1VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
95
Chain Sequence
b'MQFKVYTYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
molecule tags Plasmid
source organism Escherichia coli
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
total genus 26
structure length 95
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vubA00
4HKEA 3JRZA 5CKEA 1X75C 1VUBA 1UB4A 5DLOA 5CQYA 4MZPA 3TCJA 4ELYC 1NE8A 3VUBA 4MZMA 2MF2A 5HK3A 3NFCA 1M1FA 2VUBA 3JSCA 5CR2A 5CO7A 4OF1A 4VUBA 5CKBA 3HPWA 5CKFA 5HK0A 5CQXA 4ELZC 5CCAA 2C06A 4ME7A 5CKDA 4MDXA 4MZTA 3G7ZA 2KMTA 5CK9A 5CKHA 5HKCA
chains in the Genus database with same CATH superfamily
3CCSQ 2EYXA 3PIOA 1BI2A 3I5RA 1VQMQ 2EIFA 2JTMA 2XG8D 1UGSB 1MNEA 4ZTJA 3PE0A 3CC2T 2DTIA 1MHNA 4M7AA 1QVPA 3CEYA 4GLKA 3ZBDA 1KG1A 2FRWA 2RH2A 1X75C 3WVEB 4HA8A 5KE2A 2RJCA 4RTYA 1YFNA 1VQNT 2DXUA 2KEAA 2DM1A 5CR2A 3GF5A 1PCXA 2MOXA 3MHXA 3P8HA 1NEGA 1M3CA 4F04B 1S72A 1WDXA 1YJWT 4LD9K 4FYXB 4DBHA 2ROTA 3GOXA 3QO3A 2QEXT 1Q82U 1W2BS 4DOWA 2DVEA 5I21A 1WJQA 3UA6A 1QMCA 2RD1A 3DB4A 3REBB 4PJOG 3X24B 3OYCA 2K3YA 1M2VB 2YT6A 1WZOA 4J5YA 3HPWA 4EIKA 1PRLC 4BDYA 3MP6A 3T9NA 3EG3A 1VYVA 2QK0A 2IVWA 2BIVA 1D1AA 1W70A 1X69A 4PJMA 1JU5C 2PZ1A 2V8IA 4XU3A 2ABLA 2FZCB 1PRMC 2CP7A 3A1PA 5HCKA 3CXCP 3H0HA 3A8OB 4F7UB 1RAFB 2CS7A 2F1LA 2FHDA 1NJIC 4BUGA 4JUVA 1KQ2A 1VQLA 1TUCA 1U8RA 3CCVA 3QYGB 1YITA 1UJ0A 2DIGA 1XOVA 4C0ZA 2RK2A 3QUIA 3HRTA 4XQ3A 1UFFA 1YJ9Q 1OZ3A 1TS9A 3CBPA 2VVKA 5FWCA 5J39A 2NYSA 4DQ2A 1QVGP 3C4SA 3QZ9B 3RKXA 4AFQC 1KD1R 3I9QA 1UGRB 5GAN6 2DTHA 2PUKB 2ZAEA 1T3SA 1QVFP 4X9DA 3LYIA 5FW9A 2P0KA 1TG0A 2QASA 1ZUKA 2AZSA 3QJ6A 3KFVA 3LLRA 3EG9A 5LJ5j 2JTEA 2ZPIB 5CAIA 3THKA 2RI5A 1Z9QA 4V2SA 4GLMA 3R6OA 3M53A 2H3JA 2M16A 2Y90A 4HVUA 3EGDB 5A0LA 2RHUA 3META 4NS5A 4DEXA 4JJDA 2BTTA 4TVRA 1G3YA 1YCYA 2MI6A 3X28B 4C8QG 4EMHA 2GF7A 4C92E 3OYAA 1Q82R 2COZA 2DVJA 5GAN4 5GAOn 3E9GA 3X26B 4M75D 1WI7A 1S72Q 2K79A 1KHIA 1WHGA 2CDTA 3CCEQ 2DK3A 3FJ5A 1AVZC 4HVVA 4A4HA 1FMVA 5GANf 4CI0C 1T3LA 5D6XA 2R5MA 2BKDN 3GLXA 4PFOA 2HSEB 4D8KA 1J3TA 1QLYA 2DFUA 3CPFA 2EWNA 4E7JA 1ACMB 4ME7A 3J81E 1RI0A 3FRNA 1VQ8T 1NG2A 5CKHA 1Y57A 1M8VA 3E9FA 1FWZA 1AWJA 3AHUA 3GIBA 3MKDA 1GCPA 2GBQA 4PJOE 5A0DA 1I4K1 2LJ0A 2O9SA 2DMOA 2RQWA 2LQNA 5FWBA 3UPUA 1Q7YC 2RHYA 1KD1U 1QCNA 1R77A 2LT4A 4J9GA 1W1FA 4F17A 1SRLA 1NYGA 1VIFA 3UDCA 1SPKA 3VJPA 1WIEA 4K11A 2GQIA 2E3IA 1U06A 3A5ZB 1PM3A 1Y0MA 3RDVA 2JT4A 4RTZA 2R58A 1N8RC 3Q1JA 2D8JA 2KE9A 1OEBA 4QVDA 4UC4A 2CZ7B 4C8QA 2VB6A 5FU6B 4N0AA 5GAN5 1D3BA 1UB4A 3GNGA 4E7KA 1T0JA 3C94A 4LDYA 3WVDB 3CC7Q 4P5NA 4E7LA 4C5HA 3CCRQ 1DJ7B 2A08A 2RA2A 2YXYA 5KYYA 3GP8A 2HQXA 2NUTA 1NEBA 2RMOA 1KQSS 1VQ8A 1WXTA 3CCUA 1WHJA 2QAZA 2NUPB 4E7ZA 2ED1A 2EYQA 3S3NA 2DX1A 2QA4Q 4WCIA 2KT8A 4D8DA 2HL3A 2MMPA 1K9MR 1U5SA 3CC7T 3REAB 1YJNA 1ABQA 2FEIA 2D1XA 1RAGB 1MNDA 2DXTA 1VQKQ 1BIBA 4JLGA 4JZ4A 4CC4B 4M78E 4N0AC 1ZSZA 2JXBA 3JB9G 1H92A 3CCET 2DD5A 2LDMA 1GL5A 5GANh 2LNVA 5KYXB 1IXDA 4OF1A 5CKBA 2KY9A 1K73R 2AHJB 5GAMg 5CCAA 5M9OA 4GY5A 4C8QE 5GJWB 1ARKA 1VQOQ 1VQOA 1K8AC 3QWXX 2FZGB 1QVGA 3ER0A 2XD0A 2PTKA 4F14A 2DYIA 3UWNA 1E6HA 3PVQA 3EGDA 3JCMf 1C6VX 4M7DD 3OYJA 1YJWQ 4RCCA 4Q5WA 4C0DB 2AIRB 1VQ7Q 1ZBJA 1M30A 3INZA 2J06A 3BDUA 5EC7A 4IIOA 1VQPQ 2QQRA 2RQUA 1ZHIA 2A36A 3O5ZA 2XDPA 1X6BA 2ED0A 4E2FB 5LJ5g 5IHNA 1H8KA 1MMNA 2QQ9A 1ZA2B 3QWYA 1E6GA 2E41A 2L3SA 3LWIA 1D1CA 5KCOA 2CH4W 1GXIE 4CC2A 2L89A 2W0ZA 1TUGB 4M75E 3DKMA 4PLIA 2F5KA 1V76A 3LGFA 2WACA 3FB9A 4HKEA 1QWFA 2HCKA 1PSEA 2VXFA 1YITT 3F70A 3PTAA 2ENMA 1AT1B 1ZUUA 3ME9A 1JRIA 1VQ5Q 1K1ZA 3CCUQ 4FYWB 1KD1C 5L8RE 1JO8A 5LJ5d 1WHKA 2EBPA 3JCMX 1O9SA 3VS3A 3CMEQ 1SEMA 1WLPB 4BB7A 2O4XB 4C5EA 4J6XA 5GANg 2KRMA 2GFUA 3UT1A 4PFPA 1WQWA 3AT1B 4M7AD 2GCXA 3M59A 2BE9B 4BI4A 4M7DF 2KRSA 7AT1B 1VQ4Q 4XU2A 3EFRA 1M2VA 1W2BA 2ZPFB 1OYXA 4BACA 1WJSA 1VQ9Q 4C92B 1YHQQ 3QHSA 4F7UG 4LDVA 3CD6Q 4B9WA 5L23A 5CKDA 3JB9F 4R55A 4M77B 3QKJA 3G71T 2DERA 2EQKA 1KFZA 1YJWA 4PFZA 3JCMd 2DBMA 1IHVA 2AT1B 1XQHA 3NHNA 4J6WA 3M0SA 1M2OA 3O8VA 2COWA 2NUZA 2VGNA 2KI7A 2HD0A 4JJBA 3M4YA 1VQNA 3OS1A 1M90U 4QQGA 2KBTA 4PJOA 2EQUA 2XDBA 1YJ9T 4QQDA 3CMAA 4C8QF 1P92A 2KXCA 1N9SA 2LJ3A 3I56A 1YIJQ 4M4ZA 1KSWA 5LJ5h 1KQSP 2EQJA 4F7UF 3X20B 2RPNA 1WFWA 1MUZA 1VQPA 4OMQA 1TXQA 1VQ4T 1SSFA 4M7DC 1RAIB 1XJWB 1VQMT 2BZXA 4QVCA 1WHHA 2O4XA 1UGPB 2EPDA 2LCCA 3ULRB 2K5FA 4PJOD 2Z0WA 1VQ5A 4NOYA 3L2WA 2DJQA 1YNZA 2CZ0B 4OMLA 1OI1A 4M7AG 4DBQA 4MDWA 3CCMQ 4FIBA 3KXTA 1GFCA 2DKGA 1LNXA 3FJPA 3S3MA 2X9HA 4JPBW 1YHQA 4C5GA 2MWOA 1G3TA 3VS5A 2FB7A 8ATCB 3OYNA 5GAOr 1VQ6T 1Q81U 1H641 4HT8A 1UG1A 4FSXA 4FT4A 3SDZA 2LJ1A 3OYKA 5KH6A 2PU9B 4IKFA 4HCZA 4ZGEB 2H3EB 4JDSA 2DL4A 1BIAA 5KYNA 2OTLT 1BU1A 3E2UA 2EGEA 1JQQA 1QCFA 1D3BB 4OMFB 5LJ3j 1IRXA 3OYBA 1WA7A 1RLPC 3I5SA 4HCKA 2J7IA 4EMKA 2J05A 4PJOF 2MK5A 5CVIA 2DNUA 3HRSA 1K9MU 3EG2A 2KYMA 1I0CA 5CQYA 1Q7YR 1X6OA 3EG9B 2DETA 2MF2A 4Z8AA 4A4GA 4X34A 2DE0X 3JB9I 4KUIA 2LX7A 3VS4A 4M78B 2E12A 4OMMA 2F2VA 3CC2Q 3CCVQ 1R0BG 1VQ9T 2FVUA 3A8MB 1I5LA 2LQ8A 4JJNK 5FRNA 4LXCA 5LJ5f 2W10A 2FO0A 3H41A 3V8JA 4M7AE 1IZ6A 2CZ1B 1AWOA 3RMSA 1BI0A 1Y96B 4OMOA 1PNJA 3P8DA 5GAOp 2IG0A 5J26A 4AG2C 2QQBA 2DEUA 2DZ9A 1SSHA 2KSSA 2MPXC 4ZN1A 1Y07A 2PVOB 4M77G 3M5AA 1YITQ 1B34A 3LH0A 3V7CA 3RKWA 3CBOA 1W6XA 1RAAB 3OW2S 1V29B 1Q81R 3JCMh 3A8GB 3MJXA 2V8KA 3JAME 2A37A 2OTJA 4X9CA 2LCLA 2AK5A 3OS0A 2OTLA 1YP5A 3OYDA 3OYYA 2KYBA 4J9CA 3D7SB 3JB9H 1X2KA 3ZEHA 3CCQA 4R0KA 1JXOA 2QGFB 1M9SA 4QQ6A 5D6YA 2RHZA 4J6YA 4BE2A 3JCMV 4B9XA 1U1TA 1VQ6A 1VQ6Q 4J9EA 1E7OA 1X43A 1M90R 3NMZC 1BI3A 1YHQT 1WQ7A 3QIIA 2K5IA 2QQAA 4MMKA 3CXCS 3ZL7C 2HBWA 1VUBA 1JEGA 1K0XA 2JMAA 2PQWA 3VUBA 2P0PA 2JMCA 2WSCE 2CP2A 4OP0A 3DB3A 2DLPA 2HKQB 1WYXA 3I35A 4RTTA 2HZYA 2JZ2A 4KUDK 4BE1A 3OQ5A 5GAN2 4M75A 5I2MA 1PHTA 1NJIU 1ZSGA 4XTZA 