8 A;  1YTY A;  2GQQ A;  1HC8 A;  2UV1 A;  5E18 F;  2VAS A;  1RKT A;  3M8E A;  2HXO A;  2Y75 A;  2R7V A;  1SD5 A;  1X1A A;  4LOC A;  3OYA A;  1FTT A;  2Z5U A;  3BZK A;  1R6R A;  1J75 A;  5CJ9 A;  2Y9Y A;  1N25 A;  2R4G A;  2DK5 A;  4WK8 F;  2E5Z A;  4LJZ F;  4BY7 J;  1VQ8 I;  2LMD A;  1RKW A;  2Z33 A;  4EV0 A;  1XSD A;  1P4X A;  1FP1 D;  3LQQ A;  1B8I A;  5AIQ A;  5ED4 A;  3A4C A;  5IOY A;  2JJ7 A;  3FMS A;  5JFR A;  2EV0 A;  1DQU A;  1RRJ A;  1RES A;  2CQX A;  1ZRC A;  2E5N A;  4S0H B;  1SEU A;  4B47 A;  3GFJ A;  4IRI A;  2CFO A;  2QZ8 A;  2JK3 A;  4B43 A;  3S14 J;  3S3O A;  2DFE A;  3EET A;  2QWW A;  2HTS A;  2AXT C;  3CCV I;  3IC7 A;  4ZJZ A;  4UUV A;  4HEA 2;  4IQ4 A;  3K70 C;  5K1Y A;  2KIU A;  5F27 A;  1FT9 A;  2O8K A;  4GFB A;  3BJ6 A;  1XDU A;  2YR2 A;  5D4R A;  2CG4 A;  2DOD A;  2E36 A;  2ZFU A;  4HV6 A;  5H6R A;  2PJR B;  4C30 A;  3ASO H;  2CUZ A;  4HYE A;  4A3C J;  3E3V A;  1E0E A;  4ZYG A;  1IC8 A;  1O3T A;  3PFI A;  4XKV A;  1T2K A;  4ZTF A;  2DAO A;  1ZR2 A;  1T56 A;  5JHU A;  2ZJP F;  2P6T A;  2K86 A;  4H4K C;  3JRA A;  4I09 A;  3RKQ A;  3S1Q J;  3IWZ A;  4LIV A;  3K70 D;  1WJC A;  1S29 A;  2RNG A;  1O3S A;  1EA3 A;  3K2Z A;  1R9T J;  2G0E A;  3I9V 2;  3MAJ A;  3OIP A;  4A3L J;  4X1E A;  2BXZ A;  1W4M A;  2XAG A;  2D5V A;  3BTI A;  4D0P A;  1MD0 A;  2O5R A;  4IQJ A;  1K4T A;  1LEA A;  4BAC A;  3RPU D;  1SFX A;  2NOJ B;  3C1D A;  1XPX A;  2P8T A;  2DT5 A;  4S05 A;  1WFX A;  4RDU A;  1RUN A;  2HOA A;  2LKX A;  4M6Y A;  2LDU A;  4JX5 A;  2ZKZ A;  3ROU A;  3WHC A;  4C9Y A;  2DMU A;  2CWE A;  2DW4 A;  3QU6 A;  1YE9 A;  3FKJ A;  4AD9 A;  1N75 A;  1IZ1 A;  3LL7 A;  1FOX A;  2LKP A;  3B02 A;  1JJ6 C;  1KU3 A;  4GCV A;  3KIO A;  3SJM A;  1JI8 A;  4A0Z A;  2CW8 A;  3REO A;  4ASN A;  1FPQ A;  1DUX C;  2E1M C;  3SZP A;  1KON A;  3ECO A;  5IT3 A;  3K1N A;  2CV0 A;  2MD0 A;  4MFD A;  2WWY A;  2DJN A;  3SZT A;  2KDZ A;  1R71 A;  2DMP A;  2RAE A;  4CDG A;  1FX7 A;  4AYB A;  4Q5S F;  1FEX A;  2JPC A;  5EG0 A;  3LAP A;  2M2E A;  2IW5 A;  3DEU A;  1D1C A;  2R93 J;  2VJ4 A;  3GZ5 A;  3K4L A;  4ZDL A;  5CVR A;  4P55 A;  4IHT A;  3LOC A;  5KVR A;  4BNC A;  3QPT A;  3LSH A;  1FZP B;  3GTQ J;  1W5S A;  1WWX A;  2E35 A;  4HG2 A;  2XPU A;  3MKZ A;  2CGP A;  3MMY B;  