1VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
95
Chain Sequence
MQFKVYTYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Plasmid
molecule keywords CCDB
total genus 26
structure length 95
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vubA00
5CCAA 5CKEA 4MZTA 1X75C 2C06A 4MDXA 4VUBA 5CQXA 4ELYC 1UB4A 5CK9A 5CKFA 5CQYA 5HKCA 5HK3A 5CKBA 3G7ZA 3TCJA 3JRZA 4HKEA 4OF1A 4ME7A 5CKHA 1VUBA 2KMTA 3HPWA 4MZPA 1NE8A 5CR2A 3VUBA 3JSCA 4MZMA 1M1FA 5DLOA 4ELZC 2MF2A 5CKDA 5HK0A 3NFCA 2VUBA 5CO7A
chains in the Genus database with same CATH superfamily
2JTEA 3NPFA 5CCAA 4QVZA 5FU6B 3UT1A 3I56Q 1GCPA 1N8RR 5LL6S 3OS0A 2DILA 4PK4A 2RK2A 5CQYA 2DNUA 1MNEA 3QJYA 1QKXA 1G3WA 1ARKA 2FPFA 4HKEA 4M7DA 1NBEB 3VS4A 3ZFJA 1CKBA 4LDWA 2GCXA 4PJOD 4NS5A 1M2VB 1NE8A 4EPCA 2M02A 1YITA 1PRLC 4IUPA 3CXCP 4J7IA 3I5RA 1U8RA 1N5ZA 1H8KA 3HKSA 4M75E 1ZA1B 2E4HA 1YJWQ 1OX9A 1QMCA 4J9IA 2H3EB 3RUXA 2YUOA 2YWWA 2KXDA 3MP8A 3JCMh 1T0HA 1D1CA 1SSHA 1KD1U 4PJNA 3OYHA 2VUBA 4M78B 2EGEA 2IVWA 3NTIA 3VV0A 4PL6A 2DTIA 3MEWA 3VRZA 2B86A 3JCMf 1D0XA 4KULA 1Q86R 1OZ3A 1QVFA 1T3SA 2OTLT 6AT1B 5CVIA 1OPLA 3A8MB 3EG0A 3FDRA 2M0OA 2JT4A 3NFCA 2H8HA 4J9EA 3R6NA 2KT8A 4OVAA 1X75C 2D9TA 2JNGA 5GMKh 5CK9A 3CCSQ 1M8VA 3OYAA 2FZCB 3QSUA 2HKQB 2K3BA 1U06A 3P8DA 2HQXA 4FL6A 3JCMb 3JCMd 3BFMA 2RJDA 4OP0A 3I55Q 1VQ8A 1IGQA 3FB9A 1S1NA 3QYGB 1FX7A 2HD0A 1HXDA 3OYBA 4FW2A 3I55T 3QZ5B 4RTVA 4HCCA 1VQMA 4GBQA 2DF6A 1GCQA 2DL4A 5ECAA 5L8RE 2MCNA 2KNBB 4LXCA 1X2QA 2BZ8A 4ZTFA 2AZVA 2E65A 3QG1A 5D6XA 2EQKA 2A0FB 2JTMA 4AFZC 5C0MA 4J6WA 1PCXA 1Q7YU 4GLMA 4C8QB 5IN1A 4C8QD 2RN8A 2K5IA 4HVWA 2YRVA 3VS6A 5GMKj 1LOJA 2NWMA 2XDBA 2K9GA 2DK3A 1D3BB 5CQXA 3AHUA 1M30A 4WF2A 2EGAA 3JCMP 2JMCA 3DKMA 2X9HA 4C8QG 4PJMA 4J9CA 2QDYB 2QA4T 1QWEA 1WJQA 3OYDA 1SG5A 2E70A 3RNJA 2DJZA 3C95A 1YWPA 1VQ5Q 3CPWS 3QHSA 4BI8B 2FVUA 3LWIA 3M58A 2DIGA 2EQJA 2ED1A 2PZ1A 2CH4W 4P5NA 4JJBA 2EVRA 3CBPA 3F70A 1BIAA 3CPWA 4A4GA 5KYYA 2DA9A 5FWBA 3M56A 4C8QF 1OV3A 1Q82R 1VQ9A 3JB9I 4FYWB 4KH0B 4J6YA 1JB0E 4BE0A 2DL8A 4XU3A 2OTJA 2KXCA 1W1FA 4WCIA 2DPPB 1K9MU 2G3RA 2EFIA 1KFZA 2IPOB 4EMHA 1HD3A 1M3CA 3ZL7C 2O01E 3TVTA 3CXCA 2SEMA 4CI0C 2F5KA 3MHXA 3EG9B 1JXOA 2KDSA 3FIFA 1B34B 3JRZA 2ABLA 4FIBA 1ZBJA 4EMKA 2OTJT 2QK0A 2P4TA 2DXBA 1WHGA 3X25B 1EZZB 4R55A 2M1HA 2SRCA 4MMKA 4FYXB 2EBPA 2X4JA 4RTUA 3CMAT 1UJ0A 1RLPC 2LQ8A 2DZ9A 2PVDB 3CCJQ 4FT2A 5FU7B 1ZSZB 4DOWA 4M77F 1M90U 3A8GB 1YN8A 1A0NB 1I5LA 3L2RA 2QGGA 3WXMB 3V7SA 2DD4A 4ZN1A 5GAN6 3V7RA 2LJ3A 2EIFA 5GAN5 3X24B 3M0RA 4HT8A 1XOVA 4ZN3A 2K3XA 2LCSA 4AG1C 5LJ3e 4JS4A 4R56A 3G7ZA 1EFNA 3JCMX 3OYJA 1IZ6A 3E2UA 2LCCA 4OMNA 4IUTA 3OSSC 4YTLA 2P0PA 2RB6A 1CSKA 2KBTA 2V8JA 1QP3A 2ATCB 5FRMA 4LNPA 4FU6A 5FU7C 2WSCE 1WHKA 5HCKA 4JUVA 1S72Q 1RUWA 3JCMW 2QQBA 1VQ7Q 1G3TA 5GAMd 2E6ZA 2GGRA 5GAMh 1KK7A 1YCYA 2QQSA 4C92A 4J9BA 1VQKT 2E12A 4AFQC 4TVRA 5LJ3f 2CP3A 2CP0A 2EPDA 4CC7A 3CCMT 2DVJA 1BB9A 4C92D 2HMAA 2CKKA 1YIJT 4M7DF 1PSFA 1K76A 2ZPHB 5C6SA 2KY9A 4B9WA 1PWTA 1K4US 1H641 1PM3A 2DMOA 5I2MA 1VUBA 3PVQA 3A8OB 4E2FB 1PD1A 5HK0A 1PSEA 2MWOA 2VKNA 4BY6B 5GANe 1UHFA 3CCJA 4L5GA 1QQJA 1LJOA 3P8HA 5DM7R 2HSPA 2PUKB 4M7AD 2X3XD 3T9NA 4A4HA 5I22A 2DYBA 1YJWA 3A8LB 5KCOA 2NUTB 5GMKl 2HQHA 5M9OA 2CZ1B 5CR2A 3JSCA 4NOYA 1G3SA 4OGCA 1VQ6T 4J5YA 1PKSA 4F7UB 3OBYA 4FM4B 2EJGA 3EGXA 3X28B 2HAXA 1I1JA 3UA6A 4XU0A 2MOXA 3O8VA 4II1A 4JZ4A 2F69A 3ULRB 4M77E 2V1QA 1YCSB 4FSSA 5DLOA 3QPHA 4O6JA 2ZCFB 2CSIA 3JCMJ 1E6GA 4KGZB 2ZPBB 4MZTA 1T3LA 3CCSA 3META 3G71Q 2O9SA 1PC0A 2LT1A 3UF4A 2A08A 2EGCA 2KMTA 1Y7XA 2HL5C 1D1BA 2LMJA 1S72T 1Q86C 2V1RA 2LDMA 1MMDA 4LDYA 1KQSA 5CO7A 3HFOA 2OI3A 2KE9A 2LX7A 4C92C 3OYEA 2DETA 7AT1B 3TSZA 2KK4A 4Y92A 1VQ5T 1YITT 4B6MA 3CC2A 4AMCA 3CCRA 1WHMA 2YRDA 2EYQA 4CC2A 4XK8E 4KGXB 4FYYB 4JDSA 1QVFS 3GNFB 1VQ7A 3CC2T 1ZSZC 2QG9B 1VQ9T 5FRNA 3OS2A 3NTKA 5LJ3j 2J05A 2GTJA 2JTFA 2QQAA 3QDRB 3J81E 1NEGA 4BUGA 2JJ9A 4M78A 4KUIA 3H8ZA 2FYKA 1UECA 4C5HA 3S3OA 1VQOT 5CKEA 1AOJA 3EHQA 1ZUYA 3EFOA 1ABOA 2RHZA 3TEEA 1E6HA 3C0CA 1UDLA 4C92G 3RKWA 3DB3A 1UEBA 1N9SA 4OF1A 2KRMA 3EG9A 2HNIA 1IRXA 2DZCA 2DXCA 2YHTA 4PJOE 2CT4A 1D0ZA 2LQWA 3CCEQ 1K73R 4O5VA 1X6OA 5LJ3h 1Y71A 1T0JA 5D6YA 1HJDA 5LJ3d 1W2BS 1AVZC 2DIQA 5A0DA 1FYNA 4MDWA 2RJCA 5GAN7 4RCCA 4F7UA 4DA4A 1AZEA 2OAUA 1RLQC 1OX8A 1WA7A 2VV5A 4AT1B 3HRTA 3MEVA 4C8QC 3QYHB 3G4SA 4XU1A 3C12A 2CUDA 5HY6A 3VS0A 1AZGB 2AHJB 4PFOA 4M78D 1C0MA 3THKA 3P8BB 2I2LA 4PJOA 4A63B 5GANj 3CD6T 4CC3A 3E9FA 3VUZA 3FLGA 2L2PA 1KSWA 3D7SB 4JRIA 4AFSC 4OMLA 5IHIA 1QW1A 1RAIB 3KFVA 2JW4A 1JO8A 2ZPEB 2BE7D 3V7CA 2K7AA 1M27C 4J83A 1YITQ 1Y57A 1N9RA 1M1KR 4MZMA 4JRPA 1QVPA 2C0TA 1R0BG 5GAN2 1XTDA 1WI7A 4HCBA 2EJFA 2EWNA 3M4YA 1B3QA 1B34A 1YIJQ 3I56A 2L5QA 4L6V5 2JOYA 5EC7A 2MPXC 1VQOQ 4GLKA 4N4IA 3RKXA 5KYYB 2I0NA 2L89A 3VJPA 2E1HA 2FPEA 2ZZDA 3EGUA 1BI0A 3FEOA 3PMTA 1YJWT 1KQSP 1AWJA 1PHTA 2DL7A 3LGFA 2W0ZA 5GAOm 1IHVA 1TOVA 4C92F 5CKFA 2CSQA 4HCZA 4QQGA 3V8LA 1VQ8T 1M90R 4X9DA 3RDVA 2AIRB 5GANf 2MWPA 4ESRA 4IURA 4LDVA 4Z89A 4FYVB 3V8JA 2OX7A 5GAOn 3CCUT 3EHRA 1KQSS 2BIVA 2XHCA 4E47A 1G8XA 5CKBA 2F5TX 2QA4Q 1IO6A 3CCUA 2KROA 3VKIA 5I21A 4LD6A 4DBQA 3X20B 4QKUA 1YI2T 1MMGA 5KCHA 2FB7A 4L59A 1YI2Q 4JLIA 1NLOC 2ENMA 5IH2A 4F04B 4OMFB 2V8IA 2VGNA 2GQIA 3HTRA 1WLPB 3MP1A 1M3BA 1RI9A 3JCMg 1SEMA 1UGQB 2AT1B 3CC7T 5GJWB 1YI2A 3FJ5A 1KD1C 4J9FA 5IHNA 1BI3A 3CC7Q 1TS9A 4BDZA 3SHWA 2RJEA 5AT1B 1UB4A 2QGFB 1HYOA 2KEAA 4J7FA 3QUIA 3RIRA 3MO8A 4X1VA 2HBPA 3VUBA 2OTJQ 2R58A 1VQPQ 1QVGP 1H3HA 2E41A 4BE1A 1TTHB 3RMQA 4OB2B 2CT3A 1M1KU 1KG1A 3CCET 5GAMg 5FU6C 1WFWA 4LN2A 3BY7A 2LZ6B 1IGUA 3EH2A 3OYMA 1SKUB 4M7DC 4OMMA 2CZ6B 1NG2A 2ZPGB 2J6KA 2WSFE 2VGMA 3TU4K 3J7AF 5FWCA 2W10A 1X6BA 2YRCA 1NEBA 4BI3A 2KAFA 4XTYA 2LNVA 4E7JA 2J7IA 2CS7A 2JS2A 1H3ZA 1VYVA 2DBMA 1VQLQ 1D3BA 2XDDA 2FPDA 1GXIE 5LJ5g 5KYXA 1JQQA 3L2ZA 2COZA 3QO3A 1U5SA 4E7LA 2BZXA 1IXDA 3E19A 2LQNA 3A8HB 4F7UE 1OI1A 2P0QA 1NYFA 1VQ6A 1MUZA 2X35A 5DY9A 3H0IA 2QXFA 3VS2A 4BDYA 4C0DB 3TSWA 1Q81U 4HVUA 2DXUA 2RI3A 1VQPA 3M5AA 3S6WA 5GMKi 3CCMQ 2CP6A 1OU8A 4LDXA 4M75A 5KYWB 4NL2A 1Z9QA 1RABB 3H6ZA 4OB3B 1FMWA 5IAYA 3G4SQ 1AWXA 2EW3A 4XTZA 