3UATA 1X2QA 5KYUB 1OQKA 4JJCA 1WHLA 2RM4A 2RJEA 3CCEA 3CXCA 4E7SA 3M0QA 2RO0A 3LW5E 3PMTA 4A54A 2JNGA 2F2XA 1G83A 3CCVT 2KK4A 2CH4A 2R5AA 5GMKj 4ANJA 5DLQE 3LWHA 2KT1A 4Z02A 3A98A 2QA4T 1UGVA 4ZNXA 5D7UA 1I1JA 2CP3A 2EJ9A 1KJWA 3U23A 2ZCFB 3EFSA 3QXEB 4EPCA 4JS5A 2ESWA 4OGEA 2CGHA 4XTUA 3JCMg 3RESA 2O9VA 2DJZA 1QP2A 2CP0A 3CCRT 4NL2A 2KROA 2HEQA 3CCQT 1PKTA 1VYTA 3VKIA 5A0GA 1SG5A 4KGZB 2FPDA 4FL6A 1JB0E 1OPLA 1AD5A 2L2PA 3G71Q 1NPPA 2K4YA 2OTLQ 2JOYA 4C0DC 3UA7A 3TEEA 5KYWA 4Y92A 4C92C 2EYWA 1QKXA 2QEXA 4FCYA 5GMKi 2CREA 1RAEB 2SRCA 5LJ3e 2CSIA 2M0YA 2QDYB 1BK2A 1BB9A 4RUGA 2EFIA 1Q82C 5HKCA 4E47A 2M02A 3L2RA 1ZSZC 1NM7A 3MCAB 4O5VA 2MAMA 2M51A 2EYZA 3S6WA 1JBMA 3EHRA 4OB0B 2VUBA 3TSZA 2DAQA 3RNJA 4QT7A 5IHKA 1KC8R 4LD6A 3HP9A 4XK8E 3G6ET 2EJGA 3QDFA 3L1AA 1UJYA 3VS0A 2CYZB 2QXFA 1VQ9A 3CD6A 2GTJA 2CSQA 3MP8A 4BI8B 4M7AF 3VU3C 4PK4A 3RR6A 3HHTB 2RJFA 1OV3A 4PJOC 1HSQA 3BDLA 2PVGB 3G4ST 4HCCA 3OW2P 1B7TA 3EG0A 3OBYA 1RABB 4GBQA 2RHXA 4D6WA 2F5TX 3C12A 2GFAA 4ZGDB 1G5VA 2A3LA 3I55Q 3PVLA 3C0CA 4J8OA 1VQ7T 2O31A 1UHCA 2KVQG 3G6EQ 1GRIA 1K4US 4OB2B 4CRIA 3M0RA 4M7AB 3EFOB 3FDRA 3WXMB 2RI2A 4F7UA 3GBQA 2EYYA 2B8AA 1WXBA 2QTVA 1N8RR 2Y4YA 1FX7A 1GFDA 3CPWP 2EGAA 4X1VA 2D0NA 1BKBA 4KGXB 2CP5A 2XK0A 3VYHB 5GAOq 1ZX6A 3HFOA 1LJOA 2QYZA 3NGPA 3RIRA 2VXEA 4M78G 1PWTA 4C0GA 1M27C 4MZTA 3SB2A 1ZA1B 2QI2A 5LJ3f 5FU7B 2CP6A 3L2QA 1VQ7A 1WGSA 4M7DB 2L3PA 3ASKA 3EHQA 2KNBB 3OY9A 1NYFA 3L42A 3JSCA 3CC7A 3VS6A 3CCQQ 2DXCA 1SF9A 2DRKA 2A0FB 1EIFA 2C0IA 1U3OA 4MDXA 1BCOA 2E70A 4B6MA 3MEAA 3CCUT 2JW4A 2K7AA 3EGXA 1N27A 3VUZA 1VQ8Q 3SWNB 3M0UA 4DOVA 3PMIA 1TU0B 2O2OA 4C92A 4M78C 2QDLA 1IGQA 2ROLA 2D9TA 3OYIA 2K2MA 3P8BB 4ZGJB 2YUPA 2YLBA 5GAMe 3EAEA 3TU4K 3HTRA 2PNIA 3TQ7P 4N4GA 1PG5B 3PFSA 1H3HA 2PVDB 4ELZC 3G4SA 1N8RU 3OSVA 1JJ2S 2E64A 2HDAA 1ZBXA 1YJNQ 3QYHB 5I22A 2XICA 4Z89A 2EKOA 2L3QA 4YTLA 2LVMA 3SWNA 4R56A 1CKAA 3CMAQ 3MEWA 2HQHA 4BD3A 2BZYA 1K9MC 2DEQA 3G6EA 3OSSC 1H3ZA 4IUQA 2V26A 3I55T 5KYUA 4IIMA 2GGRA 2HMAA 3V8LA 4DEYA 3UF4A 1UGQB 4M75C 2XI9A 3PIPA 1JJ2A 2VV5A 3JCMP 4L5GA 2R57A 3QDRB 1VQKT 2YWWA 1FMKA 4FW2A 5AYFA 2F2WA 1YI2Q 4N4HA 3FLGA 5I11A 1UE9A 1MGQA 2P4TA 1K73U 4JS4A 4FU6A 1HXDA 1K9AA 2KXDA 3JV3A 2J6OA 3IQLA 3NFCA 2LZ6B 4HXJA 4M7DG 5GANd 2KQWA 3KBGA 4JRKA 3OS5A 4FM4B 1UDLA 4C92G 4J7IA 3A8HB 1I8FA 4M75B 1QW1A 2P4RA 1M1KU 2DIQA 4BI3A 3M4GA 3CCSA 2JS2A 3MPUB 1HK9A 3OB9A 1SHGA 2LP5A 1RI9A 3BW1A 4RTWA 2JS0A 4KBMB 3RMQA 3TSWA 1HYOA 1Q81C 5GAMh 2YRDA 4M75F 4FT2A 2ZGWA 4N4IA 2E6ZA 4JLIA 4Y91A 3SWNC 1K73C 2KMTA 2MWPA 4BDZA 3URGA 3SHWA 4XTVA 4M77A 4DA4A 5GJVB 1AOJA 3CPWA 4M78D 4EMKC 3HSBA 2YUOA 2RI3A 3EH2A 1HD3A 2M9UA 3JB9J 1KC8C 3BE3A 4M78A 1UTIA 2RF0A 3QZ5B 2OI3A 5KYXA 3VRZA 3PGGA 2DPPB 5IT9E 3JCMc 1M90C 2OAUA 4LNPA 2HQEA 1KHCA 2O01E 4XTYA 4RTVA 2YSQA 4FW1A 2ZPGB 6AT1B 1WPYA 1SKUB 1NBEB 4WF2A 3M55A 2MCNA 2Y4XA 1ZQ1A 2FL7A 1YJNT 4A4KA 2A7YA 3PNWC 1PSFA 4AMCA 2XDDA 5ECAA 1MMDA 2QGGA 2P0QA 2XHCA 3EG1A 3OMCA 1GBRA 2OAWA 4L59A 3M0PA 1PD0A 2V1QA 2FYKA 2ECZA 2I2LA 3VV0A 3CMET 5DLOA 3CC4A 3JCMb 5LJ3h 2DYBA 4M78F 2VC8A 4XTWA 3N5BB 5HK3A 5GMKl 3H6ZA 4J83A 4LUDA 4LDWA 5J3BA 2V1RA 2YHTA 3CCMA 2JVVA 3SFMA 2DO3A 4IUTA 2L5QA 4PNOA 4BY6B 3JRZA 2QEXQ 2DL5A 1BYMA 4MMLA 4IURA 3C95A 3RKYA 1VA7A 1B3QA 3R6NA 3JCMe 2BZ8A 1D1BA 1KQSA 4RG2A 1OPKA 2JTFA 5GAN3 1Q7YU 1QCOA 1AHJB 2X35A 4LUEA 5IHIA 1TUDA 1Y96A 4KT0E 4EDUA 2D8HA 3DLMA 1GCQA 3NPFA 1RAHB 1JXMA 1WHMA 3TCJA 1X6GA 1N5ZA 3M9QA 1YCSB 2NUPA 1M5Q1 3GPLA 2DILA 4M77E 3NTIA 4L6V5 1UUEA 1LCKA 2X4JA 2YLCA 5KE3A 2CKKA 3CCLQ 3RUXA 1PKSA 4XU1A 2JN0A 2EGCA 2YRCA 1T0HA 1FMWA 4VUBA 5C6SA 2VGMA 1WNLA 5GMKe 1V1CA 2K2VA 2EAYA 3OA6A 2LCSA 2DXBA 4M7AC 5FLXE 1UHFA 4M77D 2K57A 3JCMQ 2EVRA 4IUPA 1UECA 3BY7A 4JRPA 2VYTA 1OX8A 1I07A 2K6DA 3M58A 4Y28E 1XNIA 4C92D 1YI2T 2J6KA 1M1GA 2LRQA 1M1FA 4OB3B 5GAN8 3SD4A 3EGUA 3VRYA 5D6WA 2E65A 1Q86C 4HCBA 4IUUA 1M4ZA 2DZCA 3H8ZA 4OVAA 1Y71A 2BE7D 4JRQA 1VQPT 1K8AU 3RERA 2ATCB 3CCJT 2X3XD 1D09B 3M57A 1YI2A 3E19A 5GMKh 5FU7C 3H0IA 3QJYA 2XMFA 3OYFA 1RACB 4PL6A 3L2VA 3NTKA 1YIJT 5CO7A 3I56T 2EW3A 3GNFB 4QVZA 3OYHA 4M7DA 5DY9A 3CMAT 1VQLQ 3DLLA 1QVFA 1SRMA 4AT1B 1CSKA 2RJDA 4M77F 3M0TA 1KIKA 3NTHA 3M54A 2XIDA 4C92F 3OMGA 4PJLA 3EGXB 5KCHA 2RQVA 4PJJA 1GCQC 1QKWA 3G71A 2DD4A 1VIEA 5GAMf 4J9IA 4KULA 2CUBA 1VQMA 3CD6T 1VQ4A 5GANj 1G8XA 4FYYB 3G7ZA 1KQ1A 3VS7A 2CT4A 2OTJQ 4ELYC 2WSEE 1VQLT 4AFUC 3MEUA 3V7SA 4A53A 1UEBA 4A4EA 4J9DA 2L3RA 5HK0A 2G3RA 3CCLA 1IHWA 1ZUYA 5CIUA 4LN2A 5FRMA 4OB1B 4E6RA 1ZLMA 2KRNA 4E7IA 5CK9A 3A8LB 2IPOB 4EMGA 1WXUA 3J7AF 3HL8A 3EH1A 2YUNA 1OZ2A 1QVFS 9ATCB 2XU8A 3G4SQ 4MZMA 1M3BA 2RK1A 5AT1B 4A4FA 1QVGS 1RLQC 1PC0A 1PD1A 4J9HA 4RG8A 2I0NA 4CC7A 3M56A 5FROA 1WJRA 3LX7A 4Z88A 1ZSZB 3EFOA 2KDSA 1BCMA 2LQKA 5CKEA 1TWBA 1G3WA 3VS1A 4MZPA 3TREA 1Q95G 1NE8A 1B07A 1S72T 2FRYA 4A63B 5GAMj 3CC4T 2NWMA 1NLPC 3G1JA 1AZEA 3H0FA 5CKFA 1FYNA 2K3BA 4C8QD 2PUOB 1MV3A 3CCLT 2H8HA 2RB6A 2E5KA 1WX6A 4IUVA 2V8JA 1KC8U 4F7UE 5LJ3g 2L0AA 3CC2A 2HSPA 3QSUA 4RMOA 1EFNA 4QW2A 5GAMd 1Q86R 4NL3A 2VWFA 2NLUA 2E5QA 4C8QC 5A2QE 3E1SA 4C0FA 2LMJA 4LE9A 5KYWB 1VQOT 1OU9A 3MO8A 2FPFA 1YWPA 2X4XA 2D6FA 1X27A 1MV0B 5IN1A 1N9RA 1AWWA 1QWEA 3BFMA 1W2BP 2A28A 3CCRA 2DL7A 2X3WD 1QQJA 4OMNA 4DBRA 4HVWA 2ZPEB 1YWOA 2M0OA 2HKNA 5IXBA 2E1HA 4ATOA 4RTUA 1U1SA 2CZ6B 1SHFA 1KK7A 2WSFE 2QA4A 3J80E 2JM8A 1C1AA 3OBWA 4XAXB 3FIFA 3CCJA 3V7RA 5C0MA 3VS2A 3H9NA 1N6AA 1TSFA 2HAXA 1AWXA 3S3OA 2EQMA 1GBQA 2E4HA 3JCMJ 2DL8A 4PLLA 2LX9A 2M1HA 1XTDA 1I81A 2AZVA 1CKBA 2MIOA 4RKUE 3OW2A 1EX4A 1G3SA 2EQIA 4AG1C 1M1KC 2ZPHB 2CUDA 3FEOA 1X01A 1Y7XA 1IGUA 4ORZA 4AFSC 2FG0A 1JJ2P 3VYGA 2OTJT 2YRVA 3OYGA 4FYVB 2EKHA 1EZZB 1K76A 3OYEA 2KR3A 1FXXA 5GANe 3MP1A 3RBBB 2E3HA 3QG1A 2K9GA 3OYMA 3PT9A 1VQKA 4F16A 5IH2A 1RL2A 1OOTA 4BE0A 2G6FX 5GAOm 1I5OB 4E7HA 1NLOC 2RNAA 