3PUF A;  5DD8 A;  4EMS A;  1IV6 A;  4UNO A;  3HTS B;  2AQE A;  1IUY A;  1VQO I;  3ZRG A;  2IGO A;  4HX8 A;  2CRG A;  4OMZ A;  3HOX J;  4LMY A;  3LSK A;  2ESH A;  2J5O A;  3S8P A;  3J81 K;  4UV8 A;  2IS6 A;  3NAU A;  4HW0 A;  5E3O A;  4IOC F;  2CH0 A;  2L9V A;  3KPH A;  4ZTJ A;  3GTG J;  3FX3 A;  1I50 J;  5D5U B;  3CCY A;  1YIT I;  1R7J A;  1D5V A;  1MJ9 A;  4M3F A;  2HPM A;  3QP6 A;  1LFU P;  5IYC J;  2DT7 B;  3DKW A;  2K9S A;  4PDK A;  3F8C A;  4YG2 F;  3CDH A;  1JHH A;  3U1D A;  1R5G A;  2XSJ C;  4YIR X;  3JRE A;  4OOI A;  3OS0 A;  3PSF A;  4ZYD A;  2WBM A;  1XGO A;  3EQL F;  3T8R A;  5L3C A;  2W85 A;  1GVD A;  5TRD A;  3CCJ I;  1VTN C;  4PGG A;  4YRV A;  1H88 C;  3MVP A;  4I99 C;  5GAE J;  4RLF A;  4A3K J;  3HZJ A;  1JUS A;  5EJC A;  1P2F A;  2CV2 A;  5IY5 H;  4MFE A;  2DOE A;  4HA8 A;  2M0M A;  2GIZ A;  1ZRE A;  4XN0 A;  1VQN I;  3E6M A;  4IVN A;  1ZAO A;  3BCB A;  4XRS A;  3K4J A;  3TP0 A;  4ZDO A;  2OA4 A;  1WKM A;  3JRI A;  1FP2 A;  2FA5 A;  3ZCO A;  1BN5 A;  1X3U A;  2XV4 S;  4I0A A;  2Y0S N;  2L4A A;  2QLZ A;  3DTI A;  5LRS A;  2DI3 A;  1YW9 A;  1I5Z A;  4NQW B;  3M3Y J;  2XIG A;  3P5J A;  1KYZ A;  4CCL A;  4A6D A;  1V54 H;  1MIJ A;  3QOP A;  4A0Y A;  1IV8 A;  2NOG A;  3ZQH A;  1GDT A;  4HLX A;  4RGS A;  4HPQ A;  3S1M J;  3CLO A;  3LWF A;  3K6G A;  4DYR A;  2KT0 A;  1TNT A;  3ABK H;  3GVA A;  2F48 A;  3H92 A;  2VBY A;  4EEF G;  2HQR A;  1VI0 A;  1P4W A;  3W6J B;  1SC7 A;  4XID A;  2OQR A;  3RPU A;  3CCL I;  1ZLK A;  2KFD A;  3Q5F A;  2LBF B;  3HGY A;  3MD2 A;  1KQ0 A;  3LA3 A;  5EG0 B;  2ETH A;  3TL4 X;  5GAH J;  3K10 A;  1K78 B;  2L01 A;  3D5R C;  1PJR A;  2N8G A;  3CP8 A;  2H94 A;  2LY1 A;  2JA8 J;  3KFW X;  4RB1 A;  3BR1 A;  1D8K A;  2Y48 A;  3OL3 A;  4XRM A;  1R4M B;  1Z91 A;  2F2E A;  5DV5 A;  3UR3 C;  5GAG J;  3KZI C;  1U9N A;  3S1N J;  1U5T C;  5B5E C;  3J7Y J;  2W4S A;  4KN4 X;  2EA2 A;  2A5Y B;  4WXD A;  3GX4 X;  1J2X A;  1YW7 A;  2JUC A;  2VBW A;  3DEE A;  4KIT B;  1OCO H;  4HAM A;  2NS8 A;  3FWE A;  4ZC3 A;  5E1X A;  2LP0 A;  3PUB A;  4KIB A;  1OFC X;  5LFA A;  1BIA A;  4KT6 A;  4B09 A;  1TNS A;  3KP5 A;  1DP7 P;  1GVJ A;  3Q0U A;  2ZCW A;  1ETW A;  2E7X A;  3GEZ A;  3ZMT A;  1GXP A;  3ZP5 A;  3WTY C;  3N4M A;  3FZV A;  2M1B A;  3B73 A;  