4RCBA 3AT1B 5D7UA 1YJNT 2KGTA 4PLLA 3CC7A 3VYGA 1BI1A 2PNIA 5GAN4 2QYZA 2BUDA 4ELYC 3ZBDA 2F2WA 2FL7A 4X34A 1OQKA 2DL5A 4A4EA 1K9MR 3PIPA 1TH7A 2GFUA 2DTOA 2ECZA 2Z0WA 4JJCA 1M2VA 2HSEB 2RHUA 2KSSA 1YJ9Q 4M7DB 1SRLA 4ANJA 1MMNA 1HSQA 1WHHA 2X4YA 2D0QB 2EYWA 3ER0A 3PT9A 3OYLA 4CC4B 2PTKA 1X2KA 1K73C 1JJ2A 2PVOB 4PJOF 4ZTJA 3TQ7P 2LCLA 4EMGA 1V29B 1YHQQ 5KYXB 4ME7A 3OMGA 3SDZA 2KQWA 1NM7A 1RI0A 1M8MA 3CCLQ 1GL5A 5LJ5e 1JJ2S 3M55A 2QTVA 3JCMc 1W6XA 3VYHB 4ZNXA 4QW2A 2K6DA 5GAOl 4M7AA 1GCQC 2ROTA 4A54A 1Q82C 4Z8AA 1UTIA 1RAAB 2M16A 4QT7A 2KYMA 5GAOq 1Q81R 1Y0MA 2VYTA 3SEMA 1YNZA 1KC8C 3GIBA 4RTYA 3L2WA 3CCLA 3M54A 1OU9A 4C0DC 1ZQ1A 1WNLA 2QEXA 2JVVA 5FROA 1I8FA 3VRYA 1OZ2A 2A36A 3CCVT 3CMEQ 1QCOA 1QVGA 4E7ZA 4PLIA 2FRYA 3GPLA 3CMET 2NYSA 2FG0A 4E7KA 2QEXT 3CCVA 3OYNA 2J6OA 4OB1B 3HRUA 1FMVA 2CP7A 2DJQA 4RTZA 1Q86U 3M0QA 3LLRA 2YDLA 2BTTA 5J26A 2QEXQ 2Y4XA 4RTTA 1AHJB 1SPKA 1QVGS 2P84A 3CCQA 1Q81C 3EFSA 3JB9G 1KHIA 2V8KA 4ZGJB 4M7AE 1UUEA 3BDUA 3OS5A 3RMSA 3MPUB 3G4ST 4M75D 4C0GA 1BCOA 3CC4Q 2D0NA 2MK5A 1VQKA 1WHLA 3G1JA 5L23A 1NPPA 3LGLA 3CD6A 3FJPA 2AKKA 3L42A 2DD5A 5I11A 2VC8A 3QBYA 3HL8A 4DBRA 4GY5A 4LDUA 3ME9A 2ROLA 3M57A 3M4GA 1VQ4Q 2RPNA 4IIOA 4D6WA 4E6RA 1NJIU 3REAB 1TUCA 2EQIA 4IIMA 3QZ9B 3G6EQ 4RMOA 3E1SA 4BACA 1ZX6A 1GBRA 4KH1B 4M7AG 2LC4A 2HZYA 2D8JA 3A98A 1VQLT 1Q7YR 4BI4A 1OPKA 4AFUC 3JB9H 1D09B 1AT1B 2G6FX 2A3LA 4XAXB 4VUBA 2BKDN 4FW1A 5LJ5f 2YUPA 2CUBA 5GAMj 4C0ZA 3M0PA 2CH4A 3EGXB 2PUOB 3CEYA 1FXXA 1PD0A 2NUPA 3L2VA 2KR3A 3C94A 3UWNA 2YXYA 2Y90A 2D1XA 3SWNA 2MF2A 2EJ9A 2FEIA 1QWFA 1JU5C 1WJSA 4HT9A 1RL2A 2QQRA 3GBQA 4DEXA 2O31A 3IQLA 4OMOA 3M53A 2JM8A 4OGEA 5J3BA 2VXFA 2MAMA 1N8RC 2DL3A 4M7AC 1G83A 1MV0B 4IUUA 1FWZA 1VOMA 2COWA 5KYUB 4HCKA 1GRIA 4C8QE 4M78F 4MDXA 5GJVB 2LJ0A 2OTLQ 5I2SA 1M3AA 4JLGA 4RTWA 1QP2A 3GNGA 4E7IA 2CP5A 1JJ2P 1I07A 3LH0A 4BD3A 2K3YA 2PQWA 1K0SA 2IG0A 2BE9B 1KD1R 5KYNA 3MEAA 3U23A 2AKLA 3KBGA 2QDLA 1UGPB 2LJ1A 3PIOA 2DBKA 3I5SA 3CCQT 2YT6A 4KGVB 4A4KA 4LD9K 3NGPA 3OS1A 2PVGB 2OJ2A 3CMAQ 1M1FA 5AYFA 3H0FA 4KBMB 1YJ9A 1RACB 3L2UA 1XNIA 3G6ET 3A5ZB 3DB4A 1C6VX 2OTLA 3A1PA 3V8KA 2MI6A 3EAEA 2R57A 1VQ6Q 2YUQA 1VQ4T 1N27A 3QDFA 3UA7A 3I35A 2H3JA 4XQ3A 1E7OA 4ZGEB 3OYYA 1GBQA 2RQTA 1WZOA 3CPFA 1BKBA 3CCJT 1AWWA 2P0KA 5LJ5d 3GOXA 8AT1B 2O4XA 4DEYA 5GAN3 2VXEA 5A0GA 3CCUQ 2K5LA 2E64A 2KT1A 4HVVA 1VQNA 4J9GA 2M0YA 1RAHB 3C4SA 1ZHIA 2MMPA 4X9CA 1NLPC 3SWNB 4KRTA 4R0KA 2HBWA 4IUQA 1TU0B 1M9SA 2LX9A 1VIFA 3SB2A 2YLCA 2X3WD 1MV3A 1UG1A 1K0XA 2JS0A 3GF5A 4F17A 1LPLA 4CRIA 3OW2A 1VQKQ 3EFOB 5EG2A 2CGHA 4MMLA 3M0TA 4ATOA 2ZPFB 4PNOA 3JCMe 2VWFA 2A37A 2B8AA 2XICA 3MKDA 4QQDA 4D8KA 3HHTB 3INZA 1JBMA 4HA8A 1Y96B 4PJOB 5KH6A 4XU2A 3LH5A 1N8RU 3QWYA 1VQNQ 1K8AC 2DVEA 3OSVA 3CCVQ 2C06A 3PNWC 3UDCA 2IIMA 1RADB 2YLBA 1VQMT 2QA4A 1JEGA 1X69A 4OMPA 5LJ5h 4M78C 3GP8A 2DEUA 1RAFB 2EAYA 1VQ5A 1B07A 2NUTA 4ORZA 3CCRT 4EIKA 4WTOB 3EFRA 1VQPT 5IXFA 3OYFA 3EG3A 4D8DA 4JZ3A 1WQWA 2K57A 3CCQQ 1KC8R 2J6FA 3NHNA 5D6WA 3HPWA 1U1TA 3FRNA 1S72A 2JMAA 2L3RA 4LUEA 2M9UA 4M77A 3VS5A 2K4YA 1O9SA 4A53A 2XK0A 1DJ7B 3KUFA 3H41A 1TSFA 3G6EA 4UC4A 2LVMA 5GAOp 2VASA 3OW2S 4FSXA 1QCNA 1VQ4A 2QASA 2F2VA 2LNHB 3TREA 5GANd 4PFZA 4QVCA 2KRSA 3VS3A 5GANh 4J9HA 1PKTA 2K79A 4K11A 1Y96A 2JN0A 4Z88A 4RKUE 4BB7A 2CDTA 1OULA 3RR6A 4EMKB 2K2VA 3OYKA 4N4GA 1QLYA 4RG2A 1VQNT 2EKOA 5IT9E 2C0IA 2FRWA 1WQ7A 4RTXA 3EGDB 3PGGA 3LX7A 1Q82U 2RQVA 2XIDA 2JUFA 4M77G 1ZUUA 1UHCA 1G2BA 4M75F 4Q5WA 3CXCS 2F2XA 2DFUA 2XDPA 2VB6A 3M59A 4M77C 2XKOC 1Q7YC 2PU9B 1KQ1A 2DXTA 2EKHA 3RKYA 1XJWB 4M77D 2DKGA 2C0OA 1IREB 1I4K1 1F1BB 2NUPB 4EMKC 2L3PA 1ABQA 3JV3A 3RERA 5A2QE 3BW1A 4AG2C 4E7HA 1M5Q1 3JB9D 4PJOG 2XMFA 1K8AU 1TXQA 2ZGWA 4XTXA 2WACA 1R77A 2LRQA 1W2BP 4C8QA 2X51A 2RHXA 2QTXA 2L0AA 2MYSA 1UGRB 3O5ZA 3CCRQ 3JCMQ 3CCMA 1EX4A 2O9VA 2RH2A 3REBB 2DLPA 1YIJA 2FZKB 4DOVA 3NTHA 3J80E 3OW2P 4OMQA 1YJ9T 5CKHA 3OB9A 4KT0E 1Y07A 3I9QA 4J9DA 4F16A 3OYCA 3I56T 2CZ0B 2X4WA 2RQWA 1K9AA 5CKDA 1Z9ZA 1KJWA 2CREA 4M7AF 2GBQA 3SD4A 2WSEE 3OYGA 2AZSA 3UPUA 3LW5E 5LJ3g 2NUZA 1UGSB 3G71A 3SFMA 2DERA 3URGA 1UFFA 3MJXA 5FW9A 4PJOC 3HFNA 2XU8A 1BBZA 2E5KA 1ACMB 1Q95G 2XI9A 4B9XA 1OEBA 1SRMA 4C5GA 1CKAA 4C92E 1VQLA 2EYZA 3VS1A 2LQKA 1X43A 1TUGB 1MGQA 3DLMA 2O4XB 3OBWA 1W4SA 2DX1A 2RM4A 3PTAA 2ZPIB 2KI7A 1C1AA 3E9GA 2RNAA 1H92A 4JPBW 5HKCA 2FZGB 4RG8A 1OYXA 3CC2Q 2DYIA 2HCKA 1ZSZA 2ED0A 3EH1A 1ZBXA 5GMKe 1WIEA 1JRIA 2E5QA 3WVEB 1QKWA 2DRKA 3VU3C 1P92A 3WVDB 4V2SA 4C92B 3M0SA 3ZEHA 2GFAA 2EQMA 1R8OB 5GAOr 3CC4A 1VA7A 1J3TA 4IUVA 1RAEB 1WJRA 4ZGDB 4NL3A 2RQUA 3H0HA 1B7TA 2M51A 1QCFA 3PVLA 3CCST 2XD0A 3N5BB 2YSQA 2BZYA 2LT4A 1G3YA 4IKFA 4JS5A 1TWBA 1GFCA 3KXTA 3OQ5A 2HKNA 2RF0A 3JCMV 3QWXX 4M7AB 5KE2A 3HRSA 1KIKA 4Z02A 3TCJA 1VYUA 1K1ZA 4DBHA 3X26B 1WPYA 1XQHA 2E3HA 4JRKA 3UATA 5KE3A 1LNXA 4M7DG 2Y4YA 3QIIA 2D8HA 2FO0A 1K8AR 4N0AA 1UE9A 1SF9A 2HEQA 2QAZA 2L3SA 1U1SA 1BK2A 3OMCA 1WDXA 4LE9A 5CIUA 1BU1A 4OB0B 5KYUA 3OY9A 1X27A 1SHGA 1D1AA 1PNJA 1ZSGA 3FC3A 3ASKA 3JAME 3S3NA 2KYBA 5J39A 5GMKm 1IB8A 3S3MA 1ZLMA 5GANg 4J8OA 3EG2A 4A4FA 2F1LA 1VQOA 2RA2A 1GFDA 4M7DE 1SSFA 2DEQA 3QKJA 4LUDA 3SWNC 2P4RA 1U3OA 3VS7A 2GF7A 3DLLA 1KQ2A 1TUDA 4C5IA 1HK9A 8ATCB 4FCYA 4M7DD 1YJNA 3LYIA 1YWOA 1D0YA 4Y91A 2RJFA 4HXJA 2COYA 3PFSA 4C0FA 1W2BA 3CBOA 2AK5A 1K73U 1YFNA 2QI2A 1VQ7T 1M1KC 3MP6A 1AD5A 1VIEA 1M1GA 2CP2A 1AWOA 2HL3A 3EG1A 3CMAA 2CYZB 1BIBA 2KVQG 3HP9A 3M9QA 2KRNA 1N6AA 3BE3A 2X4XA 1WXTA 4ELZC 1KC8U 2XG8D 1IHWA 1BI2A 5GAN8 1WX6A 1V1CA 2V26A 1YBYA 1UJYA 3CMEA 2DTHA 1WYXA 1YJNQ 2O2OA 3GLXA 2RHYA 5FLXE 1I0CA 3CBMA 3M0UA 2RI2A 5LJ5j 3R6OA 4PKCC 1EIFA 5GAMf 4DQ2A 1ZA2B 2L8DA 1I5OB 1VQ8Q 2MIOA 2DAQA 4FT4A 2JM9A 4XTWA 1M90C 1AEYA 9ATCB 3H9NA 3HSBA 1ZUKA 4N0AC 1LVKA 2E10A 1WHJA 1FMKA 2YUNA 1VQ9Q 1YHQT 1MHNA 3CQTA 1OOTA 1O75A 1QVFP 4Y28E 2J06A 2GNCA 3CCLT 2EYXA 4F7UG 5CAIA 2JZ2A 2RO0A 5IXBA 1NJIR 4JRQA 3BDLA 1YHQA 3MCAB 1K9MC 1SHFA 2RD1A 2E6NA 3PMIA 1BYMA 1MNDA 2RQRA 4M75B 5KYWA 2RHIA 4M78E 3NMZC 5GAMe 2EQUA 1WXBA 3RESA 4J6XA 2R5AA 1UGVA 1KHCA 4QVDA 1PG5B 2CZ7B 4N4HA 4XTUA 2RK1A 1M4ZA 5IHKA 1X01A 4PJLA 3L1AA 2ZAEA 1JXMA 2RI5A 4KUDK 1NJIC 3G71T 4BE2A 4M4ZA 3CCEA 1WXUA 2DRMA 3LWHA 1NPRA 4QQ6A 2K2MA 3QJ6A 3Q1JA 3OYIA 4DBFA 1BCMA 2DM1A 2OAWA 4M78G 4BY6C 4PJJA 1M2OA 4M75C 1YP5A 1VYTA 3EGDA 3L2QA 4RUGA 3JB9F 4XTVA 2NLUA 1G5VA 2HDAA 4F7UF 4PFPA 2GQVA 4F14A 3RBBB 2JXBA 5HK3A 2LP5A 4C5EA 2R5MA 4JJDA 1RAGB 2DO3A 1VQMQ 2DE0X 1NZ9A 1V76A 2L3QA 4JJNK 2K5FA 3PE0A 2A7YA 2O88A 1LCKA 3CD6Q 1W70A 2ESWA 5A0LA 3I55A 3MEUA 2QQ9A 2GTOA 1PRMC 2VVKA 1NYGA 2LTOA 3JB9J 2E3IA 1TG0A 1MMAA 2A28A 1X6GA 5DLQE 2FHDA 2EYYA 4M75G 3OA6A 3QXEB 2D6FA 2HQEA 4MZPA 4M77B 3CPWP 1I81A 2RMOA 4EDUA 1WGSA 1R0CB 4E7SA 3CC4T