5IXFA 1O75A 1QP3A 1LPLA 1TH7A 3I55A 3CC4Q 2C06A 5KYYB 4OMPA 5DM7R 1NPRA 2JUFA 2CT3A 1AZGB 3OS2A 1K0SA 2LC4A 2GNCA 4RCBA 2KAFA 1OULA 2IIMA 2RN8A 4WTOB 2ZZDA 4HT9A 2FZKB 2DTOA 1IO6A 4RTXA 5FU6C 2JJ9A 2QTXA 2E10A 1K8AR 8AT1B 1OX9A 2DA9A 2FPEA 5EG2A 2RHIA 3CCJQ 2XKOC 3HFNA 3L2ZA 4FSSA 1D0ZA 4CC3A 2J6FA 3L2UA 1G2BA 2K3XA 5GAN7 1F1BB 2DRMA 2F69A 4LDXA 4PJNA 1IB8A 5GMKm 4M77C 3OYLA 2NUTB 1BI1A 4M7DE 1MMAA 2X4YA 2DF6A 4ZN3A 3CCMT 2HBPA 1C0MA 2MYSA 4J9BA 1M3AA 1NZ9A 2LNHB 1AEYA 2C0OA 3TVTA 1R0CB 2VKNA 3CPWS 1TTHB 1YN8A 3CMEA 3CBMA 3CQTA 4ZTFA 2LT1A 4KRTA 1VOMA 1YBYA 5LJ3d 4LDUA 2B86A 2HNIA 3X25B 1IREB 3LH5A 2YUQA 1A0NB 3JCMW 2KGTA 1W4SA 2AKKA 1R8OB 1VYUA 4KH1B 4OGCA 1HJDA 1TOVA 2LQWA 4C5IA 2DBKA 2EJFA 3HRUA 2E6NA 5LL6S 1Q86U 4ESRA 4XU0A 1RADB 4II1A 4J7FA 5IAYA 3QPHA 4KGVB 3I56Q 1YIJA 1BBZA 5CQXA 4JZ3A 4PJOB 2O88A 2QQSA 5GAOl 1MMGA 1D0YA 4KH0B 1NJIR 1S1NA 4XTXA 1VQNQ 5HY6A 2HL5C 1LVKA 2BUDA 2COYA 2RQTA 1M1KR 4DBFA 5LJ5e 4C8QB 4J9FA 5I2SA 4AFZC 2AKLA 1B34B 3ZFJA 2LTOA 4O6JA 2JM9A 2VASA 2QG9B 1Z9ZA 2P84A 2OX7A 1M8MA 2GQVA 4M75G 4BY6C 4PKCC 1RUWA 2YDLA 2C0TA 3SEMA 3MEVA 2RQRA 3V8KA 1YJ9A 3LGLA 3CCST 1LOJA 2K5LA 3KUFA 2GTOA 2DL3A 4QKUA 2X4WA 1OU8A 1ABOA 2SEMA 2ZPBB 3QBYA 1D0XA 4JRIA 3HKSA 2OJ2A 4EMKB 2L8DA 2D0QB 3JB9D 1VQ5T 3FC3A 2X51A
chains in the Genus database with same CATH topology
1VQPT 2F5TX 4BB7A 2O4XB 3C12A 4J6XA 4C5EA 5GANg 1K8AU 2GFUA 3PIOA 3UT1A 2GFAA 3RERA 4ZGDB 1G5VA 1BI2A 1WQWA 2A3LA 4M7AD 2GCXA 3M59A 3CCJT 4BI4A 4M7DF 2EIFA 4J8OA 3M57A 2JTMA 1VQ7T 1YI2A 3E19A 5GMKh 2XG8D 4XU2A 5FU7C 2KVQG 3EFRA 3QJYA 3OYFA 1W2BA 2ZPFB 1OYXA 3NTKA 1UGSB 4OB2B 4PL6A 5CO7A 4CRIA 3I56T 3GNFB 1WJSA 4BACA 4M7AB 3FDRA 3WXMB 4QVZA 2RI2A 4C92B 3QHSA 4ZTJA 4F7UG 4F7UA 3OYHA 3CC2T 4LDVA 5DY9A 3CMAT 2B8AA 2DTIA 4M7DA 4B9WA 3DLLA 5CKDA 1MHNA 3JB9F 2Y4YA 1QVFA 1FX7A 4R55A 4M77B 4M7AA 1QVPA 3CEYA 4GLKA 3ZBDA 1KG1A 3QKJA 3G71T 2RH2A 2EQKA 2RJDA 1X75C 4M77F 3WVEB 1BKBA 4HA8A 1YJWA 5KE2A 3JCMd 2RJCA 3NTHA 3M54A 2XK0A 3VYHB 2XIDA 5GAOq 1XQHA 1VQNT 4C92F 2DXUA 3HFOA 4J6WA 3OMGA 5KCHA 5CR2A 3O8VA 3GF5A 3G71A 1LJOA 2VGNA 2DD4A 3MHXA 1VIEA 2HD0A 3P8HA 5GAMf 3M4YA 4KULA 3RIRA 2VXEA 1VQNA 3OS1A 1S72A 4QQGA 1VQMA 1M90U 4PJOA 2EQUA 4M78G 4C0GA 2XDBA 3CD6T 1VQ4A 1YJ9T 4QQDA 1YJWT 4LD9K 3CMAA 5GANj 4MZTA 4C8QF 3SB2A 3G7ZA 1P92A 1N9SA 3I56A 3GOXA 1KQ1A 3QO3A 5LJ5h 2QI2A 2QEXT 5LJ3f 5FU7B 4DOWA 1W2BS 1Q82U 2DVEA 4ELYC 5I21A 3L2QA 2WSEE 2EQJA 1VQ7A 1WJQA 4F7UF 1WGSA 1VQLT 4M7DB 3X20B 3ASKA 3MEUA 3OY9A 2RD1A 3DB4A 3L42A 4PJOG 3JSCA 3X24B 3CC7A 3V7SA 1VQPA 4A53A 3OYCA 2K3YA 1UEBA 4A4EA 2DXCA 2L3RA 4J5YA 3HPWA 5HK0A 1VQ4T 1EIFA 2G3RA 3CCLA 1SSFA 4BDYA 3MP6A 3T9NA 4M7DC 1VQMT 5CIUA 5FRMA 4MDXA 4OB1B 4QVCA 4E7IA 2E70A 2O4XA 1UGPB 2IVWA 2BIVA 2LCCA 2K5FA 3A8LB 3MEAA 5CK9A 3CCUT 4EMGA 1VQ5A 4PJOD 3J7AF 1N27A 3HL8A 4NOYA 3VUZA 3L2WA 4XU3A 2V8IA 3SWNB 2CZ0B 1OZ2A 1QVFS 2XU8A 4DOVA 1OI1A 3PMIA 4M7AG 4MZMA 2RK1A 3A8OB 4F7UB 4C92A 4M78C 2CS7A 4A4FA 1QVGS 2FHDA 1NJIC 2D9TA 4RG8A 4BUGA 4JUVA 3OYIA 1KQ2A 1VQLA 4MDWA 3M56A 5FROA 1U8RA 1WJRA 3LX7A 3P8BB 4FIBA 3QYGB 4ZGJB 3KXTA 3CCVA 1YITA 2DKGA 3CC2A 2KDSA 1LNXA 2DIGA 1XOVA 4C0ZA 3FJPA 2LQKA 2YLBA 5CKEA 2RK2A 3S3MA 1G3WA 3HRTA 3QUIA 4XQ3A 5GAMe 3EAEA 3TU4K 4MZPA 3TREA 1YHQA 1NE8A 4C5GA 2MWOA 1S72T 1G3TA 1OZ3A 3CBPA 5GAMj 3CC4T 2FB7A 3OYNA 4N4GA 5J39A 5GAOr 1VQ6T 3PFSA 1Q81U 1H641 2PVDB 5CKFA 4C8QD 4HT8A 4DQ2A 4ELZC 3G4SA 2PUOB 3CCLT 4FSXA 1N8RU 3C4SA 3QZ9B 4FT4A 3OSVA 3RKXA 3SDZA 5KH6A 2E64A 2RB6A 3OYKA 1JJ2S 2PU9B 1UGRB 5GAN6 4IKFA 4HCZA 1ZBXA 2DTHA 2PUKB 3QYHB 4ZGEB 4IUVA 4X9DA 2V8JA 2XICA 2P0KA 3LYIA 4F7UE 2EKOA 5LJ3g 1KC8U 4JDSA 3QJ6A 1BIAA 3LLRA 4YTLA 5LJ5j 2OTLT 4RMOA 2LVMA 4QW2A 2ZPIB 5CAIA 5GAMd 4NL3A 3QSUA 2NLUA 3SWNA 4R56A 2E5QA 1D3BB 3MEWA 4OMFB 4C8QC 2RI5A 5LJ3j 4BD3A 3OYBA 4V2SA 3R6OA 1K9MC 2DEQA 3G6EA 5A2QE 3E1SA 3M53A 4C0FA 2H3JA 2M16A 2Y90A 3OSSC 1H3ZA 1VQOT 5A0LA 2RHUA 4EMKA 3META 4NS5A 3MO8A 4IUQA 4PJOF 4TVRA 1G3YA 5CVIA 1YCYA 2MI6A 2X4XA 3X28B 2D6FA 4C8QG 3I55T 3HRSA 3V8LA 4EMHA 1K9MU 2GF7A 5IN1A 4C92E 3OYAA 1N9RA 5CQYA 1UGQB 4M75C 2XI9A 3BFMA 1X6OA 5GAN4 5GAOn 3PIPA 3CCRA 1JJ2A 2VV5A 3JCMP 3E9GA 2MF2A 4A4GA 3X26B 2ZPEB 4X34A 4M75D 2M0OA 4L5GA 3JB9I 4KUIA 2R57A 3QDRB 4M78B 1VQKT 2E12A 2E1HA 4ATOA 1U1SA 2CZ6B 1KHIA 5AYFA 1VQ9T 2WSFE 2QA4A 2DK3A 3J80E 4N4HA 4A4HA 2FVUA 3FLGA 3A8MB 1MGQA 1I5LA 2LQ8A 2P4TA 4JJNK 1K73U 5FRNA 3OBWA 4XAXB 5GANf 3FIFA 4FU6A 1HXDA 3CCJA 3V7RA 4CI0C 5LJ5f 5C0MA 4JS4A 1N6AA 5D6XA 2HAXA 2R5MA 3S3OA 2BKDN 3GLXA 2EQMA 3NFCA 4M7DG 5GANd 2KQWA 3V8JA 3JCMJ 3CPFA 2EWNA 4M7AE 4PLLA 1IZ6A 2CZ1B 3KBGA 3RMSA 4JRKA 1BI0A 4E7JA 3OS5A 2LX9A 1Y96B 4FM4B 2M1HA 1XTDA 1I81A 4ME7A 4C92G 3J81E 1RI0A 4J7IA 3P8DA 3A8HB 4RKUE 1I8FA 5GAOp 2IG0A 4M75B 5J26A 3FRNA 3OW2A 1QW1A 1VQ8T 1M1KU 2QQBA 2DIQA 1G3SA 5CKHA 2DZ9A 2KSSA 4BI3A 1M1KC 1M8VA 4ZN1A 3E9FA 2ZPHB 3M4GA 1Y07A 3CCSA 1FWZA 3FEOA 1HK9A 1X01A 3OB9A 2PVOB 3AHUA 4M77G 1Y7XA 3GIBA 3BW1A 3M5AA 1B34A 4KBMB 3RMQA 3LH0A 4PJOE 3V7CA 3VYGA 2OTJT 2YRVA 3RKWA 3OYGA 5A0DA 3CBOA 1Q81C 5GAMh 3OYEA 1I4K1 3OW2S 1V29B 4M75F 3A8GB 4FT2A 2V8KA 1FXXA 3JCMh 2ZGWA 4N4IA 5GANe 3JAME 2OTJA 4X9CA 3MP1A 2LCLA 3OS0A 2E6ZA 3QG1A 4JLIA 3UPUA 4Y91A 2OTLA 3OYMA 3OYDA 3OYYA 1Q7YC 2RHYA 3SWNC 1K73C 3PT9A 1KD1U 2KMTA 1VQKA 3JB9H 1RL2A 2LT4A 2MWPA 4BDZA 4BE0A 3URGA 3ZEHA 4XTVA 4M77A 4DA4A 3CCQA 5GAOm 1VIFA 3UDCA 3CPWA 3HSBA 4M78D 4EMKC 4E7HA 2RI3A 1M9SA 4QQ6A 5D6YA 3VJPA 2M9UA 3JB9J 2RHZA 4J6YA 4BE2A 4M78A 1KC8C 3A5ZB 3JCMV 4B9XA 1O75A 1U1TA 3QZ5B 1VQ6A 1QP3A 1TH7A 3I55A 2R58A 3PGGA 2DPPB 1N8RC 2C06A 5IT9E 3Q1JA 3JCMc 1BI3A 5DM7R 1M90C 4QVDA 4UC4A 2CZ7B 1NPRA 1YHQT 1YIJT 1WQ7A 4C8QA 2OAUA 3QIIA 2K5IA 2QQAA 4MMKA 3CXCS 2JUFA 2HQEA 1KHCA 2O01E 5FU6B 4XTYA 3OS2A 4N0AA 1VUBA 2ZPGB 1D3BA 5GAN5 1UB4A 2LC4A 1WPYA 4RCBA 2KAFA 2PQWA 4WF2A 