2HVQ A;  4XLF A;  3CJR B;  5F1R A;  2X0L A;  1U3E M;  1HBX G;  2NVY J;  1EF4 A;  3LSM A;  3TP3 A;  5IT9 K;  2HYF A;  3K2A A;  4PFO A;  2BXY A;  4HF2 A;  4BY1 J;  1J9I A;  2O0Y A;  2Y0S A;  3VYT B;  2DCE A;  3F72 A;  4L9N A;  5HOD A;  1FMW A;  1LDJ A;  3HB9 A;  3CCM I;  2VUM J;  1G2H A;  1UMQ A;  1VZ0 A;  4QWQ A;  5J6X A;  2GOM A;  2FBI A;  4N9H A;  3I58 A;  4ZH4 F;  1RPW A;  3BZC A;  2XGC A;  2E1N A;  5J8F A;  3BG5 A;  3OOP A;  4TV7 A;  1HA8 A;  2W24 A;  2VQG A;  1FOK A; 
#chains in the Genus database with same CATH homology
 3HUG A;  3MZH A;  4M9X A;  1PUE E;  3E5X A;  3T8T A;  1MJB A;  1YG2 A;  5AIP A;  1C0W A;  5HLI A;  5LRR A;  2M30 A;  3RYR A;  3FM3 A;  2PMU A;  3L9F A;  3ERE D;  3TO6 A;  4EJU A;  3RDI A;  4U7B A;  2ACJ A;  2VC0 A;  4H0E A;  1FC3 A;  2L02 A;  3TO9 A;  1HSJ A;  2EV5 A;  2F5F A;  3F6V A;  2DK8 A;  3BDD A;  5HS7 A;  1HW5 A;  1XN7 A;  5DYM A;  4L9T A;  2ZME B;  3KP6 A;  5FLX K;  2WV0 A;  4BYY A;  2FMY A;  2H27 A;  1KU7 A;  4ENN A;  1IN8 A;  2O03 A;  3JAM K;  2H6C A;  3MWM A;  3LFK A;  3V8L A;  4RGR A;  4U88 A;  1HW1 A;  3L00 A;  3BRO A;  2DPU A;  3E5U A;  1W7P A;  2H6B A;  5LHI A;  2F5E A;  2RVC A;  5LGT A;  1V4R A;  3TKY A;  2IT0 A;  4NB5 A;  3FHZ A;  3HRT A;  2IVM A;  4N0B A;  1ODD A;  3WTU C;  5E20 A;  3TOA A;  1AOY A;  4EM1 A;  1SD6 A;  3D0S A;  1G6N A;  1XGS A;  3V7R A;  3ZMS A;  5D5W B;  3NQO A;  1SMY F;  4GYI A;  3E6B A;  1OYI A;  2NAZ A;  3VEP A;  3ULQ B;  3HOT A;  1CF7 B;  4L9V A;  5CVJ A;  3HRS A;  4S04 A;  3V8J A;  2QBY A;  3U9G A;  1TLH B;  1B1B A;  1B4A A;  2K7L A;  4HQE A;  4KYW A;  4GYG A;  2FBH A;  2STW A;  1V3F A;  4KIF A;  4N9I A;  2XUB A;  2WTE A;  4HDV A;  1O7F A;  2VT3 A;  4EVI A;  3OV8 A;  2RC4 A;  1FLI A;  1FSH A;  2V9V A;  2HKO A;  2DLL A;  2EWN A;  1W5T A;  4UV9 A;  1WSU A;  4LLN A;  1S3J A;  2BEO A;  1BIB A;  1BI0 A;  5ICG A;  2R7D A;  2W25 A;  2HDC A;  3ISP A;  4G8X A;  2V6C A;  1SD7 A;  4XLP F;  2FRH A;  1IW7 F;  3D5L A;  2HQN A;  2P4W A;  5JVT A;  1S7A A;  1G3T A;  4FHT A;  2EB7 A;  3SQN A;  1USS A;  3CO6 C;  2G7U A;  3ABT A;  2VC1 A;  5HDG A;  4KT5 C;  4ESF A;  5D5V B;  2XAJ A;  1R1V A;  4LG0 B;  5DCM A;  2A6H F;  5DD4 A;  2A07 F;  3W6K B;  3ZN1 A;  4P96 A;  5CLS A;  3WTT C;  3SFZ A;  4WWC A;  1JE8 A;  3E97 A;  