chains in the Genus database with same CATH topology
2JUFA 4M77G 5CCAA 3HFOA 4QVZA 4M75F 4Q5WA 5FU6B 3UT1A 2X4YA 2D0QB 3CXCS 3ER0A 3PT9A 4C92C 5LL6S 3OYEA 3OYLA 1K73C 2XDPA 3OS0A 1JJ2A 2PVOB 3M59A 2KK4A 4PJOF 2RK2A 1VQ5T 1YITT 5CQYA 4M77C 3QJYA 4ZTJA 2XKOC 1Q7YC 1G3WA 2PU9B 2LCLA 1KQ1A 4HKEA 3CC2A 2DXTA 1V29B 3ZFJA 4EMGA 3CCRA 3RKYA 4M7DA 4LDWA 2GCXA 4ME7A 4PJOD 4NS5A 3OMGA 1NE8A 2EYQA 3SDZA 4XK8E 4M77D 2KQWA 4EPCA 2DKGA 1RI0A 1YITA 4IUPA 4J7IA 5LJ5e 4JDSA 1QVFS 1IREB 1JJ2S 3GNFB 3M55A 1I4K1 3JCMc 4EMKC 1U8RA 1VQ7A 3HKSA 3CC2T 3RERA 3VYHB 4M75E 5A2QE 3BW1A 4E7HA 1VQ9T 4QW2A 5FRNA 5GAOl 3OS2A 3NTKA 5LJ3j 4M7AA 1M5Q1 3JB9D 4PJOG 4A54A 1K8AU 2JTFA 2QQAA 2ZGWA 1Q82C 3QDRB 3J81E 4XTXA 2WACA 2M16A 4BUGA 3RUXA 2LRQA 5GAOq 4M78A 3MP8A 3JCMh 4KUIA 2VYTA 3H8ZA 4C8QA 2RHXA 2FYKA 2QTXA 4C5HA 3S3OA 1KC8C 1KD1U 3GIBA 3L2WA 3CCLA 3M54A 3OYHA 1VQOT 2VUBA 4M78B 4C0DC 1ZQ1A 5CKEA 1WNLA 2QEXA 2JVVA 2IVWA 1I8FA 3NTIA 1OZ2A 5FROA 3CCVT 1UGRB 2RHZA 3TEEA 3VV0A 4PL6A 1QVGA 3JCMQ 3CCMA 4C92G 2DTIA 3RKWA 2RH2A 4PLIA 3MEWA 3DB3A 1UEBA 3GPLA 5CO7A 1YIJA 3CMET 1N9SA 4OF1A 3NTHA 4DOVA 4E7KA 3J80E 2HNIA 3JCMf 2QEXT 3CCVA 4KULA 2DZCA 3OYNA 1YJ9T 5CKHA 4OB1B 3OB9A 3HRUA 1OZ3A 4KT0E 1Q86U 1QVFA 2DXCA 1Y07A 2OTLT 3OYCA 2YHTA 2CZ0B 2X4WA 3A8MB 5CVIA 3I56T 4PJOE 3LLRA 3FDRA 5J26A 2M0OA 2Y4XA 5CKDA 1AHJB 3NFCA 1QVGS 3CCQA 1Q81C 4M7AF 3EFSA 4O5VA 3JB9G 1KHIA 2V8KA 3SD4A 4ZGJB 1X6OA 4OVAA 5LJ3h 1Y71A 4M7AE 1X75C 2WSEE 3OYGA 2D9TA 5D6YA 3BDUA 3OS5A 3RMSA 2JNGA 5GMKh 5LJ3d 3UPUA 3G4ST 3LW5E 5CK9A 1W2BS 4M75D 4C0GA 5LJ3g 2DIQA 1UGSB 5A0DA 1M8VA 1VQKA 3OYAA 3G71A 3SFMA 3QSUA 3URGA 4MDWA 3P8DA 4PJOC 2RJCA 2XU8A 1NPPA 2HQXA 3HFNA 3LGLA 3CD6A 4FL6A 5GAN7 3JCMb 3FJPA 4RCCA 3JCMd 3BFMA 2RJDA 2XI9A 3L42A 4B9XA 4OP0A 4F7UA 2DD5A 4C5GA 4DA4A 4C92E 2OAUA 2VC8A 3QBYA 1VQLA 3HL8A 2LQKA 2VV5A 4GY5A 4LDUA 1MGQA 3DLMA 3FB9A 1VQ8A 2O4XB 3OBWA 1W4SA 1FX7A 2HD0A 1HXDA 3HRTA 3M57A 3M4GA 3ME9A 2RM4A 3QYGB 3PTAA 2ZPIB 4D6WA 3I55T 3QZ5B 4HCCA 3MEVA 4C8QC 1VQMA 3E9GA 1NJIU 3QYHB 3G4SA 4XU1A 5L8RE 3C12A 5HY6A 5HKCA 3QZ9B 4RG8A 1OYXA 2AHJB 4RMOA 4M78D 3E1SA 4BACA 3P8BB 2I2LA 4ZTFA 4PJOA 1ZBXA 2E65A 3QG1A 5D6XA 5GMKe 1JRIA 2E5QA 5GANj 3CD6T 2EQKA 4M7AG 2LC4A 3WVEB 2JTMA 3E9FA 5C0MA 3VU3C 4J6WA 3FLGA 3VUZA 1Q7YU 1P92A 3WVDB 1VQLT 4V2SA 4C92B 4C8QB 5IN1A 4BI4A 4C8QD 4JRIA 2K5IA 2YRVA 3ZEHA 5GMKj 2GFAA 1LOJA 1QW1A 2EQMA 3JB9H 2XDBA 1R8OB 2DK3A 5GAOr 1D3BB 3CC4A 2A3LA 4XAXB 4VUBA 2BKDN 5CQXA 4IUVA 5LJ5f 3AHUA 1WJRA 2ZPEB 4C0ZA 4ZGDB 5GAMj 4WF2A 3V7CA 4NL3A 3JCMP 3DKMA 3CCST 2XD0A 4J83A 3N5BB 2PUOB 1N9RA 1FXXA 3CEYA 2LT4A 4C8QG 3L2VA 3C94A 3UWNA 2QDYB 2Y90A 2QA4T 4MZMA 1G3YA 1WJQA 4IKFA 4JRPA 4JS5A 1QVPA 2MF2A 3SWNA 3OYDA 2EJ9A 3KXTA 5GAN2 1XTDA 1WJSA 3OQ5A 2E70A 4HT9A 4HCBA 2DJZA 3C95A 2EJFA 3JCMV 1RL2A 2EWNA 2QQRA 4M7AB 3HRSA 3M4YA 5KE2A 3CPWS 3QHSA 1B34A 4BI8B 3I56A 2FVUA 3LWIA 4Z02A 3TCJA 3M53A 2L5QA 3M58A 2DIGA 2JOYA 4L6V5 2EQJA 3X26B 4GLKA 4P5NA 4OGEA 4N4IA 5J3BA 1WPYA 2VXFA 1XQHA 3RKXA 2MAMA 1N8RC 4JRKA 5KE3A 3CBPA 4M7AC 1LNXA 2L89A 3VJPA 4M7DG 4IUUA 2Y4YA 2E1HA 1FWZA 3F70A 3QIIA 1BIAA 3CPWA 2ZZDA 4A4GA 1BI0A 4N0AA 3FEOA 4C8QE 3PMTA 1YJWT 4M78F 4MDXA 5GAOm 3LGFA 1U1SA 3M56A 4C8QF 4C92F 5CKFA 5I2SA 4HCZA 4JLGA 1QP2A 3GNGA 4E7IA 3OMCA 1VQ9A 5CIUA 4QQGA 3LH0A 3V8LA 3JB9I 1VQ8T 4X9DA 4BD3A 4J6YA 1YJNT 1JB0E 4BE0A 2K3YA 2PQWA 4OB0B 4XU3A 5GANf 2MWPA 2OTJA 3OY9A 2IG0A 3FC3A 3ASKA 4IURA 3JAME 4LDVA 3V8JA 2DPPB 3S3NA 2G3RA 5GAOn 2EFIA 1K9MU 5J39A 5GMKm 3MEAA 4EMHA 3KBGA 3CCUT 1UGPB 3S3MA 2O01E 3CXCA 5GANg 4J8OA 3PIOA 4CI0C 1KQSS 3CCQT 2F5KA 2BIVA 2XHCA 4A4FA 1VQOA 2RA2A 3MHXA 4E47A 4A4KA 4LD9K 4M7DE 1SSFA 2DEQA 2KDSA 3FIFA 3QKJA 1B34B 5CKBA 3SWNC 3JRZA 2F5TX 2GF7A 3DLLA 4FIBA 1KQ2A 4EMKA 3OS1A 4C5IA 1HK9A 3CCUA 4M7DD 2OTJT 1YJNA 3LYIA 3VKIA 5I21A 4LD6A 4Y91A 3X20B 2PVGB 2P4TA 2RJFA 2DXBA 1M1FA 1YI2T 5AYFA 4KBMB 3PFSA 3X25B 4C0FA 4R55A 1YJ9A 2M1HA 1W2BA 3L2UA 1XNIA 2FB7A 3A5ZB 3DB4A 3CBOA 4MMKA 5KCHA 3G6ET 2X4JA 2OTLA 4L59A 1K73U 3CMAT 3V8KA 2MI6A 2QI2A 4JLIA 3EAEA 2LQ8A 2DZ9A 2R57A 4OMFB 2PVDB 2V8IA 2VGNA 1VQ4T 1VQ7T 1M1KC 1N27A 4FT2A 5FU7B 3MP6A 3MP1A 2H3JA 4DOWA 4M77F 1M90U 3A8GB 4XQ3A 4ZGEB 1VIEA 1M1GA 3OYYA 3JCMg 1I5LA 3L2RA 1UGQB 3CCJT 3CPFA 1BKBA 2CYZB 3WXMB 3CMAA 3V7SA 1BIBA 2KVQG 2P0KA 3HP9A 3M9QA 2DD4A 4ZN1A 5LJ5d 3CC7T 5GAN6 1N6AA 3GOXA 1YI2A 3V7RA 5GAN5 2EIFA 2X4XA 2O4XA 3X24B 4ELZC 1KC8U 1KD1C 2XG8D 1BI3A 4HT8A 1BI2A 1XOVA 5GAN8 5GAN3 4BDZA 4ZN3A 2VXEA 2RJEA 5A0GA 2K3XA 2K5LA 2E64A 1YBYA 3CMEA 2DTHA 1UB4A 1VQNA 5LJ3e 3OYBA 4JS4A 3GLXA 4R56A 3G7ZA 2RHYA 5FLXE 3C4SA 3JCMX 3OYJA 3CBMA 4J7FA 1ZHIA 1IZ6A 2MMPA 3QUIA 3RIRA 3MO8A 4X9CA 2HBPA 2LCCA 3VUBA 2RI2A 3SWNB 2R58A 5LJ5j 3R6OA 3OSSC 4IUTA 4PKCC 2P0PA 4YTLA 1EIFA 2RB6A 4IUQA 4DQ2A 5GAMf 1M9SA 2LX9A 2L8DA 1VIFA 2V8JA 3SB2A 1QP3A 2DAQA 2YLCA 4FT4A 5FRMA 2E41A 4FU6A 5FU7C 2WSCE 4BE1A 4XTWA 1M90C 3RMQA 3HSBA 4JUVA 4N0AC 4OB2B 2E10A 3GF5A 4CRIA 1M1KU 3OW2A 3JCMW 1YHQT 1KG1A 3CCET 1MHNA 5GAMg 2QQBA 5FU6C 1G3TA 5GAMd 5EG2A 2CGHA 2E6ZA 1O75A 3BY7A 4MMLA 4Y28E 3OYMA 5GAMh 1YCYA 2QQSA 4ATOA 4C92A 4M7DC 2ZPFB 4PNOA 3JCMe 3CCLT 1VQKT 4F7UG 5CAIA 2JZ2A 2B8AA 2RO0A 2XICA 2E12A 2CZ6B 4QQDA 2ZPGB 3HHTB 1JBMA 2WSFE 3INZA 4HA8A 4TVRA 3BDLA 5LJ3f 4JRQA 3MCAB 2VGMA 1YHQA 1Y96B 1K9MC 2RD1A 4PJOB 3TU4K 2E6NA 3J7AF 5KH6A 4XU2A 3PMIA 3CCMT 1N8RU 1BYMA 4C92D 4M75B 1K8AC 2DVEA 2CKKA 3OSVA 1YIJT 4BI3A 2RHIA 2C06A 2KAFA 4M78E 4M7DF 1PSFA 4XTYA 5GAMe 3PNWC 3UDCA 2LNVA 2ZPHB 5C6SA 4E7JA 2CS7A 2YLBA 1KQSA 2EQUA 2KY9A 3RESA 1VQMT 2QA4A 4B9WA 1H3ZA 4J6XA 1D3BA 1H641 