3M55A 2P0PA 2WSCE 2Y4XA 3GNGA 2ZZDA 3VUBA 1ZQ1A 4HT9A 4OP0A 2DTOA 2FL7A 3DB3A 1YJNT 4E7KA 5FU6C 4A4KA 3C94A 2A7YA 2QTXA 2E10A 3PNWC 1PSFA 2JZ2A 4LDYA 3WVDB 2XDDA 4KUDK 4P5NA 4BE1A 3OQ5A 5GAN2 4E7LA 4C5HA 4M75A 2P0QA 2RA2A 1DJ7B 2XHCA 5EG2A 3GP8A 2HQXA 2RHIA 2XKOC 3HFNA 3L2ZA 3OMCA 5I2MA 3L2UA 2K3XA 4L59A 1NJIU 5GAN7 4XTZA 2F69A 4LDXA 2FYKA 1KQSS 1VQ8A 3CCUA 2I2LA 5GMKm 3VV0A 4M77C 5DLOA 3OYLA 3CMET 3CC4A 3JCMb 2EYQA 2RM4A 5LJ3h 3S3NA 2RJEA 3CCEA 1BI1A 5HK3A 4M78F 2VC8A 4XTWA 3N5BB 5GMKl 3CXCA 3H6ZA 4M7DE 4J83A 2X4YA 2RO0A 2MMPA 4LDWA 3CC7T 3G6ET 3LW5E 4ZN3A 3PMTA 5J3BA 2JNGA 4A54A 1YJNA 3CCMT 2HBPA 3CCVT 2YHTA 2KK4A 3CCMA 2R5AA 2DXTA 5GMKj 1BIBA 2JVVA 4JLGA 3SFMA 2DO3A 1NZ9A 2L5QA 4IUTA 5DLQE 4PNOA 4BY6B 3JRZA 4M78E 3LWHA 4Z02A 4N0AC 2QA4T 3JB9G 1BYMA 4MMLA 4IURA 3C95A 3CCET 3RKYA 2DD5A 2LDMA 3CPWS 5GANh 2EJ9A 2ZCFB 3QXEB 3EFSA 3JCMe 3CMEA 2LNVA 3CBMA 4EPCA 2LT1A 4JS5A 4ZTFA 1KQSA 4OGEA 4RG2A 2CGHA 2JTFA 5GAN3 1YBYA 5LJ3d 4XTUA 3JCMg 4OF1A 3RESA 4LDUA 5CKBA 2DJZA 2HNIA 2KY9A 1Q7YU 1AHJB 1QP2A 2AHJB 5GAMg 5CCAA 2X35A 3X25B 3CCRT 5M9OA 4GY5A 4NL2A 1IREB 4C8QE 1Y96A 4KT0E 3CCQT 3VKIA 5A0GA 3JCMW 1W4SA 4EDUA 1VQOA 1K8AC 4FL6A 3DLMA 1JB0E 1R8OB 4OGCA 1QVGA 3ER0A 1NPPA 2K4YA 3TCJA 4C5IA 2XD0A 2EJFA 3M9QA 3HRUA 2E6NA 2JOYA 5LL6S 4C0DC 1Q86U 4XU0A 3UWNA 3TEEA 1M5Q1 4C92C 3JCMf 4II1A 2QEXA 4J7FA 5IAYA 3GPLA 4M7DD 3QPHA 3OYJA 1YIJA 4M77E 5GMKi 3NTIA 4RCCA 5CQXA 4L6V5 4Q5WA 4C0DB 5LJ3e 4PJOB 2QDYB 2EFIA 2QQSA 3INZA 5GAOl 3BDUA 3L2VA 1Q82C 5HKCA 4E47A 4XTXA 2X4JA 2QQRA 3L2RA 2YLCA 1ZHIA 5HY6A 5KE3A 3MCAB 2CKKA 2XDPA 4O5VA 2MAMA 5LJ5g 2BUDA 2QQ9A 3RUXA 3S6WA 4XU1A 1JBMA 2JN0A 4OB0B 2VUBA 5LJ5e 2E41A 3LWIA 2DAQA 4VUBA 4C8QB 5C6SA 5I2SA 5KCOA 2VGMA 1WNLA 5GMKe 1B34B 4LD6A 2K2VA 2L89A 3ZFJA 1GXIE 2LTOA 4O6JA 2EAYA 3HP9A 4M75E 3OA6A 2DXBA 3DKMA 4M7AC 5FLXE 2F5KA 2GQVA 2K57A 4M77D 4PLIA 4XK8E 2EJGA 3LGFA 3JCMQ 2WACA 4M75G 4IUPA 4BY6C 3L1AA 3FB9A 3BY7A 2VXFA 2VYTA 1PSEA 2CYZB 4HKEA 4PKCC 4JRPA 1YITT 2QXFA 1VQ9A 3M58A 4Y28E 1XNIA 3MEVA 4C92D 3V8KA 1YI2T 1YJ9A 3F70A 3PTAA 3LGLA 3CD6A 3MP8A 4BI8B 4M7AF 3CCST 1LOJA 2K5LA 1JRIA 3KUFA 3ME9A 1M1GA 2LRQA 1M1FA 4JRQA 4OB3B 3VU3C 5GAN8 3SD4A 2X4WA 1KD1C 5L8RE 3HHTB 2RJFA 2ZPBB 3QBYA 5D6WA 5LJ5d 4PJOC 2E65A 1Q86C 3BDLA 2PVGB 4JRIA 3HKSA 3G4ST 4HCCA 4IUUA 1M4ZA 4HCBA 4EMKB 2DZCA 3H8ZA 4OVAA 1O9SA 1Y71A 2L8DA 3OBYA 3JCMX 2D0QB 3JB9D 1VQ5T 3FC3A 2RHXA 4D6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKE A;  3JRZ A;  5CKE A;  1X75 C;  1VUB A;  1UB4 A;  5DLO A;  5CQY A;  4MZP A;  3TCJ A;  4ELY C;  1NE8 A;  3VUB A;  4MZM A;  2MF2 A;  5HK3 A;  3NFC A;  1M1F A;  2VUB A;  3JSC A;  5CR2 A;  5CO7 A;  4OF1 A;  4VUB A;  5CKB A;  3HPW A;  5CKF A;  5HK0 A;  5CQX A;  4ELZ C;  5CCA A;  2C06 A;  4ME7 A;  5CKD A;  4MDX A;  4MZT A;  3G7Z A;  2KMT A;  5CK9 A;  5CKH A;  5HKC A; 
#chains in the Genus database with same CATH topology
 3CCS Q;  2EYX A;  3PIO A;  1BI2 A;  3I5R A;  1VQM Q;  2EIF A;  2JTM A;  2XG8 D;  1UGS B;  1MNE A;  4ZTJ A;  3PE0 A;  3CC2 T;  2DTI A;  1MHN A;  4M7A A;  1QVP A;  3CEY A;  4GLK A;  3ZBD A;  1KG1 A;  2FRW A;  2RH2 A;  1X75 C;  3WVE B;  4HA8 A;  5KE2 A;  2RJC A;  4RTY A;  1YFN A;  1VQN T;  2DXU A;  2KEA A;  2DM1 A;  5CR2 A;  3GF5 A;  1PCX A;  2MOX A;  3MHX A;  3P8H A;  1NEG A;  1M3C A;  4F04 B;  1S72 A;  1WDX A;  1YJW T;  4LD9 K;  4FYX B;  4DBH A;  2ROT A;  3GOX A;  3QO3 A;  2QEX T;  1Q82 U;  1W2B S;  4DOW A;  2DVE A;  5I21 A;  1WJQ A;  3UA6 A;  1QMC A;  2RD1 A;  3DB4 A;  3REB B;  4PJO G;  3X24 B;  3OYC A;  2K3Y A;  1M2V B;  2YT6 A;  1WZO A;  4J5Y A;  3HPW A;  4EIK A;  1PRL C;  4BDY A;  3MP6 A;  3T9N A;  3EG3 A;  1VYV A;  2QK0 A;  2IVW A;  2BIV A;  1D1A A;  1W70 A;  1X69 A;  4PJM A;  1JU5 C;  2PZ1 A;  2V8I A;  4XU3 A;  2ABL A;  2FZC B;  1PRM C;  2CP7 A;  3A1P A;  5HCK A;  3CXC P;  3H0H A;  3A8O B;  4F7U B;  1RAF B;  2CS7 A;  2F1L A;  2FHD A;  1NJI C;  4BUG A;  4JUV A;  1KQ2 A;  1VQL A;  1TUC A;  1U8R A;  3CCV A;  3QYG B;  1YIT A;  1UJ0 A;  2DIG A;  1XOV A;  4C0Z A;  2RK2 A;  3QUI A;  3HRT A;  4XQ3 A;  1UFF A;  1YJ9 Q;  1OZ3 A;  1TS9 A;  3CBP A;  2VVK A;  5FWC A;  5J39 A;  2NYS A;  4DQ2 A;  1QVG P;  3C4S A;  3QZ9 B;  3RKX A;  4AFQ C;  1KD1 R;  3I9Q A;  1UGR B;  5GAN 6;  2DTH A;  2PUK B;  2ZAE A;  1T3S A;  1QVF P;  4X9D A;  3LYI A;  5FW9 A;  2P0K A;  1TG0 A;  2QAS A;  1ZUK A;  2AZS A;  3QJ6 A;  3KFV A;  3LLR A;  3EG9 A;  5LJ5 j;  2JTE A;  2ZPI B;  5CAI A;  3THK A;  2RI5 A;  1Z9Q A;  4V2S A;  4GLM A;  3R6O A;  3M53 A;  2H3J A;  2M16 A;  2Y90 A;  4HVU A;  3EGD B;  5A0L A;  2RHU A;  3MET A;  4NS5 A;  4DEX A;  4JJD A;  2BTT A;  4TVR A;  1G3Y A;  1YCY A;  2MI6 A;  3X28 B;  4C8Q G;  4EMH A;  2GF7 A;  4C92 E;  3OYA A;  1Q82 R;  2COZ A;  2DVJ A;  5GAN 4;  5GAO n;  3E9G A;  3X26 B;  4M75 D;  1WI7 A;  1S72 Q;  2K79 A;  1KHI A;  1WHG A;  2CDT A;  3CCE Q;  2DK3 A;  3FJ5 A;  1AVZ C;  4HVV A;  4A4H A;  1FMV A;  5GAN f;  4CI0 C;  1T3L A;  5D6X A;  2R5M A;  2BKD N;  3GLX A;  4PFO A;  2HSE B;  4D8K A;  1J3T A;  1QLY A;  2DFU A;  3CPF A;  2EWN A;  4E7J A;  1ACM B;  4ME7 A;  3J81 E;  1RI0 A;  3FRN A;  1VQ8 T;  1NG2 A;  5CKH A;  1Y57 A;  1M8V A;  3E9F A;  1FWZ A;  1AWJ A;  3AHU A;  3GIB A;  3MKD A;  1GCP A;  2GBQ A;  4PJO E;  5A0D A;  1I4K 1;  2LJ0 A;  2O9S A;  2DMO A;  2RQW A;  2LQN A;  5FWB A;  3UPU A;  1Q7Y C;  2RHY A;  1KD1 U;  1QCN A;  1R77 A;  2LT4 A;  4J9G A;  1W1F A;  4F17 A;  1SRL A;  1NYG A;  1VIF A;  3UDC A;  1SPK A;  3VJP A;  1WIE A;  4K11 A;  2GQI A;  2E3I A;  1U06 A;  3A5Z B;  1PM3 A;  1Y0M A;  3RDV A;  2JT4 A;  4RTZ A;  2R58 A;  1N8R C;  3Q1J A;  2D8J A;  2KE9 A;  1OEB A;  4QVD A;  4UC4 A;  2CZ7 B;  4C8Q A;  2VB6 A;  5FU6 B;  4N0A A;  5GAN 5;  1D3B A;  1UB4 A;  3GNG A;  4E7K A;  1T0J A;  3C94 A;  4LDY A;  3WVD B;  3CC7 Q;  4P5N