4M6X A;  3VFZ A;  1O57 A;  4A5N A;  4KUM A;  5LGN A;  2V79 A;  1IRF A;  2DBB A;  1U2W A;  3F8N A;  3E5Q A;  1Z7U A;  2XAF A;  2D1V A;  3O2P E;  1KA8 A;  4LLL A;  4EM2 A;  4IRH A;  1XSV A;  3F8F A;  3FXQ A;  3BP8 A;  2BGC A;  2XHK A;  2XKO A;  3HHH A;  3KCC A;  3WTS C;  2F5D A;  3I59 A;  4HX7 A;  1P4A A;  1Z9C A;  3HSE A;  3ZMU A;  1IN5 A;  2Z99 A;  4HDU A;  2Z3Y A;  5CYV A;  1RZ4 A;  2YU3 A;  5F64 A;  1LQ1 A;  3GZ6 A;  2MD5 A;  4I01 A;  4LD5 A;  5E1Z B;  4Y17 A;  2PN6 A;  1T0F A;  1XGN A;  3JTH A;  3MQ0 A;  4KFC A;  2FNP A;  2IPQ X;  4HOB A;  2M5W A;  5E17 F;  4HX4 A;  2GXB A;  1EH7 A;  1FY7 A;  3H3U A;  1HXD A;  3M8F A;  2KJC A;  4Y15 A;  1UB9 A;  2EK5 A;  3IL2 A;  3K1P A;  2QVO A;  1ZHF A;  3HOS A;  1F5T A;  1HW2 A;  3ABU A;  3WG9 A;  1BI3 A;  2FU4 A;  1REP C;  4MTE A;  4BH9 A;  1IN6 A;  1ZYR F;  3DXJ F;  4XBF A;  3WTZ A;  3IRR A;  1O7L A;  5FGM A;  2E1C A;  4MNU A;  4P9F A;  3I5U A;  2R7F A;  1ZGJ A;  2VBZ A;  1XB4 A;  3VB2 A;  3BY6 A;  3NRV A;  5F6F A;  3P7N A;  2GAU A;  3GYH X;  4AIK A;  2GIV A;  3EYI A;  5BS6 A;  3QP5 A;  3QU3 A;  4ZZD A;  4L5J A;  3CUO A;  2P5V A;  1U6G A;  3KE2 A;  5HOO A;  1K79 A;  1R00 A;  4O5V A;  4HF0 A;  3BZ6 A;  3BPX A;  2MBF A;  5IT9 Z;  4ZYE A;  3HHG A;  1IN7 A;  2V1D A;  3GLX A;  1JXS A;  1H9G A;  1D3Y A;  4XRF A;  3L2C A;  1IAW A;  5KK1 A;  5DCF A;  2ZBK A;  4BAY A;  3KP4 A;  2RKH A;  1IXR C;  3AAF A;  2M8E A;  5BMZ A;  3TGN A;  3LQR A;  5BOX A;  2YPR A;  3FXU A;  3HIF A;  2D2W A;  2GWR A;  1ZRF A;  3LST A;  2ISZ A;  2ELH A;  2IA2 A;  2HR3 A;  2OU2 A;  5L3F A;  2XRN A;  1QQI A;  5JI6 A;  1FBS A;  1J5Y A;  1UHW A;  1HQC A;  2K02 A;  4P5O A;  2FE3 A;  5DUK A;  3TOB A;  1ZGA A;  2EJR A;  4CXF A;  1YYV A;  3R0A A;  1ZG1 A;  4LK0 F;  3G73 A;  1OYW A;  1YS6 A;  1LB2 A;  1B9M A;  2CW0 F;  4JQF A;  1ONV A;  2WC2 A;  2PMH A;  4ZZL A;  3F3X A;  1J7K A;  2KRF A;  1J0R A;  2QYO A;  3DPT A;  2XAS A;  5DUI A;  5D8K B;  3CJN A;  2VON A;  1UST A;  3C3W A;  1BI1 A;  2ZXJ A;  2OZU A;  2RQP A;  4ON0 A;  2JRT A;  3WE3 A;  5HVQ C;  2FML A;  4U0W A;  3JSP A;  3T5X A;  1XMA A;  3R4K A;  5BPI A;  4KMU X;  1ZAR A;  3O3K A;  3HTU A;  4G94 A;  2GA1 A;  5A2Q Z;  2QM3 A;  2FNA A;  1FBU A;  2VN2 A;  2NS0 A;  4MEY F;  1Q1H A;  4EJV A;  2B0L A;  5LEK A;  