2XDDA 2R5AA 5I2MA 5LJ5h 1VUBA 4M78C 3GP8A 1GXIE 2EAYA 1KHCA 4QVDA 3A8OB 1VQ5A 2CZ7B 4N4HA 5LJ5g 4XTUA 2RK1A 1M4ZA 3L2ZA 1X01A 5HK0A 3L1AA 1PSEA 3QO3A 4E7LA 2MWOA 3CCRT 2RI5A 3EFRA 4BY6B 5GANe 1VQPT 4KUDK 1NJIC 3CCJA 3OYFA 3E19A 4F7UE 3A8HB 3G71T 1OI1A 4L5GA 4BE2A 2P0QA 1LJOA 3P8HA 5DM7R 2PUKB 1VQ6A 1WQWA 2X35A 4M7AD 3CCEA 3T9NA 2K57A 4A4HA 3LWHA 5DY9A 1YJWA 1NPRA 3A8LB 4QQ6A 5KCOA 3QJ6A 2QXFA 3Q1JA 5GMKl 4BDYA 5D6WA 5M9OA 3OYIA 3HPWA 2CZ1B 4C0DB 1U1TA 5CR2A 4BY6C 1Q81U 3FRNA 3JSCA 4M78G 1S72A 4NOYA 1G3SA 4M75C 4OGCA 1VQ6T 2L3RA 2M9UA 4J5YA 4M77A 3L2QA 4F7UB 3OBYA 2DXUA 2RI3A 4FM4B 2K4YA 1O9SA 4A53A 2EJGA 1VQPA 2XK0A 1DJ7B 3JB9F 4XTVA 3M5AA 3KUFA 3S6WA 5GMKi 2NLUA 1G5VA 3X28B 2HAXA 3G6EA 4F7UF 4UC4A 2LVMA 4LDXA 4XU0A 2GQVA 4M75A 5GAOp 3O8VA 3OW2S 5HK3A 4II1A 4NL2A 2F69A 4FSXA 4C5EA 2R5MA 4M77E 1VQ4A 3H6ZA 2DO3A 4OB3B 3TREA 1NZ9A 5GANd 4JJNK 5IAYA 2K5FA 4QVCA 2A7YA 5GANh 4XTZA 4RCBA 5DLOA 3QPHA 4O6JA 4PLLA 5A0LA 3MEUA 3I55A 2QQ9A 2ZCFB 3CC7A 3JCMJ 1Y96A 3VYGA 2ZPBB 4MZTA 2JN0A 1BI1A 4RKUE 4BB7A 5GAN4 3CCSA 2BUDA 4ELYC 3ZBDA 3META 2FL7A 2LTOA 4EMKB 3JB9J 2K2VA 4X34A 3OYKA 4N4GA 4A4EA 2LT1A 3PIPA 1TH7A 4RG2A 5DLQE 2FHDA 1VQNT 2GFUA 4M75G 3OA6A 2EKOA 3QXEB 5IT9E 2D6FA 2DTOA 2HQEA 2KMTA 4MZPA 1WQ7A 1Y7XA 4M77B 1I81A 1S72T 2RHUA 2KSSA 3LX7A 3PGGA 4EDUA 1Q82U 1Q86C 1WGSA 2LDMA 4M7DB 4LDYA 3CC4T 2XIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCA A;  5CKE A;  4MZT A;  1X75 C;  2C06 A;  4MDX A;  4VUB A;  5CQX A;  4ELY C;  1UB4 A;  5CK9 A;  5CKF A;  5CQY A;  5HKC A;  5HK3 A;  5CKB A;  3G7Z A;  3TCJ A;  3JRZ A;  4HKE A;  4OF1 A;  4ME7 A;  5CKH A;  1VUB A;  2KMT A;  3HPW A;  4MZP A;  1NE8 A;  5CR2 A;  3VUB A;  3JSC A;  4MZM A;  1M1F A;  5DLO A;  4ELZ C;  2MF2 A;  5CKD A;  5HK0 A;  3NFC A;  2VUB A;  5CO7 A; 
#chains in the Genus database with same CATH topology
 2JTE A;  3NPF A;  5CCA A;  4QVZ A;  5FU6 B;  3UT1 A;  3I56 Q;  1GCP A;  1N8R R;  5LL6 S;  3OS0 A;  2DIL A;  4PK4 A;  2RK2 A;  5CQY A;  2DNU A;  1MNE A;  3QJY A;  1QKX A;  1G3W A;  1ARK A;  2FPF A;  4HKE A;  4M7D A;  1NBE B;  3VS4 A;  3ZFJ A;  1CKB A;  4LDW A;  2GCX A;  4PJO D;  4NS5 A;  1M2V B;  1NE8 A;  4EPC A;  2M02 A;  1YIT A;  1PRL C;  4IUP A;  3CXC P;  4J7I A;  3I5R A;  1U8R A;  1N5Z A;  1H8K A;  3HKS A;  4M75 E;  1ZA1 B;  2E4H A;  1YJW Q;  1OX9 A;  1QMC A;  4J9I A;  2H3E B;  3RUX A;  2YUO A;  2YWW A;  2KXD A;  3MP8 A;  3JCM h;  1T0H A;  1D1C A;  1SSH A;  1KD1 U;  4PJN A;  3OYH A;  2VUB A;  4M78 B;  2EGE A;  2IVW A;  3NTI A;  3VV0 A;  4PL6 A;  2DTI A;  3MEW A;  3VRZ A;  2B86 A;  3JCM f;  1D0X A;  4KUL A;  1Q86 R;  1OZ3 A;  1QVF A;  1T3S A;  2OTL T;  6AT1 B;  5CVI A;  1OPL A;  3A8M B;  3EG0 A;  3FDR A;  2M0O A;  2JT4 A;  3NFC A;  2H8H A;  4J9E A;  3R6N A;  2KT8 A;  4OVA A;  1X75 C;  2D9T A;  2JNG A;  5GMK h;  5CK9 A;  3CCS Q;  1M8V A;  3OYA A;  2FZC B;  3QSU A;  2HKQ B;  2K3B A;  1U06 A;  3P8D A;  2HQX A;  4FL6 A;  3JCM b;  3JCM d;  3BFM A;  2RJD A;  4OP0 A;  3I55 Q;  1VQ8 A;  1IGQ A;  3FB9 A;  1S1N A;  3QYG B;  1FX7 A;  2HD0 A;  1HXD A;  3OYB A;  4FW2 A;  3I55 T;  3QZ5 B;  4RTV A;  4HCC A;  1VQM A;  4GBQ A;  2DF6 A;  1GCQ A;  2DL4 A;  5ECA A;  5L8R E;  2MCN A;  2KNB B;  4LXC A;  1X2Q A;  2BZ8 A;  4ZTF A;  2AZV A;  2E65 A;  3QG1 A;  5D6X A;  2EQK A;  2A0F B;  2JTM A;  4AFZ C;  5C0M A;  4J6W A;  1PCX A;  1Q7Y U;  4GLM A;  4C8Q B;  5IN1 A;  4C8Q D;  2RN8 A;  2K5I A;  4HVW A;  2YRV A;  3VS6 A;  5GMK j;  1LOJ A;  2NWM A;  2XDB A;  2K9G A;  2DK3 A;  1D3B B;  5CQX A;  3AHU A;  1M30 A;  4WF2 A;  2EGA A;  3JCM P;  2JMC A;  3DKM A;  2X9H A;  4C8Q G;  4PJM A;  4J9C A;  2QDY B;  2QA4 T;  1QWE A;  1WJQ A;  3OYD A;  1SG5 A;  2E70 A;  3RNJ A;  2DJZ A;  3C95 A;  1YWP A;  1VQ5 Q;  3CPW S;  3QHS A;  4BI8 B;  2FVU A;  3LWI A;  3M58 A;  2DIG A;  2EQJ A;  2ED1 A;  2PZ1 A;  2CH4 W;  4P5N A;  4JJB A;  2EVR A;  3CBP A;  3F70 A;  1BIA A;  3CPW A;  4A4G A;  5KYY A;  2DA9 A;  5FWB A;  3M56 A;  4C8Q F;  1OV3 A;  1Q82 R;  1VQ9 A;  3JB9 I;  4FYW B;  4KH0 B;  4J6Y A;  1JB0 E;  4BE0 A;  2DL8 A;  4XU3 A;  2OTJ A;  2KXC A;  1W1F A;  4WCI A;  2DPP B;  1K9M U;  2G3R A;  2EFI A;  1KFZ A;  2IPO B;  4EMH A;  1HD3 A;  1M3C A;  3ZL7 C;  2O01 E;  3TVT A;  3CXC A;  2SEM A;  4CI0 C;  2F5K A;  3MHX A;  3EG9 B;  1JXO A;  2KDS A;  3FIF A;  1B34 B;  3JRZ A;  2ABL A;  4FIB A;  1ZBJ A;  4EMK A;  2OTJ T;  2QK0 A;  2P4T A;  2DXB A;  1WHG A;  3X25 B;  1EZZ B;  4R55 A;  2M1H A;  2SRC A;  4MMK A;  4FYX B;  2EBP A;  2X4J A;  4RTU A;  3CMA T;  1UJ0 A;  1RLP C;  2LQ8 A;  2DZ9 A;  2PVD B;  3CCJ Q;  4FT2 A;  5FU7 B;  1ZSZ B;  4DOW A;  4M77 F;  1M90 U;  3A8G B;  1YN8 A;  1A0N B;  1I5L A;  3L2R A;  2QGG A;  3WXM B;  3V7S A;  2DD4 A;  4ZN1 A;  5GAN 6;  3V7R A;  2LJ3 A;  2EIF A;  5GAN 5;  3X24 B;  3M0R A;  4HT8 A;  1XOV A;  4ZN3 A;  2K3X A;  2LCS A;  4AG1 C;  5LJ3 e;  4JS4 A;  4R56 A;  3G7Z A;  1EFN A;  3JCM X;  3OYJ A;  1IZ6 A;  3E2U A;  2LCC A;  4OMN A;  4IUT A;  3OSS C;  4YTL A;  2P0P A;  2RB6 A;  1CSK A;  2KBT A;  2V8J A;  1QP3 A;  2ATC B;  5FRM A;  4LNP A;  4FU6 A;  5FU7 C;  2WSC E;  1WHK A;  5HCK A;  4JUV A;  1S72 Q;  1RUW A;  3JCM W;  2QQB A;  1VQ7 Q;  1G3T A;  5GAM d;  2E6Z A;  2GGR A;  5GAM h;  1KK7 A;  1YCY A;  2QQS A;  4C92 A;  4J9B A;  1VQK T;  2E12 A;  4AFQ C;  4TVR A;  5LJ3 f;  2CP3 A;  2CP0 A;  2EPD A;  4CC7 A;  3CCM T;  2DVJ A;  1BB9 A;  4C92 D;  2HMA A;  2CKK A;  1YIJ T;  4M7D F;  1PSF A;  1K76 A;  2ZPH B;  5C6S A;  2KY9 A;  4B9W A;  1PWT A;  1K4U S;  1H64 1;  1PM3 A;  2DMO A;  5I2M A;  1VUB A;  3PVQ A;  3A8O B;  4E2F B;  1PD1 A;  5HK0 A;  1PSE A;  2MWO A;  2VKN A;  4BY6 B;  5GAN e;  1UHF A;  3CCJ A;  4L5G A;  1QQJ A;  1LJO A;  3P8H A;  5DM7 R;  2HSP A;  2PUK B;  4M7A D;  2X3X D;  3T9N A;  4A4H A;  5I22 A;  2DYB A;  1YJW A;  3A8L B;  5KCO A;  2NUT B;  5GMK l;  2HQH A;  5M9O A;  2CZ1 B;  5CR2 A;  3JSC A;  4NOY A;  1G3S A;  4OGC A;  1VQ6 T;  4J5Y A;  1PKS A;  4F7U B;  3OBY A;  4FM4 B;  2EJG A;  3EGX A;  3X28 B;  2HAX A;  1I1J A;  3UA6 A;  4XU0 A;  2MOX A;  3O8V A;  4II1 A;  4JZ4 A;  2F69 A;  3ULR B;  4M77 E;  2V1Q A;  1YCS B;  4FSS A;  5DLO A;  3QPH