A;  4E7L A;  4C5H A;  3CCR Q;  1DJ7 B;  2A08 A;  2RA2 A;  2YXY A;  5KYY A;  3GP8 A;  2HQX A;  2NUT A;  1NEB A;  2RMO A;  1KQS S;  1VQ8 A;  1WXT A;  3CCU A;  1WHJ A;  2QAZ A;  2NUP B;  4E7Z A;  2ED1 A;  2EYQ A;  3S3N A;  2DX1 A;  2QA4 Q;  4WCI A;  2KT8 A;  4D8D A;  2HL3 A;  2MMP A;  1K9M R;  1U5S A;  3CC7 T;  3REA B;  1YJN A;  1ABQ A;  2FEI A;  2D1X A;  1RAG B;  1MND A;  2DXT A;  1VQK Q;  1BIB A;  4JLG A;  4JZ4 A;  4CC4 B;  4M78 E;  4N0A C;  1ZSZ A;  2JXB A;  3JB9 G;  1H92 A;  3CCE T;  2DD5 A;  2LDM A;  1GL5 A;  5GAN h;  2LNV A;  5KYX B;  1IXD A;  4OF1 A;  5CKB A;  2KY9 A;  1K73 R;  2AHJ B;  5GAM g;  5CCA A;  5M9O A;  4GY5 A;  4C8Q E;  5GJW B;  1ARK A;  1VQO Q;  1VQO A;  1K8A C;  3QWX X;  2FZG B;  1QVG A;  3ER0 A;  2XD0 A;  2PTK A;  4F14 A;  2DYI A;  3UWN A;  1E6H A;  3PVQ A;  3EGD A;  3JCM f;  1C6V X;  4M7D D;  3OYJ A;  1YJW Q;  4RCC A;  4Q5W A;  4C0D B;  2AIR B;  1VQ7 Q;  1ZBJ A;  1M30 A;  3INZ A;  2J06 A;  3BDU A;  5EC7 A;  4IIO A;  1VQP Q;  2QQR A;  2RQU A;  1ZHI A;  2A36 A;  3O5Z A;  2XDP A;  1X6B A;  2ED0 A;  4E2F B;  5LJ5 g;  5IHN A;  1H8K A;  1MMN A;  2QQ9 A;  1ZA2 B;  3QWY A;  1E6G A;  2E41 A;  2L3S A;  3LWI A;  1D1C A;  5KCO A;  2CH4 W;  1GXI E;  4CC2 A;  2L89 A;  2W0Z A;  1TUG B;  4M75 E;  3DKM A;  4PLI A;  2F5K A;  1V76 A;  3LGF A;  2WAC A;  3FB9 A;  4HKE A;  1QWF A;  2HCK A;  1PSE A;  2VXF A;  1YIT T;  3F70 A;  3PTA A;  2ENM A;  1AT1 B;  1ZUU A;  3ME9 A;  1JRI A;  1VQ5 Q;  1K1Z A;  3CCU Q;  4FYW B;  1KD1 C;  5L8R E;  1JO8 A;  5LJ5 d;  1WHK A;  2EBP A;  3JCM X;  1O9S A;  3VS3 A;  3CME Q;  1SEM A;  1WLP B;  4BB7 A;  2O4X B;  4C5E A;  4J6X A;  5GAN g;  2KRM A;  2GFU A;  3UT1 A;  4PFP A;  1WQW A;  3AT1 B;  4M7A D;  2GCX A;  3M59 A;  2BE9 B;  4BI4 A;  4M7D F;  2KRS A;  7AT1 B;  1VQ4 Q;  4XU2 A;  3EFR A;  1M2V A;  1W2B A;  2ZPF B;  1OYX A;  4BAC A;  1WJS A;  1VQ9 Q;  4C92 B;  1YHQ Q;  3QHS A;  4F7U G;  4LDV A;  3CD6 Q;  4B9W A;  5L23 A;  5CKD A;  3JB9 F;  4R55 A;  4M77 B;  3QKJ A;  3G71 T;  2DER A;  2EQK A;  1KFZ A;  1YJW A;  4PFZ A;  3JCM d;  2DBM A;  1IHV A;  2AT1 B;  1XQH A;  3NHN A;  4J6W A;  3M0S A;  1M2O A;  3O8V A;  2COW A;  2NUZ A;  2VGN A;  2KI7 A;  2HD0 A;  4JJB A;  3M4Y A;  1VQN A;  3OS1 A;  1M90 U;  4QQG A;  2KBT A;  4PJO A;  2EQU A;  2XDB A;  1YJ9 T;  4QQD A;  3CMA A;  4C8Q F;  1P92 A;  2KXC A;  1N9S A;  2LJ3 A;  3I56 A;  1YIJ Q;  4M4Z A;  1KSW A;  5LJ5 h;  1KQS P;  2EQJ A;  4F7U F;  3X20 B;  2RPN A;  1WFW A;  1MUZ A;  1VQP A;  4OMQ A;  1TXQ A;  1VQ4 T;  1SSF A;  4M7D C;  1RAI B;  1XJW B;  1VQM T;  2BZX A;  4QVC A;  1WHH A;  2O4X A;  1UGP B;  2EPD A;  2LCC A;  3ULR B;  2K5F A;  4PJO D;  2Z0W A;  1VQ5 A;  4NOY A;  3L2W A;  2DJQ A;  1YNZ A;  2CZ0 B;  4OML A;  1OI1 A;  4M7A G;  4DBQ A;  4MDW A;  3CCM Q;  4FIB A;  3KXT A;  1GFC A;  2DKG A;  1LNX A;  3FJP A;  3S3M A;  2X9H A;  4JPB W;  1YHQ A;  4C5G A;  2MWO A;  1G3T A;  3VS5 A;  2FB7 A;  8ATC B;  3OYN A;  5GAO r;  1VQ6 T;  1Q81 U;  1H64 1;  4HT8 A;  1UG1 A;  4FSX A;  4FT4 A;  3SDZ A;  2LJ1 A;  3OYK A;  5KH6 A;  2PU9 B;  4IKF A;  4HCZ A;  4ZGE B;  2H3E B;  4JDS A;  2DL4 A;  1BIA A;  5KYN A;  2OTL T;  1BU1 A;  3E2U A;  2EGE A;  1JQQ A;  1QCF A;  1D3B B;  4OMF B;  5LJ3 j;  1IRX A;  3OYB A;  1WA7 A;  1RLP C;  3I5S A;  4HCK A;  2J7I A;  4EMK A;  2J05 A;  4PJO F;  2MK5 A;  5CVI A;  2DNU A;  3HRS A;  1K9M U;  3EG2 A;  2KYM A;  1I0C A;  5CQY A;  1Q7Y R;  1X6O A;  3EG9 B;  2DET A;  2MF2 A;  4Z8A A;  4A4G A;  4X34 A;  2DE0 X;  3JB9 I;  4KUI A;  2LX7 A;  3VS4 A;  4M78 B;  2E12 A;  4OMM A;  2F2V A;  3CC2 Q;  3CCV Q;  1R0B G;  1VQ9 T;  2FVU A;  3A8M B;  1I5L A;  2LQ8 A;  4JJN K;  5FRN A;  4LXC A;  5LJ5 f;  2W10 A;  2FO0 A;  3H41 A;  3V8J A;  4M7A E;  1IZ6 A;  2CZ1 B;  1AWO A;  3RMS A;  1BI0 A;  1Y96 B;  4OMO A;  1PNJ A;  3P8D A;  5GAO p;  2IG0 A;  5J26 A;  4AG2 C;  2QQB A;  2DEU A;  2DZ9 A;  1SSH A;  2KSS A;  2MPX C;  4ZN1 A;  1Y07 A;  2PVO B;  4M77 G;  3M5A A;  1YIT Q;  1B34 A;  3LH0 A;  3V7C A;  3RKW A;  3CBO A;  1W6X A;  1RAA B;  3OW2 S;  1V29 B;  1Q81 R;  3JCM h;  3A8G B;  3MJX A;  2V8K A;  3JAM E;  2A37 A;  2OTJ A;  4X9C A;  2LCL A;  2AK5 A;  3OS0 A;  2OTL A;  1YP5 A;  3OYD A;  3OYY A;  2KYB A;  4J9C A;  3D7S B;  3JB9 H;  1X2K A;  3ZEH A;  3CCQ A;  4R0K A;  1JXO A;  2QGF B;  1M9S A;  4QQ6 A;  5D6Y A;  2RHZ A;  4J6Y A;  4BE2 A;  3JCM V;  4B9X A;  1U1T A;  1VQ6 A;  1VQ6 Q;  4J9E A;  1E7O A;  1X43 A;  1M90 R;  3NMZ C;  1BI3 A;  1YHQ T;  1WQ7 A;  3QII A;  2K5I A;  2QQA A;  4MMK A;  3CXC S;  3ZL7 C;  2HBW A;  1VUB A;  1JEG A;  1K0X A;  2JMA A;  2PQW A;  3VUB A;  2P0P A;  2JMC A;  2WSC E;  2CP2 A;  4OP0 A;  3DB3 A;  2DLP A;  2HKQ B;  1WYX A;  3I35 A;  4RTT A;  2HZY A;  2JZ2 A;  4KUD K;  4BE1 A;  3OQ5 A;  5GAN 2;  4M75 A;  5I2M A;  1PHT A;  1NJI U;  1ZSG A;  4XTZ A;  3UAT A;  1X2Q A;  5KYU B;  1OQK A;  4JJC A;  1WHL A;  2RM4 A;  2RJE A;  3CCE A;  3CXC A;  4E7S A;  3M0Q A;  2RO0 A;  3LW5 E;  3PMT A;  4A54 A;  2JNG A;  2F2X A;  1G83 A;  3CCV T;  2KK4 A;  2CH4 A;  2R5A A;  5GMK j;  4ANJ A;  5DLQ E;  3LWH A;  2KT1 A;  4Z02 A;  3A98 A;  2QA4 T;  1UGV A;  4ZNX A;  5D7U A;  1I1J A;  2CP3 A;  2EJ9 A;  1KJW A;  3U23 A;  2ZCF B;  3EFS A;  3QXE B;  4EPC A;  4JS5 A;  2ESW A;  4OGE A;  2CGH A;  4XTU A;  3JCM g;  3RES A;  2O9V A;  2DJZ A;  1QP2 A;  2CP0 A;  3CCR T;  4NL2 A;  2KRO A;  2HEQ A;  3CCQ T;  1PKT A;  1VYT A;  3VKI A;  5A0G A;  1SG5 A;  4KGZ B;  2FPD A;  4FL6 A;  1JB0 E;  1OPL A;  1AD5 A;  2L2P A;  3G71 Q;  1NPP A;  2K4Y A;  2OTL Q;  2JOY A;  4C0D C;  3UA7 A;  3TEE A;  5KYW A;  4Y92 A;  4C92 C;  2EYW A;  1QKX A;  2QEX A;  4FCY A;  5GMK i;  2CRE A;  1RAE B;  2SRC A;  5LJ3 e;  2CSI A;  2M0Y A;  2QDY B;  1BK2 A;  1BB9 A;  4RUG A;  2EFI A;  1Q82 C;  5HKC A;  4E47 A;  2M02 A;  3L2R A;  1ZSZ C;  1NM7 A;  3MCA B;  