1E2X A;  2ZO4 A;  5D6E A;  3T0Y A;  3Q9S A;  5ERI A;  4L18 B;  2J5P A;  3WTX C;  2O3F A;  4ESJ A;  1G3W A;  3BJO A;  1FSE A;  5L3G A;  5HDK A;  2Q2E A;  1CF7 A;  1DPU A;  2PFB A;  3CUQ C;  5D6F A;  1FYM A;  2HOE A;  4P9U A;  4BQA A;  3N97 A;  3RIR A;  4OIR F;  2RN7 A;  4RAZ A;  3MZY A;  3SXY A;  3WGH A;  1MDM A;  2Q0O A;  3HRM A;  4ETS A;  1JHF A;  4PZJ A;  2CO5 A;  5L3E A;  2QEN A;  2VE9 A;  2L3D A;  2NRA C;  2EFP A;  2O6G E;  5CVU A;  4KMF A;  2G7H A;  1LDD A;  3MCZ A;  2FQ3 A;  2HWV A;  4YFN F;  1T38 A;  4KDP A;  4CZZ A;  1KU9 A;  1G4D A;  2FEZ A;  1TW3 A;  5FLX Z;  1MDM B;  4UXN A;  2G9W A;  4XLN F;  3KLO A;  2DQR A;  2MLK A;  4UVC A;  4KNY A;  5TJJ A;  2ADU A;  2NNY A;  1H9T A;  3J81 Z;  1MGT A;  2JSC A;  4G7O F;  3JTG A;  5HS8 A;  4PCQ A;  3WU0 A;  5FD6 A;  1OMI A;  3K69 A;  2VBX A;  3HRU A;  4MGR A;  1J59 A;  4DQ2 A;  4R79 A;  3F21 A;  4FX4 A;  3IRQ A;  4IPA A;  2X4H A;  3ECH A;  2EA4 A;  4GGG A;  2FF4 A;  3P9K A;  2PJP A;  2IA1 A;  3I64 A;  1TQI A;  4I2O A;  2BE5 F;  5D8L B;  1R58 A;  1U5T B;  2BYV E;  2QBY B;  2Y0M A;  1R1U A;  1KQ8 A;  1YQA A;  1ZN2 A;  5ICF A;  3I0T A;  1BC8 C;  4NHJ A;  5CVI A;  3ELK A;  1XDS A;  2KJB A;  3FMR A;  2R3S A;  3TDZ C;  4Y13 A;  3I4P A;  5LGU A;  3JSO A;  1QGP A;  1WRJ A;  3J7A O;  1EH8 A;  2A69 F;  1XCV A;  2HKX A;  2KKO A;  2OBP A;  5E1W A;  4KA4 A;  4M71 A;  5D4S A;  1KU2 A;  3EUH A;  1O3Q A;  1K6O A;  4BHC A;  4WXC A;  4EJW A;  1YS7 A;  1ZLJ A;  2YSR A;  5LHH A;  2FOK A;  2RGV A;  3RKW A;  1QZY A;  4L0Y B;  4LB5 A;  4HQM A;  5J8C A;  1BM9 A;  3S2W A;  4CGZ A;  3WGG A;  4U0V A;  1YO5 C;  3QPH A;  1LNW A;  3E6C C;  3HYI A;  4RGX A;  3GFL A;  3R60 A;  4EJT A;  5L3B A;  2HTJ A;  3VOD A;  4LB6 B;  4EGY A;  4KIG A;  3FMQ A;  2UXN A;  3WGI A;  3EYY A;  2CYY A;  4IF4 A;  3IKV A;  2ZME A;  4YFK F;  2JZY A;  2P5L C;  5LLQ A;  3WU1 B;  3O6B B;  1G3Y A;  3QAH A;  1S7O A;  2ZNY A;  1R23 A;  1QO0 D;  5H6Q A;  3WTV C;  3FF5 A;  1A04 A;  3IHU A;  1DPR A;  2PBI A;  5HLH A;  3IWF A;  5AON A;  5BPD A;  5BQT A;  3BWG A;  1Z6T A;  3KP7 A;  1GXQ A;  4ENJ A;  2HS5 A;  4OIN F;  1YFH A;  3KP3 A;  1SMT A;  1IF1 A;  1UCR A;  5K5O A;  4XSZ F;  3J80 K;  1S6L A;  1BJA A;  4YIF A;  3MEX A;  4I0B A;  1SFU A;  2LF8 A;  3GW2 A;  3Q9V A;  3WTW C;  