A;  4O6J A;  2ZCF B;  2CSI A;  3JCM J;  1E6G A;  4KGZ B;  2ZPB B;  4MZT A;  1T3L A;  3CCS A;  3MET A;  3G71 Q;  2O9S A;  1PC0 A;  2LT1 A;  3UF4 A;  2A08 A;  2EGC A;  2KMT A;  1Y7X A;  2HL5 C;  1D1B A;  2LMJ A;  1S72 T;  1Q86 C;  2V1R A;  2LDM A;  1MMD A;  4LDY A;  1KQS A;  5CO7 A;  3HFO A;  2OI3 A;  2KE9 A;  2LX7 A;  4C92 C;  3OYE A;  2DET A;  7AT1 B;  3TSZ A;  2KK4 A;  4Y92 A;  1VQ5 T;  1YIT T;  4B6M A;  3CC2 A;  4AMC A;  3CCR A;  1WHM A;  2YRD A;  2EYQ A;  4CC2 A;  4XK8 E;  4KGX B;  4FYY B;  4JDS A;  1QVF S;  3GNF B;  1VQ7 A;  3CC2 T;  1ZSZ C;  2QG9 B;  1VQ9 T;  5FRN A;  3OS2 A;  3NTK A;  5LJ3 j;  2J05 A;  2GTJ A;  2JTF A;  2QQA A;  3QDR B;  3J81 E;  1NEG A;  4BUG A;  2JJ9 A;  4M78 A;  4KUI A;  3H8Z A;  2FYK A;  1UEC A;  4C5H A;  3S3O A;  1VQO T;  5CKE A;  1AOJ A;  3EHQ A;  1ZUY A;  3EFO A;  1ABO A;  2RHZ A;  3TEE A;  1E6H A;  3C0C A;  1UDL A;  4C92 G;  3RKW A;  3DB3 A;  1UEB A;  1N9S A;  4OF1 A;  2KRM A;  3EG9 A;  2HNI A;  1IRX A;  2DZC A;  2DXC A;  2YHT A;  4PJO E;  2CT4 A;  1D0Z A;  2LQW A;  3CCE Q;  1K73 R;  4O5V A;  1X6O A;  5LJ3 h;  1Y71 A;  1T0J A;  5D6Y A;  1HJD A;  5LJ3 d;  1W2B S;  1AVZ C;  2DIQ A;  5A0D A;  1FYN A;  4MDW A;  2RJC A;  5GAN 7;  4RCC A;  4F7U A;  4DA4 A;  1AZE A;  2OAU A;  1RLQ C;  1OX8 A;  1WA7 A;  2VV5 A;  4AT1 B;  3HRT A;  3MEV A;  4C8Q C;  3QYH B;  3G4S A;  4XU1 A;  3C12 A;  2CUD A;  5HY6 A;  3VS0 A;  1AZG B;  2AHJ B;  4PFO A;  4M78 D;  1C0M A;  3THK A;  3P8B B;  2I2L A;  4PJO A;  4A63 B;  5GAN j;  3CD6 T;  4CC3 A;  3E9F A;  3VUZ A;  3FLG A;  2L2P A;  1KSW A;  3D7S B;  4JRI A;  4AFS C;  4OML A;  5IHI A;  1QW1 A;  1RAI B;  3KFV A;  2JW4 A;  1JO8 A;  2ZPE B;  2BE7 D;  3V7C A;  2K7A A;  1M27 C;  4J83 A;  1YIT Q;  1Y57 A;  1N9R A;  1M1K R;  4MZM A;  4JRP A;  1QVP A;  2C0T A;  1R0B G;  5GAN 2;  1XTD A;  1WI7 A;  4HCB A;  2EJF A;  2EWN A;  3M4Y A;  1B3Q A;  1B34 A;  1YIJ Q;  3I56 A;  2L5Q A;  4L6V 5;  2JOY A;  5EC7 A;  2MPX C;  1VQO Q;  4GLK A;  4N4I A;  3RKX A;  5KYY B;  2I0N A;  2L89 A;  3VJP A;  2E1H A;  2FPE A;  2ZZD A;  3EGU A;  1BI0 A;  3FEO A;  3PMT A;  1YJW T;  1KQS P;  1AWJ A;  1PHT A;  2DL7 A;  3LGF A;  2W0Z A;  5GAO m;  1IHV A;  1TOV A;  4C92 F;  5CKF A;  2CSQ A;  4HCZ A;  4QQG A;  3V8L A;  1VQ8 T;  1M90 R;  4X9D A;  3RDV A;  2AIR B;  5GAN f;  2MWP A;  4ESR A;  4IUR A;  4LDV A;  4Z89 A;  4FYV B;  3V8J A;  2OX7 A;  5GAO n;  3CCU T;  3EHR A;  1KQS S;  2BIV A;  2XHC A;  4E47 A;  1G8X A;  5CKB A;  2F5T X;  2QA4 Q;  1IO6 A;  3CCU A;  2KRO A;  3VKI A;  5I21 A;  4LD6 A;  4DBQ A;  3X20 B;  4QKU A;  1YI2 T;  1MMG A;  5KCH A;  2FB7 A;  4L59 A;  1YI2 Q;  4JLI A;  1NLO C;  2ENM A;  5IH2 A;  4F04 B;  4OMF B;  2V8I A;  2VGN A;  2GQI A;  3HTR A;  1WLP B;  3MP1 A;  1M3B A;  1RI9 A;  3JCM g;  1SEM A;  1UGQ B;  2AT1 B;  3CC7 T;  5GJW B;  1YI2 A;  3FJ5 A;  1KD1 C;  4J9F A;  5IHN A;  1BI3 A;  3CC7 Q;  1TS9 A;  4BDZ A;  3SHW A;  2RJE A;  5AT1 B;  1UB4 A;  2QGF B;  1HYO A;  2KEA A;  4J7F A;  3QUI A;  3RIR A;  3MO8 A;  4X1V A;  2HBP A;  3VUB A;  2OTJ Q;  2R58 A;  1VQP Q;  1QVG P;  1H3H A;  2E41 A;  4BE1 A;  1TTH B;  3RMQ A;  4OB2 B;  2CT3 A;  1M1K U;  1KG1 A;  3CCE T;  5GAM g;  5FU6 C;  1WFW A;  4LN2 A;  3BY7 A;  2LZ6 B;  1IGU A;  3EH2 A;  3OYM A;  1SKU B;  4M7D C;  4OMM A;  2CZ6 B;  1NG2 A;  2ZPG B;  2J6K A;  2WSF E;  2VGM A;  3TU4 K;  3J7A F;  5FWC A;  2W10 A;  1X6B A;  2YRC A;  1NEB A;  4BI3 A;  2KAF A;  4XTY A;  2LNV A;  4E7J A;  2J7I A;  2CS7 A;  2JS2 A;  1H3Z A;  1VYV A;  2DBM A;  1VQL Q;  1D3B A;  2XDD A;  2FPD A;  1GXI E;  5LJ5 g;  5KYX A;  1JQQ A;  3L2Z A;  2COZ A;  3QO3 A;  1U5S A;  4E7L A;  2BZX A;  1IXD A;  3E19 A;  2LQN A;  3A8H B;  4F7U E;  1OI1 A;  2P0Q A;  1NYF A;  1VQ6 A;  1MUZ A;  2X35 A;  5DY9 A;  3H0I A;  2QXF A;  3VS2 A;  4BDY A;  4C0D B;  3TSW A;  1Q81 U;  4HVU A;  2DXU A;  2RI3 A;  1VQP A;  3M5A A;  3S6W A;  5GMK i;  3CCM Q;  2CP6 A;  1OU8 A;  4LDX A;  4M75 A;  5KYW B;  4NL2 A;  1Z9Q A;  1RAB B;  3H6Z A;  4OB3 B;  1FMW A;  5IAY A;  3G4S Q;  1AWX A;  2EW3 A;  4XTZ A;  4RCB A;  3AT1 B;  5D7U A;  1YJN T;  2KGT A;  4PLL A;  3CC7 A;  3VYG A;  1BI1 A;  2PNI A;  5GAN 4;  2QYZ A;  2BUD A;  4ELY C;  3ZBD A;  2F2W A;  2FL7 A;  4X34 A;  1OQK A;  2DL5 A;  4A4E A;  1K9M R;  3PIP A;  1TH7 A;  2GFU A;  2DTO A;  2ECZ A;  2Z0W A;  4JJC A;  1M2V A;  2HSE B;  2RHU A;  2KSS A;  1YJ9 Q;  4M7D B;  1SRL A;  4ANJ A;  1MMN A;  1HSQ A;  1WHH A;  2X4Y A;  2D0Q B;  2EYW A;  3ER0 A;  3PT9 A;  3OYL A;  4CC4 B;  2PTK A;  1X2K A;  1K73 C;  1JJ2 A;  2PVO B;  4PJO F;  4ZTJ A;  3TQ7 P;  2LCL A;  4EMG A;  1V29 B;  1YHQ Q;  5KYX B;  4ME7 A;  3OMG A;  3SDZ A;  2KQW A;  1NM7 A;  1RI0 A;  1M8M A;  3CCL Q;  1GL5 A;  5LJ5 e;  1JJ2 S;  3M55 A;  2QTV A;  3JCM c;  1W6X A;  3VYH B;  4ZNX A;  4QW2 A;  2K6D A;  5GAO l;  4M7A A;  1GCQ C;  2ROT A;  4A54 A;  1Q82 C;  4Z8A A;  1UTI A;  1RAA B;  2M16 A;  4QT7 A;  2KYM A;  5GAO q;  1Q81 R;  1Y0M A;  2VYT A;  3SEM A;  1YNZ A;  1KC8 C;  3GIB A;  4RTY A;  3L2W A;  3CCL A;  3M54 A;  1OU9 A;  4C0D C;  1ZQ1 A;  1WNL A;  2QEX A;  2JVV A;  5FRO A;  1I8F A;  3VRY A;  1OZ2 A;  2A36 A;  3CCV T;  3CME Q;  1QCO A;  1QVG A;  4E7Z A;  4PLI A;  2FRY A;  3GPL A;  3CME T;  2NYS A;  2FG0 A;  4E7K A;  2QEX T;  3CCV A;  3OYN A;  2J6O A;  4OB1 B;  3HRU A;  1FMV A;  2CP7 A;  2DJQ A;  4RTZ A;  1Q86 U;  3M0Q A;  3LLR A;  2YDL A;  2BTT A;  5J26 A;  2QEX Q;  2Y4X A;  4RTT A;  1AHJ B;  1SPK A;  1QVG S;  2P84 A;  3CCQ A;  1Q81 C;  3EFS A;  3JB9 G;  1KHI A;  2V8K A;  4ZGJ B;  4M7A E;  1UUE A;  3BDU A;  3OS5 A;  3RMS A;  3MPU B;  3G4S T;  4M75 D;  4C0G A;  1BCO A;  3CC4 Q;  2D0N A;  2MK5 A;  1VQK A;  1WHL A;  3G1J A;  5L23 A;  1NPP A;  3LGL A;  3CD6 A;  3FJP A;  2AKK A;  3L42 A;  2DD5 A;  5I11 A;  2VC8 A;  3QBY A;  3HL8 A;  4DBR A;  4GY5 A;  4LDU A;  3ME9 A;  2ROL A;  3M57 A;  3M4G A;  1VQ4 Q;  2RPN A;  4IIO A;  4D6W A;  4E6R A;  1NJI U;  3REA B;  1TUC A;  2EQI A;  4IIM A;  3QZ9 B;  3G6E Q;  4RMO A;  3E1S A;  4BAC A;  1ZX6 A;  1GBR A;  4KH1 B;  4M7A G;  2LC4 A;  2HZY A;  2D8J A;  3A98 A;  1VQL T;  1Q7Y R;  4BI4 A;  1OPK A;  4AFU C;  3JB9 H;  1D09 B;  1AT1 