4O5V A;  2MAM A;  2M51 A;  2EYZ A;  3S6W A;  1JBM A;  3EHR A;  4OB0 B;  2VUB A;  3TSZ A;  2DAQ A;  3RNJ A;  4QT7 A;  5IHK A;  1KC8 R;  4LD6 A;  3HP9 A;  4XK8 E;  3G6E T;  2EJG A;  3QDF A;  3L1A A;  1UJY A;  3VS0 A;  2CYZ B;  2QXF A;  1VQ9 A;  3CD6 A;  2GTJ A;  2CSQ A;  3MP8 A;  4BI8 B;  4M7A F;  3VU3 C;  4PK4 A;  3RR6 A;  3HHT B;  2RJF A;  1OV3 A;  4PJO C;  1HSQ A;  3BDL A;  2PVG B;  3G4S T;  4HCC A;  3OW2 P;  1B7T A;  3EG0 A;  3OBY A;  1RAB B;  4GBQ A;  2RHX A;  4D6W A;  2F5T X;  3C12 A;  2GFA A;  4ZGD B;  1G5V A;  2A3L A;  3I55 Q;  3PVL A;  3C0C A;  4J8O A;  1VQ7 T;  2O31 A;  1UHC A;  2KVQ G;  3G6E Q;  1GRI A;  1K4U S;  4OB2 B;  4CRI A;  3M0R A;  4M7A B;  3EFO B;  3FDR A;  3WXM B;  2RI2 A;  4F7U A;  3GBQ A;  2EYY A;  2B8A A;  1WXB A;  2QTV A;  1N8R R;  2Y4Y A;  1FX7 A;  1GFD A;  3CPW P;  2EGA A;  4X1V A;  2D0N A;  1BKB A;  4KGX B;  2CP5 A;  2XK0 A;  3VYH B;  5GAO q;  1ZX6 A;  3HFO A;  1LJO A;  2QYZ A;  3NGP A;  3RIR A;  2VXE A;  4M78 G;  1PWT A;  4C0G A;  1M27 C;  4MZT A;  3SB2 A;  1ZA1 B;  2QI2 A;  5LJ3 f;  5FU7 B;  2CP6 A;  3L2Q A;  1VQ7 A;  1WGS A;  4M7D B;  2L3P A;  3ASK A;  3EHQ A;  2KNB B;  3OY9 A;  1NYF A;  3L42 A;  3JSC A;  3CC7 A;  3VS6 A;  3CCQ Q;  2DXC A;  1SF9 A;  2DRK A;  2A0F B;  1EIF A;  2C0I A;  1U3O A;  4MDX A;  1BCO A;  2E70 A;  4B6M A;  3MEA A;  3CCU T;  2JW4 A;  2K7A A;  3EGX A;  1N27 A;  3VUZ A;  1VQ8 Q;  3SWN B;  3M0U A;  4DOV A;  3PMI A;  1TU0 B;  2O2O A;  4C92 A;  4M78 C;  2QDL A;  1IGQ A;  2ROL A;  2D9T A;  3OYI A;  2K2M A;  3P8B B;  4ZGJ B;  2YUP A;  2YLB A;  5GAM e;  3EAE A;  3TU4 K;  3HTR A;  2PNI A;  3TQ7 P;  4N4G A;  1PG5 B;  3PFS A;  1H3H A;  2PVD B;  4ELZ C;  3G4S A;  1N8R U;  3OSV A;  1JJ2 S;  2E64 A;  2HDA A;  1ZBX A;  1YJN Q;  3QYH B;  5I22 A;  2XIC A;  4Z89 A;  2EKO A;  2L3Q A;  4YTL A;  2LVM A;  3SWN A;  4R56 A;  1CKA A;  3CMA Q;  3MEW A;  2HQH A;  4BD3 A;  2BZY A;  1K9M C;  2DEQ A;  3G6E A;  3OSS C;  1H3Z A;  4IUQ A;  2V26 A;  3I55 T;  5KYU A;  4IIM A;  2GGR A;  2HMA A;  3V8L A;  4DEY A;  3UF4 A;  1UGQ B;  4M75 C;  2XI9 A;  3PIP A;  1JJ2 A;  2VV5 A;  3JCM P;  4L5G A;  2R57 A;  3QDR B;  1VQK T;  2YWW A;  1FMK A;  4FW2 A;  5AYF A;  2F2W A;  1YI2 Q;  4N4H A;  3FLG A;  5I11 A;  1UE9 A;  1MGQ A;  2P4T A;  1K73 U;  4JS4 A;  4FU6 A;  1HXD A;  1K9A A;  2KXD A;  3JV3 A;  2J6O A;  3IQL A;  3NFC A;  2LZ6 B;  4HXJ A;  4M7D G;  5GAN d;  2KQW A;  3KBG A;  4JRK A;  3OS5 A;  4FM4 B;  1UDL A;  4C92 G;  4J7I A;  3A8H B;  1I8F A;  4M75 B;  1QW1 A;  2P4R A;  1M1K U;  2DIQ A;  4BI3 A;  3M4G A;  3CCS A;  2JS2 A;  3MPU B;  1HK9 A;  3OB9 A;  1SHG A;  2LP5 A;  1RI9 A;  3BW1 A;  4RTW A;  2JS0 A;  4KBM B;  3RMQ A;  3TSW A;  1HYO A;  1Q81 C;  5GAM h;  2YRD A;  4M75 F;  4FT2 A;  2ZGW A;  4N4I A;  2E6Z A;  4JLI A;  4Y91 A;  3SWN C;  1K73 C;  2KMT A;  2MWP A;  4BDZ A;  3URG A;  3SHW A;  4XTV A;  4M77 A;  4DA4 A;  5GJV B;  1AOJ A;  3CPW A;  4M78 D;  4EMK C;  3HSB A;  2YUO A;  2RI3 A;  3EH2 A;  1HD3 A;  2M9U A;  3JB9 J;  1KC8 C;  3BE3 A;  4M78 A;  1UTI A;  2RF0 A;  3QZ5 B;  2OI3 A;  5KYX A;  3VRZ A;  3PGG A;  2DPP B;  5IT9 E;  3JCM c;  1M90 C;  2OAU A;  4LNP A;  2HQE A;  1KHC A;  2O01 E;  4XTY A;  4RTV A;  2YSQ A;  4FW1 A;  2ZPG B;  6AT1 B;  1WPY A;  1SKU B;  1NBE B;  4WF2 A;  3M55 A;  2MCN A;  2Y4X A;  1ZQ1 A;  2FL7 A;  1YJN T;  4A4K A;  2A7Y A;  3PNW C;  1PSF A;  4AMC A;  2XDD A;  5ECA A;  1MMD A;  2QGG A;  2P0Q A;  2XHC A;  3EG1 A;  3OMC A;  1GBR A;  2OAW A;  4L59 A;  3M0P A;  1PD0 A;  2V1Q A;  2FYK A;  2ECZ A;  2I2L A;  3VV0 A;  3CME T;  5DLO A;  3CC4 A;  3JCM b;  5LJ3 h;  2DYB A;  4M78 F;  2VC8 A;  4XTW A;  3N5B B;  5HK3 A;  5GMK l;  3H6Z A;  4J83 A;  4LUD A;  4LDW A;  5J3B A;  2V1R A;  2YHT A;  3CCM A;  2JVV A;  3SFM A;  2DO3 A;  4IUT A;  2L5Q A;  4PNO A;  4BY6 B;  3JRZ A;  2QEX Q;  2DL5 A;  1BYM A;  4MML A;  4IUR A;  3C95 A;  3RKY A;  1VA7 A;  1B3Q A;  3R6N A;  3JCM e;  2BZ8 A;  1D1B A;  1KQS A;  4RG2 A;  1OPK A;  2JTF A;  5GAN 3;  1Q7Y U;  1QCO A;  1AHJ B;  2X35 A;  4LUE A;  5IHI A;  1TUD A;  1Y96 A;  4KT0 E;  4EDU A;  2D8H A;  3DLM A;  1GCQ A;  3NPF A;  1RAH B;  1JXM A;  1WHM A;  3TCJ A;  1X6G A;  1N5Z A;  3M9Q A;  1YCS B;  2NUP A;  1M5Q 1;  3GPL A;  2DIL A;  4M77 E;  3NTI A;  4L6V 5;  1UUE A;  1LCK A;  2X4J A;  2YLC A;  5KE3 A;  2CKK A;  3CCL Q;  3RUX A;  1PKS A;  4XU1 A;  2JN0 A;  2EGC A;  2YRC A;  1T0H A;  1FMW A;  4VUB A;  5C6S A;  2VGM A;  1WNL A;  5GMK e;  1V1C A;  2K2V A;  2EAY A;  3OA6 A;  2LCS A;  2DXB A;  4M7A C;  5FLX E;  1UHF A;  4M77 D;  2K57 A;  3JCM Q;  2EVR A;  4IUP A;  1UEC A;  3BY7 A;  4JRP A;  2VYT A;  1OX8 A;  1I07 A;  2K6D A;  3M58 A;  4Y28 E;  1XNI A;  4C92 D;  1YI2 T;  2J6K A;  1M1G A;  2LRQ A;  1M1F A;  4OB3 B;  5GAN 8;  3SD4 A;  3EGU A;  3VRY A;  5D6W A;  2E65 A;  1Q86 C;  4HCB A;  4IUU A;  1M4Z A;  2DZC A;  3H8Z A;  4OVA A;  1Y71 A;  2BE7 D;  4JRQ A;  1VQP T;  1K8A U;  3RER A;  2ATC B;  3CCJ T;  2X3X D;  1D09 B;  3M57 A;  1YI2 A;  3E19 A;  5GMK h;  5FU7 C;  3H0I A;  3QJY A;  2XMF A;  3OYF A;  1RAC B;  4PL6 A;  3L2V A;  3NTK A;  1YIJ T;  5CO7 A;  3I56 T;  2EW3 A;  3GNF B;  4QVZ A;  3OYH A;  4M7D A;  5DY9 A;  3CMA T;  1VQL Q;  3DLL A;  1QVF A;  1SRM A;  4AT1 B;  1CSK A;  2RJD A;  4M77 F;  3M0T A;  1KIK A;  3NTH A;  3M54 A;  2XID A;  4C92 F;  3OMG A;  4PJL A;  3EGX B;  5KCH A;  2RQV A;  4PJJ A;  1GCQ C;  1QKW A;  3G71 A;  2DD4 A;  1VIE A;  5GAM f;  4J9I A;  4KUL A;  2CUB A;  1VQM A;  3CD6 T;  1VQ4 A;  5GAN j;  1G8X A;  4FYY B;  3G7Z A;  1KQ1 A;  3VS7 A;  2CT4 A;  2OTJ Q;  4ELY C;  2WSE E;  1VQL T;  4AFU C;  3MEU A;  3V7S A;  4A53 A;  1UEB A;  4A4E A;  4J9D A;  2L3R A;  5HK0 A;  2G3R A;  3CCL A;  1IHW A;  1ZUY A;  5CIU A;  4LN2 A;  5FRM A;  4OB1 B;  4E6R A;  1ZLM A;  2KRN A;  4E7I A;  5CK9 A;  3A8L B;  2IPO B;  4EMG