4EM0 B;  4G6Q A;  3KLN A;  1Z6R A;  3TDU C;  4CO8 A;  4M74 A;  2XKP A;  2RV8 A;  1ULY A;  4M73 A;  5ILS A;  4L0Z B;  2NNN A;  1BBY A;  5EEG A;  5EEH A;  2DO7 A;  2ZFW A;  5A2Q K;  4KN7 X;  3I71 A;  2HGC A;  4IRG A;  1ON1 A;  4B8X A;  3BOQ A;  1KYW A;  2PG4 A;  1P92 A;  1F1Z A;  2HZT A;  5K5Q A;  1I1G A;  2QQA A;  5FFZ A;  1SAX A;  3GUD A;  3PQJ A;  5FB2 A;  2A68 F;  3F8B A;  5H20 A;  3WE2 A;  3HSF A;  2D45 A;  4EGZ A;  5FD5 A;  2P6S A;  1TW2 A;  3M9A A;  2EFQ A;  2M45 A;  2QUF A;  1D8J A;  1O3R A;  1P6R A;  3K0L A;  2VOD A;  1XSX A;  1AWC A;  3NEU A;  3KZZ A;  3DV8 A;  4ESB A;  1DDN A;  2VE8 A;  3C18 A;  5JR3 A;  4HBL A;  1QPM A;  2IA0 A;  4G6D A;  1T6S A;  1TBX A;  3QRF F;  2RDP A;  3M1E A;  2M87 A;  5FFX A;  1QBJ A;  3LAJ A;  4I7H A;  3COA C;  4JK1 X;  1H0M A;  4OIQ F;  4K2E A;  2XAQ A;  2KIF A;  4HV5 A;  1I1S A;  2UXX A;  3KZY A;  1OPC A;  4L9J A;  2MH2 A;  1UFM A;  2D1H A;  1XD7 A;  3F23 A;  1XMK A;  4CYD A;  4BXU A;  1RIO H;  3HSR A;  3P9C A;  4M9Z A;  5ILV A;  1WI9 A;  4A0X A;  1TTY A;  1HKT A;  3J80 Z;  2EV6 A;  2W57 A;  3GXO A;  1OR7 A;  1F4K A;  3V7S A;  3ML6 A;  4WXH A;  1STZ A;  3F6O A;  2AS5 F;  4UVA A;  4RS8 A;  4UVB A;  5ICE A;  4R8H A;  1TQP A;  4RAY A;  1ZH5 A;  1EV7 A;  2STT A;  4BHP A;  4HLY A;  2ESN A;  3E6D A;  2XGX A;  1R5H A;  4MTD A;  4YFX F;  2E7W A;  4A2U A;  4LG0 A;  4XSX F;  4Q48 A;  1B9N A;  5DEQ A;  2ISY A;  5HLG A;  3I53 A;  3RPQ A;  4Z2Y A;  4FX0 A;  4G9Y A;  2ZNZ A;  5ILU A;  3TQN A;  2LSO A;  1MZB A;  4Q4Z F;  4LGW A;  1HST A;  2MLG A;  4U7D A;  4WF2 A;  3V4G A;  2DTR A;  1EH6 A;  3R0J A;  2K4J A;  1FNN A;  1L3L A;  1TQM A;  1T39 A;  5L3D A;  1JGS A;  3GWZ A;  2P7C B;  4A5M A;  2OQG A;  3WOD F;  1LEB A;  1B59 A;  1ZG3 A;  3RKX A;  5E8G A;  4PGH A;  2MH9 A;  2P5K A;  2A6E F;  2IJL A;  2TDX A;  1IXC A;  1XGM A;  1F9N A;  1BOA A;  3KET A;  1CGP A;  3DPL C;  5HS9 A;  2LNB A;  4MHG A;  3R61 A;  4LFU A;  4O6J A;  1UHM A;  2L4M A;  2KIM A;  4I02 A;  3GO5 A;  3LA7 A;  4RGU A;  2MC3 A;  1U78 A;  1SD4 A;  1PP7 U;  4QLC U;  2UZK A;  5D5X B;  1ZG5 A;  2EFN A;  2F5C A;  4Q47 A;  3DF8 A;  4IXA A;  3DFG A;  4WCG A;  3LA2 A;  1FWZ A;  4RB0 A;  1ON2 A;  2O8X A;  2PI0 A;  1IRG A;  1LDK B;  3K9T A;  1YLF A;  4AIJ A;  4M72 A;  2HYG D;  1GHC