B;  2G6F X;  2A3L A;  4XAX B;  4VUB A;  2BKD N;  4FW1 A;  5LJ5 f;  2YUP A;  2CUB A;  5GAM j;  4C0Z A;  3M0P A;  2CH4 A;  3EGX B;  2PUO B;  3CEY A;  1FXX A;  1PD0 A;  2NUP A;  3L2V A;  2KR3 A;  3C94 A;  3UWN A;  2YXY A;  2Y90 A;  2D1X A;  3SWN A;  2MF2 A;  2EJ9 A;  2FEI A;  1QWF A;  1JU5 C;  1WJS A;  4HT9 A;  1RL2 A;  2QQR A;  3GBQ A;  4DEX A;  2O31 A;  3IQL A;  4OMO A;  3M53 A;  2JM8 A;  4OGE A;  5J3B A;  2VXF A;  2MAM A;  1N8R C;  2DL3 A;  4M7A C;  1G83 A;  1MV0 B;  4IUU A;  1FWZ A;  1VOM A;  2COW A;  5KYU B;  4HCK A;  1GRI A;  4C8Q E;  4M78 F;  4MDX A;  5GJV B;  2LJ0 A;  2OTL Q;  5I2S A;  1M3A A;  4JLG A;  4RTW A;  1QP2 A;  3GNG A;  4E7I A;  2CP5 A;  1JJ2 P;  1I07 A;  3LH0 A;  4BD3 A;  2K3Y A;  2PQW A;  1K0S A;  2IG0 A;  2BE9 B;  1KD1 R;  5KYN A;  3MEA A;  3U23 A;  2AKL A;  3KBG A;  2QDL A;  1UGP B;  2LJ1 A;  3PIO A;  2DBK A;  3I5S A;  3CCQ T;  2YT6 A;  4KGV B;  4A4K A;  4LD9 K;  3NGP A;  3OS1 A;  2PVG B;  2OJ2 A;  3CMA Q;  1M1F A;  5AYF A;  3H0F A;  4KBM B;  1YJ9 A;  1RAC B;  3L2U A;  1XNI A;  3G6E T;  3A5Z B;  3DB4 A;  1C6V X;  2OTL A;  3A1P A;  3V8K A;  2MI6 A;  3EAE A;  2R57 A;  1VQ6 Q;  2YUQ A;  1VQ4 T;  1N27 A;  3QDF A;  3UA7 A;  3I35 A;  2H3J A;  4XQ3 A;  1E7O A;  4ZGE B;  3OYY A;  1GBQ A;  2RQT A;  1WZO A;  3CPF A;  1BKB A;  3CCJ T;  1AWW A;  2P0K A;  5LJ5 d;  3GOX A;  8AT1 B;  2O4X A;  4DEY A;  5GAN 3;  2VXE A;  5A0G A;  3CCU Q;  2K5L A;  2E64 A;  2KT1 A;  4HVV A;  1VQN A;  4J9G A;  2M0Y A;  1RAH B;  3C4S A;  1ZHI A;  2MMP A;  4X9C A;  1NLP C;  3SWN B;  4KRT A;  4R0K A;  2HBW A;  4IUQ A;  1TU0 B;  1M9S A;  2LX9 A;  1VIF A;  3SB2 A;  2YLC A;  2X3W D;  1MV3 A;  1UG1 A;  1K0X A;  2JS0 A;  3GF5 A;  4F17 A;  1LPL A;  4CRI A;  3OW2 A;  1VQK Q;  3EFO B;  5EG2 A;  2CGH A;  4MML A;  3M0T A;  4ATO A;  2ZPF B;  4PNO A;  3JCM e;  2VWF A;  2A37 A;  2B8A A;  2XIC A;  3MKD A;  4QQD A;  4D8K A;  3HHT B;  3INZ A;  1JBM A;  4HA8 A;  1Y96 B;  4PJO B;  5KH6 A;  4XU2 A;  3LH5 A;  1N8R U;  3QWY A;  1VQN Q;  1K8A C;  2DVE A;  3OSV A;  3CCV Q;  2C06 A;  3PNW C;  3UDC A;  2IIM A;  1RAD B;  2YLB A;  1VQM T;  2QA4 A;  1JEG A;  1X69 A;  4OMP A;  5LJ5 h;  4M78 C;  3GP8 A;  2DEU A;  1RAF B;  2EAY A;  1VQ5 A;  1B07 A;  2NUT A;  4ORZ A;  3CCR T;  4EIK A;  4WTO B;  3EFR A;  1VQP T;  5IXF A;  3OYF A;  3EG3 A;  4D8D A;  4JZ3 A;  1WQW A;  2K57 A;  3CCQ Q;  1KC8 R;  2J6F A;  3NHN A;  5D6W A;  3HPW A;  1U1T A;  3FRN A;  1S72 A;  2JMA A;  2L3R A;  4LUE A;  2M9U A;  4M77 A;  3VS5 A;  2K4Y A;  1O9S A;  4A53 A;  2XK0 A;  1DJ7 B;  3KUF A;  3H41 A;  1TSF A;  3G6E A;  4UC4 A;  2LVM A;  5GAO p;  2VAS A;  3OW2 S;  4FSX A;  1QCN A;  1VQ4 A;  2QAS A;  2F2V A;  2LNH B;  3TRE A;  5GAN d;  4PFZ A;  4QVC A;  2KRS A;  3VS3 A;  5GAN h;  4J9H A;  1PKT A;  2K79 A;  4K11 A;  1Y96 A;  2JN0 A;  4Z88 A;  4RKU E;  4BB7 A;  2CDT A;  1OUL A;  3RR6 A;  4EMK B;  2K2V A;  3OYK A;  4N4G A;  1QLY A;  4RG2 A;  1VQN T;  2EKO A;  5IT9 E;  2C0I A;  2FRW A;  1WQ7 A;  4RTX A;  3EGD B;  3PGG A;  3LX7 A;  1Q82 U;  2RQV A;  2XID A;  2JUF A;  4M77 G;  1ZUU A;  1UHC A;  1G2B A;  4M75 F;  4Q5W A;  3CXC S;  2F2X A;  2DFU A;  2XDP A;  2VB6 A;  3M59 A;  4M77 C;  2XKO C;  1Q7Y C;  2PU9 B;  1KQ1 A;  2DXT A;  2EKH A;  3RKY A;  1XJW B;  4M77 D;  2DKG A;  2C0O A;  1IRE B;  1I4K 1;  1F1B B;  2NUP B;  4EMK C;  2L3P A;  1ABQ A;  3JV3 A;  3RER A;  5A2Q E;  3BW1 A;  4AG2 C;  4E7H A;  1M5Q 1;  3JB9 D;  4PJO G;  2XMF A;  1K8A U;  1TXQ A;  2ZGW A;  4XTX A;  2WAC A;  1R77 A;  2LRQ A;  1W2B P;  4C8Q A;  2X51 A;  2RHX A;  2QTX A;  2L0A A;  2MYS A;  1UGR B;  3O5Z A;  3CCR Q;  3JCM Q;  3CCM A;  1EX4 A;  2O9V A;  2RH2 A;  3REB B;  2DLP A;  1YIJ A;  2FZK B;  4DOV A;  3NTH A;  3J80 E;  3OW2 P;  4OMQ A;  1YJ9 T;  5CKH A;  3OB9 A;  4KT0 E;  1Y07 A;  3I9Q A;  4J9D A;  4F16 A;  3OYC A;  3I56 T;  2CZ0 B;  2X4W A;  2RQW A;  1K9A A;  5CKD A;  1Z9Z A;  1KJW A;  2CRE A;  4M7A F;  2GBQ A;  3SD4 A;  2WSE E;  3OYG A;  2AZS A;  3UPU A;  3LW5 E;  5LJ3 g;  2NUZ A;  1UGS B;  3G71 A;  3SFM A;  2DER A;  3URG A;  1UFF A;  3MJX A;  5FW9 A;  4PJO C;  3HFN A;  2XU8 A;  1BBZ A;  2E5K A;  1ACM B;  1Q95 G;  2XI9 A;  4B9X A;  1OEB A;  1SRM A;  4C5G A;  1CKA A;  4C92 E;  1VQL A;  2EYZ A;  3VS1 A;  2LQK A;  1X43 A;  1TUG B;  1MGQ A;  3DLM A;  2O4X B;  3OBW A;  1W4S A;  2DX1 A;  2RM4 A;  3PTA A;  2ZPI B;  2KI7 A;  1C1A A;  3E9G A;  2RNA A;  1H92 A;  4JPB W;  5HKC A;  2FZG B;  4RG8 A;  1OYX A;  3CC2 Q;  2DYI A;  2HCK A;  1ZSZ A;  2ED0 A;  3EH1 A;  1ZBX A;  5GMK e;  1WIE A;  1JRI A;  2E5Q A;  3WVE B;  1QKW A;  2DRK A;  3VU3 C;  1P92 A;  3WVD B;  4V2S A;  4C92 B;  3M0S A;  3ZEH A;  2GFA A;  2EQM A;  1R8O B;  5GAO r;  3CC4 A;  1VA7 A;  1J3T A;  4IUV A;  1RAE B;  1WJR A;  4ZGD B;  4NL3 A;  2RQU A;  3H0H A;  1B7T A;  2M51 A;  1QCF A;  3PVL A;  3CCS T;  2XD0 A;  3N5B B;  2YSQ A;  2BZY A;  2LT4 A;  1G3Y A;  4IKF A;  4JS5 A;  1TWB A;  1GFC A;  3KXT A;  3OQ5 A;  2HKN A;  2RF0 A;  3JCM V;  3QWX X;  4M7A B;  5KE2 A;  3HRS A;  1KIK A;  4Z02 A;  3TCJ A;  1VYU A;  1K1Z A;  4DBH A;  3X26 B;  1WPY A;  1XQH A;  2E3H A;  4JRK A;  3UAT A;  5KE3 A;  1LNX A;  4M7D G;  2Y4Y A;  3QII A;  2D8H A;  2FO0 A;  1K8A R;  4N0A A;  1UE9 A;  1SF9 A;  2HEQ A;  2QAZ A;  2L3S A;  1U1S A;  1BK2 A;  3OMC A;  1WDX A;  4LE9 A;  5CIU A;  1BU1 A;  4OB0 B;  5KYU A;  3OY9 A;  1X27 A;  1SHG A;  1D1A A;  1PNJ A;  1ZSG A;  3FC3 A;  3ASK A;  3JAM E;  3S3N A;  2KYB A;  5J39 A;  5GMK m;  1IB8 A;  3S3M A;  1ZLM A;  5GAN g;  4J8O A;  3EG2 A;  4A4F A;  2F1L A;  1VQO A;  2RA2 A;  1GFD A;  4M7D E;  1SSF A;  2DEQ A;  3QKJ A;  4LUD A;  3SWN C;  2P4R A;  1U3O A;  3VS7 A;  2GF7 A;  3DLL A;  1KQ2 A;  1TUD A;  4C5I A;  1HK9 A;  8ATC B;  4FCY A;  4M7D D;  1YJN A;  3LYI A;  1YWO A;  1D0Y A;  4Y91 A;  2RJF A;  4HXJ A;  2COY A;  3PFS A;  4C0F A;  1W2B A;  3CBO A;  2AK5 A;  1K73 U;  1YFN A;  2QI2 A;  1VQ7 T;  1M1K C;  3MP6 A;  1AD5 A;  1VIE A;  1M1G A;  2CP2 A;  1AWO A;  2HL3 A;  3EG1 A;  3CMA A;  2CYZ B;  1BIB A;  2KVQ G;  3HP9 A;  3M9Q A;  2KRN A;  1N6A A;  3BE3 A;  2X4X A;  1WXT A;  4ELZ C;  1KC8 U;  2XG8 D;  1IHW A;  1BI2 A;  5GAN 8;  