A;  1WXU A;  3J7A F;  3HL8 A;  3EH1 A;  2YUN A;  1OZ2 A;  1QVF S;  9ATC B;  2XU8 A;  3G4S Q;  4MZM A;  1M3B A;  2RK1 A;  5AT1 B;  4A4F A;  1QVG S;  1RLQ C;  1PC0 A;  1PD1 A;  4J9H A;  4RG8 A;  2I0N A;  4CC7 A;  3M56 A;  5FRO A;  1WJR A;  3LX7 A;  4Z88 A;  1ZSZ B;  3EFO A;  2KDS A;  1BCM A;  2LQK A;  5CKE A;  1TWB A;  1G3W A;  3VS1 A;  4MZP A;  3TRE A;  1Q95 G;  1NE8 A;  1B07 A;  1S72 T;  2FRY A;  4A63 B;  5GAM j;  3CC4 T;  2NWM A;  1NLP C;  3G1J A;  1AZE A;  3H0F A;  5CKF A;  1FYN A;  2K3B A;  4C8Q D;  2PUO B;  1MV3 A;  3CCL T;  2H8H A;  2RB6 A;  2E5K A;  1WX6 A;  4IUV A;  2V8J A;  1KC8 U;  4F7U E;  5LJ3 g;  2L0A A;  3CC2 A;  2HSP A;  3QSU A;  4RMO A;  1EFN A;  4QW2 A;  5GAM d;  1Q86 R;  4NL3 A;  2VWF A;  2NLU A;  2E5Q A;  4C8Q C;  5A2Q E;  3E1S A;  4C0F A;  2LMJ A;  4LE9 A;  5KYW B;  1VQO T;  1OU9 A;  3MO8 A;  2FPF A;  1YWP A;  2X4X A;  2D6F A;  1X27 A;  1MV0 B;  5IN1 A;  1N9R A;  1AWW A;  1QWE A;  3BFM A;  1W2B P;  2A28 A;  3CCR A;  2DL7 A;  2X3W D;  1QQJ A;  4OMN A;  4DBR A;  4HVW A;  2ZPE B;  1YWO A;  2M0O A;  2HKN A;  5IXB A;  2E1H A;  4ATO A;  4RTU A;  1U1S A;  2CZ6 B;  1SHF A;  1KK7 A;  2WSF E;  2QA4 A;  3J80 E;  2JM8 A;  1C1A A;  3OBW A;  4XAX B;  3FIF A;  3CCJ A;  3V7R A;  5C0M A;  3VS2 A;  3H9N A;  1N6A A;  1TSF A;  2HAX A;  1AWX A;  3S3O A;  2EQM A;  1GBQ A;  2E4H A;  3JCM J;  2DL8 A;  4PLL A;  2LX9 A;  2M1H A;  1XTD A;  1I81 A;  2AZV A;  1CKB A;  2MIO A;  4RKU E;  3OW2 A;  1EX4 A;  1G3S A;  2EQI A;  4AG1 C;  1M1K C;  2ZPH B;  2CUD A;  3FEO A;  1X01 A;  1Y7X A;  1IGU A;  4ORZ A;  4AFS C;  2FG0 A;  1JJ2 P;  3VYG A;  2OTJ T;  2YRV A;  3OYG A;  4FYV B;  2EKH A;  1EZZ B;  1K76 A;  3OYE A;  2KR3 A;  1FXX A;  5GAN e;  3MP1 A;  3RBB B;  2E3H A;  3QG1 A;  2K9G A;  3OYM A;  3PT9 A;  1VQK A;  4F16 A;  5IH2 A;  1RL2 A;  1OOT A;  4BE0 A;  2G6F X;  5GAO m;  1I5O B;  4E7H A;  1NLO C;  2RNA A;  5IXF A;  1O75 A;  1QP3 A;  1LPL A;  1TH7 A;  3I55 A;  3CC4 Q;  2C06 A;  5KYY B;  4OMP A;  5DM7 R;  1NPR A;  2JUF A;  2CT3 A;  1AZG B;  3OS2 A;  1K0S A;  2LC4 A;  2GNC A;  4RCB A;  2KAF A;  1OUL A;  2IIM A;  2RN8 A;  4WTO B;  2ZZD A;  4HT9 A;  2FZK B;  2DTO A;  1IO6 A;  4RTX A;  5FU6 C;  2JJ9 A;  2QTX A;  2E10 A;  1K8A R;  8AT1 B;  1OX9 A;  2DA9 A;  2FPE A;  5EG2 A;  2RHI A;  3CCJ Q;  2XKO C;  3HFN A;  3L2Z A;  4FSS A;  1D0Z A;  4CC3 A;  2J6F A;  3L2U A;  1G2B A;  2K3X A;  5GAN 7;  1F1B B;  2DRM A;  2F69 A;  4LDX A;  4PJN A;  1IB8 A;  5GMK m;  4M77 C;  3OYL A;  2NUT B;  1BI1 A;  4M7D E;  1MMA A;  2X4Y A;  2DF6 A;  4ZN3 A;  3CCM T;  2HBP A;  1C0M A;  2MYS A;  4J9B A;  1M3A A;  1NZ9 A;  2LNH B;  1AEY A;  2C0O A;  3TVT A;  1R0C B;  2VKN A;  3CPW S;  1TTH B;  1YN8 A;  3CME A;  3CBM A;  3CQT A;  4ZTF A;  2LT1 A;  4KRT A;  1VOM A;  1YBY A;  5LJ3 d;  4LDU A;  2B86 A;  2HNI A;  3X25 B;  1IRE B;  3LH5 A;  2YUQ A;  1A0N B;  3JCM W;  2KGT A;  1W4S A;  2AKK A;  1R8O B;  1VYU A;  4KH1 B;  4OGC A;  1HJD A;  1TOV A;  2LQW A;  4C5I A;  2DBK A;  2EJF A;  3HRU A;  2E6N A;  5LL6 S;  1Q86 U;  4ESR A;  4XU0 A;  1RAD B;  4II1 A;  4J7F A;  5IAY A;  3QPH A;  4KGV B;  3I56 Q;  1YIJ A;  1BBZ A;  5CQX A;  4JZ3 A;  4PJO B;  2O88 A;  2QQS A;  5GAO l;  1MMG A;  1D0Y A;  4KH0 B;  1NJI R;  1S1N A;  4XTX A;  1VQN Q;  5HY6 A;  2HL5 C;  1LVK A;  2BUD A;  2COY A;  2RQT A;  1M1K R;  4DBF A;  5LJ5 e;  4C8Q B;  4J9F A;  5I2S A;  4AFZ C;  2AKL A;  1B34 B;  3ZFJ A;  2LTO A;  4O6J A;  2JM9 A;  2VAS A;  2QG9 B;  1Z9Z A;  2P84 A;  2OX7 A;  1M8M A;  2GQV A;  4M75 G;  4BY6 C;  4PKC C;  1RUW A;  2YDL A;  2C0T A;  3SEM A;  3MEV A;  2RQR A;  3V8K A;  1YJ9 A;  3LGL A;  3CCS T;  1LOJ A;  2K5L A;  3KUF A;  2GTO A;  2DL3 A;  4QKU A;  2X4W A;  1OU8 A;  1ABO A;  2SEM A;  2ZPB B;  3QBY A;  1D0X A;  4JRI A;  3HKS A;  2OJ2 A;  4EMK B;  2L8D A;  2D0Q B;  3JB9 D;  1VQ5 T;  3FC3 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 1VQP T;  2F5T X;  4BB7 A;  2O4X B;  3C12 A;  4J6X A;  4C5E A;  5GAN g;  1K8A U;  2GFU A;  3PIO A;  3UT1 A;  2GFA A;  3RER A;  4ZGD B;  1G5V A;  1BI2 A;  1WQW A;  2A3L A;  4M7A D;  2GCX A;  3M59 A;  3CCJ T;  4BI4 A;  4M7D F;  2EIF A;  4J8O A;  3M57 A;  2JTM A;  1VQ7 T;  1YI2 A;  3E19 A;  5GMK h;  2XG8 D;  4XU2 A;  5FU7 C;  2KVQ G;  3EFR A;  3QJY A;  3OYF A;  1W2B A;  2ZPF B;  1OYX A;  3NTK A;  1UGS B;  4OB2 B;  4PL6 A;  5CO7 A;  4CRI A;  3I56 T;  3GNF B;  1WJS A;  4BAC A;  4M7A B;  3FDR A;  3WXM B;  4QVZ A;  2RI2 A;  4C92 B;  3QHS A;  4ZTJ A;  4F7U G;  4F7U A;  3OYH A;  3CC2 T;  4LDV A;  5DY9 A;  3CMA T;  2B8A A;  2DTI A;  4M7D A;  4B9W A;  3DLL A;  5CKD A;  1MHN A;  3JB9 F;  2Y4Y A;  1QVF A;  1FX7 A;  4R55 A;  4M77 B;  4M7A A;  1QVP A;  3CEY A;  4GLK A;  3ZBD A;  1KG1 A;  3QKJ A;  3G71 T;  2RH2 A;  2EQK A;  2RJD A;  1X75 C;  4M77 F;  3WVE B;  1BKB A;  4HA8 A;  1YJW A;  5KE2 A;  3JCM d;  2RJC A;  3NTH A;  3M54 A;  2XK0 A;  3VYH B;  2XID A;  5GAO q;  1XQH A;  1VQN T;  4C92 F;  2DXU A;  3HFO A;  4J6W A;  3OMG A;  5KCH A;  5CR2 A;  3O8V A;  3GF5 A;  3G71 A;  1LJO A;  2VGN A;  2DD4 A;  3MHX A;  1VIE A;  2HD0 A;  3P8H A;  5GAM f;  3M4Y A;  4KUL A;  3RIR A;  2VXE A;  1VQN A;  3OS1 A;  1S72 A;  4QQG A;  1VQM A;  1M90 U;  4PJO A;  2EQU A;  4M78 G;  4C0G A;  2XDB A;  3CD6 T;  1VQ4 A;  1YJ9 T;  4QQD A;  1YJW T;  4LD9 K;  3CMA A;  5GAN j;  4MZT A;  4C8Q F;  3SB2 A;  3G7Z A;  1P92 A;  1N9S A;  3I56 A;  3GOX A;  1KQ1 A;  3QO3 A;  5LJ5 h;  2QI2 A;  2QEX T;  5LJ3 f;  5FU7 B;  4DOW A;  1W2B S;  1Q82 U;  2DVE A;  4ELY C;  5I21 A;  3L2Q A;  2WSE E;  2EQJ A;  1VQ7 A;  1WJQ A;  4F7U F;  1WGS A;  1VQL T;  4M7D B;  3X20 B;  3ASK A;  3MEU A;  3OY9 A;  2RD1 A;  3DB4 A;  3L42 A;  4PJO G;  3JSC A;  3X24 B;  3CC7 A;  3V7S A;  1VQP A;  4A53 A;  3OYC A;  2K3Y A;  1UEB A;  4A4E A;  2DXC A;  2L3R A;  4J5Y A;  3HPW A;  5HK0 A;  1VQ4 