A;  2EFO A;  1R22 A;  1WQ2 A;  2IP2 A;  4CIC A;  1KGS A;  2DQL A;  2VOO A;  3F8M A;  2OAZ A;  2C6Y A;  1Z1D A;  2FBK A;  1IXS B;  1K78 A;  4IHS A;  2GZW A;  1K7A A;  3IKT A;  1HKQ A;  1NHA A;  2CSO A;  4F7Z A;  1RUO A;  3VOE A;  2FSW A;  3RYP A;  1LJ9 A;  3ZMV A;  4EQQ A;  1U8R A;  4I98 B;  4RB3 C;  2H09 A;  4AWX B;  3V8K A;  4E70 A;  2FXA A;  1I6X A;  1QZZ A;  1Z05 A;  5DDG A;  4G7H F;  2XAH A;  2CQK A;  3TO7 A;  1IN4 A;  2IRF G;  2OD5 A;  4MQV A;  2JTV A;  4MQ9 F;  5CVV A;  1OKR A;  2L54 A;  3L7W A;  2XVC A;  3M7G A;  2MA3 A;  3CO7 C;  1I27 A;  4GXO A;  2GXG A;  1OYY A;  4ENK A;  2CFX A;  4HF1 A;  4AIH A;  1Y0U A;  1E17 A;  3FXR A;  3JW4 A;  2K4B A;  2DFI A;  3RI4 A;  1PP8 F;  4U0Y A;  4OMY A;  3R6S A;  3ZMD A;  1YW8 A;  4M9S A;  2BV6 A;  2UWM A;  2ZJ2 A;  3PQK A;  2W84 A;  3MFK A;  4G7Z F;  3KEQ A;  1HKS A;  1RNL A;  5FO5 A;  4A12 A;  3CUQ A;  5DCM B;  1FYK A;  2VOP A;  3P9I A;  1LVA A;  4MEX F;  5K5R A;  2YX4 A;  3RJP A;  3SHF A;  3V7C A;  2V1X A;  4RB2 C;  4DNC A;  1W7P D;  2HFH A;  4OIO F;  3K1M A;  2QQB A;  1B6A A;  3ZQ7 A;  2HEO A;  4EJO A;  1BC7 C;  3CUQ B;  1SFE A;  3FM5 A;  5LEJ A;  1FYL A;  3EDP A;  1MJA A;  3L09 A;  2K27 A;  1PDN C;  1L0O C;  2Z9O A;  2QQ9 A;  1KQ9 A;  2RNJ A;  2P7V B;  5HDN A;  4ENM A;  2O61 A;  2PLY A;  2JPB A;  3GFI A;  2Q8K A;  1R36 A;  4UHT A;  3KEO A;  3ZN0 A;  4CHU A;  1MKM A;  4NQW A;  5LBQ A;  2DPD A;  1T98 A;  3BJA A;  1QNT A;  4OU0 A;  3RTR A;  2BBY A;  1U5T A;  2GA2 A;  1YIO A;  2VXZ A;  2V1U A;  3I59 B;  4YII A;  2EFW A;  3BPV A;  1RI7 A;  6PAX A;  4LK1 F;  2A3S A;  1R1T A;  2JT1 A;  4LLG F;  4A6E A;  1S8N A;  1G3S A;  2DU9 A;  5E8I A;  4JBA A;  4IJA A;  2YX7 A;  4L5I A;  3C7J A;  2AXL A;  3I54 A;  3KP2 A;  3H3Z A;  3DP7 A;  1XCB A;  2A61 A;  3U2R A;  4HZF A;  3DQV C;  4AVP A;  1ZRD A;  3ZPL A;  4FT8 A;  3GFM A;  2XRO A;  2PEX A;  3JAM Z;  4O3M A;  2OZ6 A;  3F22 A;  1FBQ A;  3CTA A;  5ICC A;  1W7P B;  4OIP F;  2VT2 A;  4ZYH A;  3ZMZ A;  4KIC A;  2NYX A;  1BI2 A;  2COM A;  4GO1 A;  2LF7 A;  3RKY A;  4BHB A;  3G3Z A;  2PQ8 A;  4WX9 A;  5LHG A;  4R1H A;  3T1B A;  3GF2 A;  1YTY A;  2GQQ A;  5E18 F;  3M8E A;  2Y75 A;  1SD5 A;  2Z5U A;  1J75 A;  5CJ9 A;  2DK5 A;  4WK8 F;  4LJZ F;  2Z33 A;  4EV0 A;  1XSD A;  1P4X A;  1FP1 