1WX6 A;  1V1C A;  2V26 A;  1YBY A;  1UJY A;  3CME A;  2DTH A;  1WYX A;  1YJN Q;  2O2O A;  3GLX A;  2RHY A;  5FLX E;  1I0C A;  3CBM A;  3M0U A;  2RI2 A;  5LJ5 j;  3R6O A;  4PKC C;  1EIF A;  5GAM f;  4DQ2 A;  1ZA2 B;  2L8D A;  1I5O B;  1VQ8 Q;  2MIO A;  2DAQ A;  4FT4 A;  2JM9 A;  4XTW A;  1M90 C;  1AEY A;  9ATC B;  3H9N A;  3HSB A;  1ZUK A;  4N0A C;  1LVK A;  2E10 A;  1WHJ A;  1FMK A;  2YUN A;  1VQ9 Q;  1YHQ T;  1MHN A;  3CQT A;  1OOT A;  1O75 A;  1QVF P;  4Y28 E;  2J06 A;  2GNC A;  3CCL T;  2EYX A;  4F7U G;  5CAI A;  2JZ2 A;  2RO0 A;  5IXB A;  1NJI R;  4JRQ A;  3BDL A;  1YHQ A;  3MCA B;  1K9M C;  1SHF A;  2RD1 A;  2E6N A;  3PMI A;  1BYM A;  1MND A;  2RQR A;  4M75 B;  5KYW A;  2RHI A;  4M78 E;  3NMZ C;  5GAM e;  2EQU A;  1WXB A;  3RES A;  4J6X A;  2R5A A;  1UGV A;  1KHC A;  4QVD A;  1PG5 B;  2CZ7 B;  4N4H A;  4XTU A;  2RK1 A;  1M4Z A;  5IHK A;  1X01 A;  4PJL A;  3L1A A;  2ZAE A;  1JXM A;  2RI5 A;  4KUD K;  1NJI C;  3G71 T;  4BE2 A;  4M4Z A;  3CCE A;  1WXU A;  2DRM A;  3LWH A;  1NPR A;  4QQ6 A;  2K2M A;  3QJ6 A;  3Q1J A;  3OYI A;  4DBF A;  1BCM A;  2DM1 A;  2OAW A;  4M78 G;  4BY6 C;  4PJJ A;  1M2O A;  4M75 C;  1YP5 A;  1VYT A;  3EGD A;  3L2Q A;  4RUG A;  3JB9 F;  4XTV A;  2NLU A;  1G5V A;  2HDA A;  4F7U F;  4PFP A;  2GQV A;  4F14 A;  3RBB B;  2JXB A;  5HK3 A;  2LP5 A;  4C5E A;  2R5M A;  4JJD A;  1RAG B;  2DO3 A;  1VQM Q;  2DE0 X;  1NZ9 A;  1V76 A;  2L3Q A;  4JJN K;  2K5F A;  3PE0 A;  2A7Y A;  2O88 A;  1LCK A;  3CD6 Q;  1W70 A;  2ESW A;  5A0L A;  3I55 A;  3MEU A;  2QQ9 A;  2GTO A;  1PRM C;  2VVK A;  1NYG A;  2LTO A;  3JB9 J;  2E3I A;  1TG0 A;  1MMA A;  2A28 A;  1X6G A;  5DLQ E;  2FHD A;  2EYY A;  4M75 G;  3OA6 A;  3QXE B;  2D6F A;  2HQE A;  4MZP A;  4M77 B;  3CPW P;  1I81 A;  2RMO A;  4EDU A;  1WGS A;  1R0C B;  4E7S A;  3CC4 T; 
#chains in the Genus database with same CATH homology
 2JUF A;  4M77 G;  5CCA A;  3HFO A;  4QVZ A;  4M75 F;  4Q5W A;  5FU6 B;  3UT1 A;  2X4Y A;  2D0Q B;  3CXC S;  3ER0 A;  3PT9 A;  4C92 C;  5LL6 S;  3OYE A;  3OYL A;  1K73 C;  2XDP A;  3OS0 A;  1JJ2 A;  2PVO B;  3M59 A;  2KK4 A;  4PJO F;  2RK2 A;  1VQ5 T;  1YIT T;  5CQY A;  4M77 C;  3QJY A;  4ZTJ A;  2XKO C;  1Q7Y C;  1G3W A;  2PU9 B;  2LCL A;  1KQ1 A;  4HKE A;  3CC2 A;  2DXT A;  1V29 B;  3ZFJ A;  4EMG A;  3CCR A;  3RKY A;  4M7D A;  4LDW A;  2GCX A;  4ME7 A;  4PJO D;  4NS5 A;  3OMG A;  1NE8 A;  2EYQ A;  3SDZ A;  4XK8 E;  4M77 D;  2KQW A;  4EPC A;  2DKG A;  1RI0 A;  1YIT A;  4IUP A;  4J7I A;  5LJ5 e;  4JDS A;  1QVF S;  1IRE B;  1JJ2 S;  3GNF B;  3M55 A;  1I4K 1;  3JCM c;  4EMK C;  1U8R A;  1VQ7 A;  3HKS A;  3CC2 T;  3RER A;  3VYH B;  4M75 E;  5A2Q E;  3BW1 A;  4E7H A;  1VQ9 T;  4QW2 A;  5FRN A;  5GAO l;  3OS2 A;  3NTK A;  5LJ3 j;  4M7A A;  1M5Q 1;  3JB9 D;  4PJO G;  4A54 A;  1K8A U;  2JTF A;  2QQA A;  2ZGW A;  1Q82 C;  3QDR B;  3J81 E;  4XTX A;  2WAC A;  2M16 A;  4BUG A;  3RUX A;  2LRQ A;  5GAO q;  4M78 A;  3MP8 A;  3JCM h;  4KUI A;  2VYT A;  3H8Z A;  4C8Q A;  2RHX A;  2FYK A;  2QTX A;  4C5H A;  3S3O A;  1KC8 C;  1KD1 U;  3GIB A;  3L2W A;  3CCL A;  3M54 A;  3OYH A;  1VQO T;  2VUB A;  4M78 B;  4C0D C;  1ZQ1 A;  5CKE A;  1WNL A;  2QEX A;  2JVV A;  2IVW A;  1I8F A;  3NTI A;  1OZ2 A;  5FRO A;  3CCV T;  1UGR B;  2RHZ A;  3TEE A;  3VV0 A;  4PL6 A;  1QVG A;  3JCM Q;  3CCM A;  4C92 G;  2DTI A;  3RKW A;  2RH2 A;  4PLI A;  3MEW A;  3DB3 A;  1UEB A;  3GPL A;  5CO7 A;  1YIJ A;  3CME T;  1N9S A;  4OF1 A;  3NTH A;  4DOV A;  4E7K A;  3J80 E;  2HNI A;  3JCM f;  2QEX T;  3CCV A;  4KUL A;  2DZC A;  3OYN A;  1YJ9 T;  5CKH A;  4OB1 B;  3OB9 A;  3HRU A;  1OZ3 A;  4KT0 E;  1Q86 U;  1QVF A;  2DXC A;  1Y07 A;  2OTL T;  3OYC A;  2YHT A;  2CZ0 B;  2X4W A;  3A8M B;  5CVI A;  3I56 T;  4PJO E;  3LLR A;  3FDR A;  5J26 A;  2M0O A;  2Y4X A;  5CKD A;  1AHJ B;  3NFC A;  1QVG S;  3CCQ A;  1Q81 C;  4M7A F;  3EFS A;  4O5V A;  3JB9 G;  1KHI A;  2V8K A;  3SD4 A;  4ZGJ B;  1X6O A;  4OVA A;  5LJ3 h;  1Y71 A;  4M7A E;  1X75 C;  2WSE E;  3OYG A;  2D9T A;  5D6Y A;  3BDU A;  3OS5 A;  3RMS A;  2JNG A;  5GMK h;  5LJ3 d;  3UPU A;  3G4S T;  3LW5 E;  5CK9 A;  1W2B S;  4M75 D;  4C0G A;  5LJ3 g;  2DIQ A;  1UGS B;  5A0D A;  1M8V A;  1VQK A;  3OYA A;  3G71 A;  3SFM A;  3QSU A;  3URG A;  4MDW A;  3P8D A;  4PJO C;  2RJC A;  2XU8 A;  1NPP A;  2HQX A;  3HFN A;  3LGL A;  3CD6 A;  4FL6 A;  5GAN 7;  3JCM b;  3FJP A;  4RCC A;  3JCM d;  3BFM A;  2RJD A;  2XI9 A;  3L42 A;  4B9X A;  4OP0 A;  4F7U A;  2DD5 A;  4C5G A;  4DA4 A;  4C92 E;  2OAU A;  2VC8 A;  3QBY A;  1VQL A;  3HL8 A;  2LQK A;  2VV5 A;  4GY5 A;  4LDU A;  1MGQ A;  3DLM A;  3FB9 A;  1VQ8 A;  2O4X B;  3OBW A;  1W4S A;  1FX7 A;  2HD0 A;  1HXD A;  3HRT A;  3M57 A;  3M4G A;  3ME9 A;  2RM4 A;  3QYG B;  3PTA A;  2ZPI B;  4D6W A;  3I55 T;  3QZ5 B;  4HCC A;  3MEV A;  4C8Q C;  1VQM A;  3E9G A;  1NJI U;  3QYH B;  3G4S A;  4XU1 A;  5L8R E;  3C12 A;  5HY6 A;  5HKC A;  3QZ9 B;  4RG8 A;  1OYX A;  2AHJ B;  4RMO A;  4M78 D;  3E1S A;  4BAC A;  3P8B B;  2I2L A;  4ZTF A;  4PJO A;  1ZBX A;  2E65 A;  3QG1 A;  5D6X A;  5GMK e;  1JRI A;  2E5Q A;  5GAN j;  3CD6 T;  2EQK A;  4M7A G;  2LC4 A;  3WVE B;  2JTM A;  3E9F A;  5C0M A;  3VU3 C;  4J6W A;  3FLG A;  3VUZ A;  1Q7Y U;  1P92 A;  3WVD B;  1VQL T;  4V2S A;  4C92 B;  4C8Q B;  5IN1 A;  4BI4 A;  4C8Q D;  4JRI A;  2K5I A;  2YRV A;  3ZEH A;  5GMK j;  2GFA A;  1LOJ A;  1QW1 A;  2EQM A;  3JB9 H;  2XDB A;  1R8O B;  2DK3 A;  5GAO r;  1D3B B;  3CC4 A;  2A3L A;  4XAX B;  4VUB A;  2BKD N;  5CQX A;  4IUV A;  5LJ5 f;  3AHU A;  1WJR A;  2ZPE B;  4C0Z A;  4ZGD B;  5GAM j;  4WF2 A;  3V7C A;  4NL3 A;  3JCM P;  3DKM A;  3CCS T;  2XD0 A;  4J83 A;  3N5B B;  2PUO B;  1N9R A;  1FXX A;  3CEY A;  2LT4 A;  4C8Q G;  3L2V A;  3C94 A;  3UWN A;  2QDY B;  2Y90 A;  2QA4 T;  4MZM A;  1G3Y A;  1WJQ A;  4IKF A;  4JRP A;  4JS5 A;  1QVP A;  2MF2 A;  3SWN A;  3OYD A;  2EJ9 A;  3KXT A;  5GAN 2;  1XTD A;  1WJS A;  3OQ5 A;  2E70 A;  4HT9 A;  4HCB A;  2DJZ A;  3C95 A;  2EJF A;  3JCM V;  1RL2 A;  2EWN A;  2QQR A;  4M7A B;  3HRS A;  3M4Y A;  5KE2 A;  3CPW S;  3QHS A;  1B34 A;  4BI8 B;  3I56 A;  2FVU A;  3LWI A;  