D;  3LQQ A;  5AIQ A;  5ED4 A;  5JFR A;  3FMS A;  2EV0 A;  1ZRC A;  3GFJ A;  4IRI A;  2QZ8 A;  3EET A;  2QWW A;  2HTS A;  3IC7 A;  4UUV A;  5K1Y A;  2KIU A;  1FT9 A;  3BJ6 A;  1XDU A;  2YR2 A;  5D4R A;  2CG4 A;  4HV6 A;  5H6R A;  4HYE A;  3E3V A;  4ZYG A;  1O3T A;  3PFI A;  1T2K A;  2DAO A;  5JHU A;  2P6T A;  2K86 A;  4I09 A;  3IWZ A;  1S29 A;  1O3S A;  3K2Z A;  3MAJ A;  1W4M A;  2XAG A;  4D0P A;  1MD0 A;  1LEA A;  1SFX A;  3C1D A;  2P8T A;  2DT5 A;  4S05 A;  1RUN A;  4M6Y A;  2LDU A;  3ROU A;  2ZKZ A;  2CWE A;  2DW4 A;  3QU6 A;  4AD9 A;  1IZ1 A;  2LKP A;  3B02 A;  1KU3 A;  4GCV A;  4A0Z A;  3REO A;  4ASN A;  1FPQ A;  1DUX C;  3SZP A;  3ECO A;  5IT3 A;  3K1N A;  2WWY A;  3SZT A;  4CDG A;  1FX7 A;  4Q5S F;  2JPC A;  3LAP A;  2IW5 A;  3DEU A;  3GZ5 A;  4IHT A;  5CVR A;  4P55 A;  5KVR A;  4BNC A;  3QPT A;  1FZP B;  1W5S A;  1WWX A;  2CGP A;  4UNO A;  5DD8 A;  4EMS A;  1IUY A;  3HTS B;  4HX8 A;  4OMZ A;  4LMY A;  2ESH A;  2J5O A;  3J81 K;  4UV8 A;  4HW0 A;  3FX3 A;  5D5U B;  1R7J A;  1D5V A;  1MJ9 A;  3QP6 A;  3DKW A;  4PDK A;  3F8C A;  4YG2 F;  3CDH A;  1JHH A;  3U1D A;  1R5G A;  4OOI A;  4ZYD A;  1XGO A;  3EQL F;  3T8R A;  5TRD A;  2W85 A;  5L3C A;  1VTN C;  4PGG A;  1P2F A;  4HA8 A;  1ZRE A;  3E6M A;  4IVN A;  1ZAO A;  2OA4 A;  1WKM A;  1FP2 A;  2FA5 A;  1BN5 A;  1X3U A;  2XV4 S;  4I0A A;  2L4A A;  2QLZ A;  5LRS A;  2DI3 A;  1YW9 A;  1I5Z A;  2XIG A;  1KYZ A;  4A6D A;  3QOP A;  4A0Y A;  4HLX A;  4RGS A;  3CLO A;  3LWF A;  1TNT A;  3GVA A;  3H92 A;  2VBY A;  2HQR A;  1P4W A;  3W6J B;  2OQR A;  3RPU A;  1ZLK A;  3Q5F A;  1KQ0 A;  3LA3 A;  2ETH A;  1K78 B;  2L01 A;  2H94 A;  3KFW X;  4RB1 A;  1D8K A;  2Y48 A;  1Z91 A;  2F2E A;  5DV5 A;  1U5T C;  4KN4 X;  2EA2 A;  2A5Y B;  4WXD A;  3GX4 X;  1J2X A;  1YW7 A;  2VBW A;  4HAM A;  3FWE A;  5E1X A;  4KIB A;  1BIA A;  4B09 A;  1TNS A;  3KP5 A;  1DP7 P;  1GVJ A;  2ZCW A;  2E7X A;  3GEZ A;  3ZMT A;  1GXP A;  3ZP5 A;  3WTY C;  3N4M A;  3FZV A;  2M1B A;  3B73 A;  5F1R A;  2X0L A;  1U3E M;  1HBX G;  5IT9 K;  2HYF A;  4HF2 A;  1J9I A;  2O0Y A;  3F72 A;  4L9N A;  1LDJ A;  5J6X A;  4QWQ A;  2FBI A;  4N9H A;  3I58 A;  4ZH4 F;  2E1N A;  5J8F A;  4TV7 A;  3OOP A;  2W24 A;  1FOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...