4Z02 A;  3TCJ A;  3M53 A;  2L5Q A;  3M58 A;  2DIG A;  2JOY A;  4L6V 5;  2EQJ A;  3X26 B;  4GLK A;  4P5N A;  4OGE A;  4N4I A;  5J3B A;  1WPY A;  2VXF A;  1XQH A;  3RKX A;  2MAM A;  1N8R C;  4JRK A;  5KE3 A;  3CBP A;  4M7A C;  1LNX A;  2L89 A;  3VJP A;  4M7D G;  4IUU A;  2Y4Y A;  2E1H A;  1FWZ A;  3F70 A;  3QII A;  1BIA A;  3CPW A;  2ZZD A;  4A4G A;  1BI0 A;  4N0A A;  3FEO A;  4C8Q E;  3PMT A;  1YJW T;  4M78 F;  4MDX A;  5GAO m;  3LGF A;  1U1S A;  3M56 A;  4C8Q F;  4C92 F;  5CKF A;  5I2S A;  4HCZ A;  4JLG A;  1QP2 A;  3GNG A;  4E7I A;  3OMC A;  1VQ9 A;  5CIU A;  4QQG A;  3LH0 A;  3V8L A;  3JB9 I;  1VQ8 T;  4X9D A;  4BD3 A;  4J6Y A;  1YJN T;  1JB0 E;  4BE0 A;  2K3Y A;  2PQW A;  4OB0 B;  4XU3 A;  5GAN f;  2MWP A;  2OTJ A;  3OY9 A;  2IG0 A;  3FC3 A;  3ASK A;  4IUR A;  3JAM E;  4LDV A;  3V8J A;  2DPP B;  3S3N A;  2G3R A;  5GAO n;  2EFI A;  1K9M U;  5J39 A;  5GMK m;  3MEA A;  4EMH A;  3KBG A;  3CCU T;  1UGP B;  3S3M A;  2O01 E;  3CXC A;  5GAN g;  4J8O A;  3PIO A;  4CI0 C;  1KQS S;  3CCQ T;  2F5K A;  2BIV A;  2XHC A;  4A4F A;  1VQO A;  2RA2 A;  3MHX A;  4E47 A;  4A4K A;  4LD9 K;  4M7D E;  1SSF A;  2DEQ A;  2KDS A;  3FIF A;  3QKJ A;  1B34 B;  5CKB A;  3SWN C;  3JRZ A;  2F5T X;  2GF7 A;  3DLL A;  4FIB A;  1KQ2 A;  4EMK A;  3OS1 A;  4C5I A;  1HK9 A;  3CCU A;  4M7D D;  2OTJ T;  1YJN A;  3LYI A;  3VKI A;  5I21 A;  4LD6 A;  4Y91 A;  3X20 B;  2PVG B;  2P4T A;  2RJF A;  2DXB A;  1M1F A;  1YI2 T;  5AYF A;  4KBM B;  3PFS A;  3X25 B;  4C0F A;  4R55 A;  1YJ9 A;  2M1H A;  1W2B A;  3L2U A;  1XNI A;  2FB7 A;  3A5Z B;  3DB4 A;  3CBO A;  4MMK A;  5KCH A;  3G6E T;  2X4J A;  2OTL A;  4L59 A;  1K73 U;  3CMA T;  3V8K A;  2MI6 A;  2QI2 A;  4JLI A;  3EAE A;  2LQ8 A;  2DZ9 A;  2R57 A;  4OMF B;  2PVD B;  2V8I A;  2VGN A;  1VQ4 T;  1VQ7 T;  1M1K C;  1N27 A;  4FT2 A;  5FU7 B;  3MP6 A;  3MP1 A;  2H3J A;  4DOW A;  4M77 F;  1M90 U;  3A8G B;  4XQ3 A;  4ZGE B;  1VIE A;  1M1G A;  3OYY A;  3JCM g;  1I5L A;  3L2R A;  1UGQ B;  3CCJ T;  3CPF A;  1BKB A;  2CYZ B;  3WXM B;  3CMA A;  3V7S A;  1BIB A;  2KVQ G;  2P0K A;  3HP9 A;  3M9Q A;  2DD4 A;  4ZN1 A;  5LJ5 d;  3CC7 T;  5GAN 6;  1N6A A;  3GOX A;  1YI2 A;  3V7R A;  5GAN 5;  2EIF A;  2X4X A;  2O4X A;  3X24 B;  4ELZ C;  1KC8 U;  1KD1 C;  2XG8 D;  1BI3 A;  4HT8 A;  1BI2 A;  1XOV A;  5GAN 8;  5GAN 3;  4BDZ A;  4ZN3 A;  2VXE A;  2RJE A;  5A0G A;  2K3X A;  2K5L A;  2E64 A;  1YBY A;  3CME A;  2DTH A;  1UB4 A;  1VQN A;  5LJ3 e;  3OYB A;  4JS4 A;  3GLX A;  4R56 A;  3G7Z A;  2RHY A;  5FLX E;  3C4S A;  3JCM X;  3OYJ A;  3CBM A;  4J7F A;  1ZHI A;  1IZ6 A;  2MMP A;  3QUI A;  3RIR A;  3MO8 A;  4X9C A;  2HBP A;  2LCC A;  3VUB A;  2RI2 A;  3SWN B;  2R58 A;  5LJ5 j;  3R6O A;  3OSS C;  4IUT A;  4PKC C;  2P0P A;  4YTL A;  1EIF A;  2RB6 A;  4IUQ A;  4DQ2 A;  5GAM f;  1M9S A;  2LX9 A;  2L8D A;  1VIF A;  2V8J A;  3SB2 A;  1QP3 A;  2DAQ A;  2YLC A;  4FT4 A;  5FRM A;  2E41 A;  4FU6 A;  5FU7 C;  2WSC E;  4BE1 A;  4XTW A;  1M90 C;  3RMQ A;  3HSB A;  4JUV A;  4N0A C;  4OB2 B;  2E10 A;  3GF5 A;  4CRI A;  1M1K U;  3OW2 A;  3JCM W;  1YHQ T;  1KG1 A;  3CCE T;  1MHN A;  5GAM g;  2QQB A;  5FU6 C;  1G3T A;  5GAM d;  5EG2 A;  2CGH A;  2E6Z A;  1O75 A;  3BY7 A;  4MML A;  4Y28 E;  3OYM A;  5GAM h;  1YCY A;  2QQS A;  4ATO A;  4C92 A;  4M7D C;  2ZPF B;  4PNO A;  3JCM e;  3CCL T;  1VQK T;  4F7U G;  5CAI A;  2JZ2 A;  2B8A A;  2RO0 A;  2XIC A;  2E12 A;  2CZ6 B;  4QQD A;  2ZPG B;  3HHT B;  1JBM A;  2WSF E;  3INZ A;  4HA8 A;  4TVR A;  3BDL A;  5LJ3 f;  4JRQ A;  3MCA B;  2VGM A;  1YHQ A;  1Y96 B;  1K9M C;  2RD1 A;  4PJO B;  3TU4 K;  2E6N A;  3J7A F;  5KH6 A;  4XU2 A;  3PMI A;  3CCM T;  1N8R U;  1BYM A;  4C92 D;  4M75 B;  1K8A C;  2DVE A;  2CKK A;  3OSV A;  1YIJ T;  4BI3 A;  2RHI A;  2C06 A;  2KAF A;  4M78 E;  4M7D F;  1PSF A;  4XTY A;  5GAM e;  3PNW C;  3UDC A;  2LNV A;  2ZPH B;  5C6S A;  4E7J A;  2CS7 A;  2YLB A;  1KQS A;  2EQU A;  2KY9 A;  3RES A;  1VQM T;  2QA4 A;  4B9W A;  1H3Z A;  4J6X A;  1D3B A;  1H64 1;  2XDD A;  2R5A A;  5I2M A;  5LJ5 h;  1VUB A;  4M78 C;  3GP8 A;  1GXI E;  2EAY A;  1KHC A;  4QVD A;  3A8O B;  1VQ5 A;  2CZ7 B;  4N4H A;  5LJ5 g;  4XTU A;  2RK1 A;  1M4Z A;  3L2Z A;  1X01 A;  5HK0 A;  3L1A A;  1PSE A;  3QO3 A;  4E7L A;  2MWO A;  3CCR T;  2RI5 A;  3EFR A;  4BY6 B;  5GAN e;  1VQP T;  4KUD K;  1NJI C;  3CCJ A;  3OYF A;  3E19 A;  4F7U E;  3A8H B;  3G71 T;  1OI1 A;  4L5G A;  4BE2 A;  2P0Q A;  1LJO A;  3P8H A;  5DM7 R;  2PUK B;  1VQ6 A;  1WQW A;  2X35 A;  4M7A D;  3CCE A;  3T9N A;  2K57 A;  4A4H A;  3LWH A;  5DY9 A;  1YJW A;  1NPR A;  3A8L B;  4QQ6 A;  5KCO A;  3QJ6 A;  2QXF A;  3Q1J A;  5GMK l;  4BDY A;  5D6W A;  5M9O A;  3OYI A;  3HPW A;  2CZ1 B;  4C0D B;  1U1T A;  5CR2 A;  4BY6 C;  1Q81 U;  3FRN A;  3JSC A;  4M78 G;  1S72 A;  4NOY A;  1G3S A;  4M75 C;  4OGC A;  1VQ6 T;  2L3R A;  2M9U A;  4J5Y A;  4M77 A;  3L2Q A;  4F7U B;  3OBY A;  2DXU A;  2RI3 A;  4FM4 B;  2K4Y A;  1O9S A;  4A53 A;  2EJG A;  1VQP A;  2XK0 A;  1DJ7 B;  3JB9 F;  4XTV A;  3M5A A;  3KUF A;  3S6W A;  5GMK i;  2NLU A;  1G5V A;  3X28 B;  2HAX A;  3G6E A;  4F7U F;  4UC4 A;  2LVM A;  4LDX A;  4XU0 A;  2GQV A;  4M75 A;  5GAO p;  3O8V A;  3OW2 S;  5HK3 A;  4II1 A;  4NL2 A;  2F69 A;  4FSX A;  4C5E A;  2R5M A;  4M77 E;  1VQ4 A;  3H6Z A;  2DO3 A;  4OB3 B;  3TRE A;  1NZ9 A;  5GAN d;  4JJN K;  5IAY A;  2K5F A;  4QVC A;  2A7Y A;  5GAN h;  4XTZ A;  4RCB A;  5DLO A;  3QPH A;  4O6J A;  4PLL A;  5A0L A;  3MEU A;  3I55 A;  2QQ9 A;  2ZCF B;  3CC7 A;  3JCM J;  1Y96 A;  3VYG A;  2ZPB B;  4MZT A;  2JN0 A;  1BI1 A;  4RKU E;  4BB7 A;  5GAN 4;  3CCS A;  2BUD A;  4ELY C;  3ZBD A;  3MET A;  2FL7 A;  2LTO A;  4EMK B;  3JB9 J;  2K2V A;  4X34 A;  3OYK A;  4N4G A;  4A4E A;  2LT1 A;  3PIP A;  1TH7 A;  4RG2 A;  5DLQ E;  2FHD A;  1VQN T;  2GFU A;  4M75 G;  3OA6 A;  2EKO A;  3QXE B;  5IT9 E;  2D6F A;  2DTO A;  2HQE A;  2KMT A;  4MZP A;  1WQ7 A;  1Y7X A;  4M77 B;  1I81 A;  1S72 T;  2RHU A;  2KSS A;  3LX7 A;  3PGG A;  4EDU A;  1Q82 U;  1Q86 C;  1WGS A;  2LDM A;  4M7D B;  4LDY A;  3CC4 T;  2XID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...