T;  1EIF A;  2G3R A;  3CCL A;  1SSF A;  4BDY A;  3MP6 A;  3T9N A;  4M7D C;  1VQM T;  5CIU A;  5FRM A;  4MDX A;  4OB1 B;  4QVC A;  4E7I A;  2E70 A;  2O4X A;  1UGP B;  2IVW A;  2BIV A;  2LCC A;  2K5F A;  3A8L B;  3MEA A;  5CK9 A;  3CCU T;  4EMG A;  1VQ5 A;  4PJO D;  3J7A F;  1N27 A;  3HL8 A;  4NOY A;  3VUZ A;  3L2W A;  4XU3 A;  2V8I A;  3SWN B;  2CZ0 B;  1OZ2 A;  1QVF S;  2XU8 A;  4DOV A;  1OI1 A;  3PMI A;  4M7A G;  4MZM A;  2RK1 A;  3A8O B;  4F7U B;  4C92 A;  4M78 C;  2CS7 A;  4A4F A;  1QVG S;  2FHD A;  1NJI C;  2D9T A;  4RG8 A;  4BUG A;  4JUV A;  3OYI A;  1KQ2 A;  1VQL A;  4MDW A;  3M56 A;  5FRO A;  1U8R A;  1WJR A;  3LX7 A;  3P8B B;  4FIB A;  3QYG B;  4ZGJ B;  3KXT A;  3CCV A;  1YIT A;  2DKG A;  3CC2 A;  2KDS A;  1LNX A;  2DIG A;  1XOV A;  4C0Z A;  3FJP A;  2LQK A;  2YLB A;  5CKE A;  2RK2 A;  3S3M A;  1G3W A;  3HRT A;  3QUI A;  4XQ3 A;  5GAM e;  3EAE A;  3TU4 K;  4MZP A;  3TRE A;  1YHQ A;  1NE8 A;  4C5G A;  2MWO A;  1S72 T;  1G3T A;  1OZ3 A;  3CBP A;  5GAM j;  3CC4 T;  2FB7 A;  3OYN A;  4N4G A;  5J39 A;  5GAO r;  1VQ6 T;  3PFS A;  1Q81 U;  1H64 1;  2PVD B;  5CKF A;  4C8Q D;  4HT8 A;  4DQ2 A;  4ELZ C;  3G4S A;  2PUO B;  3CCL T;  4FSX A;  1N8R U;  3C4S A;  3QZ9 B;  4FT4 A;  3OSV A;  3RKX A;  3SDZ A;  5KH6 A;  2E64 A;  2RB6 A;  3OYK A;  1JJ2 S;  2PU9 B;  1UGR B;  5GAN 6;  4IKF A;  4HCZ A;  1ZBX A;  2DTH A;  2PUK B;  3QYH B;  4ZGE B;  4IUV A;  4X9D A;  2V8J A;  2XIC A;  2P0K A;  3LYI A;  4F7U E;  2EKO A;  5LJ3 g;  1KC8 U;  4JDS A;  3QJ6 A;  1BIA A;  3LLR A;  4YTL A;  5LJ5 j;  2OTL T;  4RMO A;  2LVM A;  4QW2 A;  2ZPI B;  5CAI A;  5GAM d;  4NL3 A;  3QSU A;  2NLU A;  3SWN A;  4R56 A;  2E5Q A;  1D3B B;  3MEW A;  4OMF B;  4C8Q C;  2RI5 A;  5LJ3 j;  4BD3 A;  3OYB A;  4V2S A;  3R6O A;  1K9M C;  2DEQ A;  3G6E A;  5A2Q E;  3E1S A;  3M53 A;  4C0F A;  2H3J A;  2M16 A;  2Y90 A;  3OSS C;  1H3Z A;  1VQO T;  5A0L A;  2RHU A;  4EMK A;  3MET A;  4NS5 A;  3MO8 A;  4IUQ A;  4PJO F;  4TVR A;  1G3Y A;  5CVI A;  1YCY A;  2MI6 A;  2X4X A;  3X28 B;  2D6F A;  4C8Q G;  3I55 T;  3HRS A;  3V8L A;  4EMH A;  1K9M U;  2GF7 A;  5IN1 A;  4C92 E;  3OYA A;  1N9R A;  5CQY A;  1UGQ B;  4M75 C;  2XI9 A;  3BFM A;  1X6O A;  5GAN 4;  5GAO n;  3PIP A;  3CCR A;  1JJ2 A;  2VV5 A;  3JCM P;  3E9G A;  2MF2 A;  4A4G A;  3X26 B;  2ZPE B;  4X34 A;  4M75 D;  2M0O A;  4L5G A;  3JB9 I;  4KUI A;  2R57 A;  3QDR B;  4M78 B;  1VQK T;  2E12 A;  2E1H A;  4ATO A;  1U1S A;  2CZ6 B;  1KHI A;  5AYF A;  1VQ9 T;  2WSF E;  2QA4 A;  2DK3 A;  3J80 E;  4N4H A;  4A4H A;  2FVU A;  3FLG A;  3A8M B;  1MGQ A;  1I5L A;  2LQ8 A;  2P4T A;  4JJN K;  1K73 U;  5FRN A;  3OBW A;  4XAX B;  5GAN f;  3FIF A;  4FU6 A;  1HXD A;  3CCJ A;  3V7R A;  4CI0 C;  5LJ5 f;  5C0M A;  4JS4 A;  1N6A A;  5D6X A;  2HAX A;  2R5M A;  3S3O A;  2BKD N;  3GLX A;  2EQM A;  3NFC A;  4M7D G;  5GAN d;  2KQW A;  3V8J A;  3JCM J;  3CPF A;  2EWN A;  4M7A E;  4PLL A;  1IZ6 A;  2CZ1 B;  3KBG A;  3RMS A;  4JRK A;  1BI0 A;  4E7J A;  3OS5 A;  2LX9 A;  1Y96 B;  4FM4 B;  2M1H A;  1XTD A;  1I81 A;  4ME7 A;  4C92 G;  3J81 E;  1RI0 A;  4J7I A;  3P8D A;  3A8H B;  4RKU E;  1I8F A;  5GAO p;  2IG0 A;  4M75 B;  5J26 A;  3FRN A;  3OW2 A;  1QW1 A;  1VQ8 T;  1M1K U;  2QQB A;  2DIQ A;  1G3S A;  5CKH A;  2DZ9 A;  2KSS A;  4BI3 A;  1M1K C;  1M8V A;  4ZN1 A;  3E9F A;  2ZPH B;  3M4G A;  1Y07 A;  3CCS A;  1FWZ A;  3FEO A;  1HK9 A;  1X01 A;  3OB9 A;  2PVO B;  3AHU A;  4M77 G;  1Y7X A;  3GIB A;  3BW1 A;  3M5A A;  1B34 A;  4KBM B;  3RMQ A;  3LH0 A;  4PJO E;  3V7C A;  3VYG A;  2OTJ T;  2YRV A;  3RKW A;  3OYG A;  5A0D A;  3CBO A;  1Q81 C;  5GAM h;  3OYE A;  1I4K 1;  3OW2 S;  1V29 B;  4M75 F;  3A8G B;  4FT2 A;  2V8K A;  1FXX A;  3JCM h;  2ZGW A;  4N4I A;  5GAN e;  3JAM E;  2OTJ A;  4X9C A;  3MP1 A;  2LCL A;  3OS0 A;  2E6Z A;  3QG1 A;  4JLI A;  3UPU A;  4Y91 A;  2OTL A;  3OYM A;  3OYD A;  3OYY A;  1Q7Y C;  2RHY A;  3SWN C;  1K73 C;  3PT9 A;  1KD1 U;  2KMT A;  1VQK A;  3JB9 H;  1RL2 A;  2LT4 A;  2MWP A;  4BDZ A;  4BE0 A;  3URG A;  3ZEH A;  4XTV A;  4M77 A;  4DA4 A;  3CCQ A;  5GAO m;  1VIF A;  3UDC A;  3CPW A;  3HSB A;  4M78 D;  4EMK C;  4E7H A;  2RI3 A;  1M9S A;  4QQ6 A;  5D6Y A;  3VJP A;  2M9U A;  3JB9 J;  2RHZ A;  4J6Y A;  4BE2 A;  4M78 A;  1KC8 C;  3A5Z B;  3JCM V;  4B9X A;  1O75 A;  1U1T A;  3QZ5 B;  1VQ6 A;  1QP3 A;  1TH7 A;  3I55 A;  2R58 A;  3PGG A;  2DPP B;  1N8R C;  2C06 A;  5IT9 E;  3Q1J A;  3JCM c;  1BI3 A;  5DM7 R;  1M90 C;  4QVD A;  4UC4 A;  2CZ7 B;  1NPR A;  1YHQ T;  1YIJ T;  1WQ7 A;  4C8Q A;  2OAU A;  3QII A;  2K5I A;  2QQA A;  4MMK A;  3CXC S;  2JUF A;  2HQE A;  1KHC A;  2O01 E;  5FU6 B;  4XTY A;  3OS2 A;  4N0A A;  1VUB A;  2ZPG B;  1D3B A;  5GAN 5;  1UB4 A;  2LC4 A;  1WPY A;  4RCB A;  2KAF A;  2PQW A;  4WF2 A;  3M55 A;  2P0P A;  2WSC E;  2Y4X A;  3GNG A;  2ZZD A;  3VUB A;  1ZQ1 A;  4HT9 A;  4OP0 A;  2DTO A;  2FL7 A;  3DB3 A;  1YJN T;  4E7K A;  5FU6 C;  4A4K A;  3C94 A;  2A7Y A;  2QTX A;  2E10 A;  3PNW C;  1PSF A;  2JZ2 A;  4LDY A;  3WVD B;  2XDD A;  4KUD K;  4P5N A;  4BE1 A;  3OQ5 A;  5GAN 2;  4E7L A;  4C5H A;  4M75 A;  2P0Q A;  2RA2 A;  1DJ7 B;  2XHC A;  5EG2 A;  3GP8 A;  2HQX A;  2RHI A;  2XKO C;  3HFN A;  3L2Z A;  3OMC A;  5I2M A;  3L2U A;  2K3X A;  4L59 A;  1NJI U;  5GAN 7;  4XTZ A;  2F69 A;  4LDX A;  2FYK A;  1KQS S;  1VQ8 A;  3CCU A;  2I2L A;  5GMK m;  3VV0 A;  4M77 C;  5DLO A;  3OYL A;  3CME T;  3CC4 A;  3JCM b;  2EYQ A;  2RM4 A;  5LJ3 h;  3S3N A;  2RJE A;  3CCE A;  1BI1 A;  5HK3 A;  4M78 F;  2VC8 A;  4XTW A;  3N5B B;  5GMK l;  3CXC A;  3H6Z A;  4M7D E;  4J83 A;  2X4Y A;  2RO0 A;  2MMP A;  4LDW A;  3CC7 T;  3G6E T;  3LW5 E;  4ZN3 A;  3PMT A;  5J3B A;  2JNG A;  4A54 A;  1YJN A;  3CCM T;  2HBP A;  3CCV T;  2YHT A;  2KK4 A;  3CCM A;  2R5A A;  2DXT A;  5GMK j;  1BIB A;  2JVV A;  4JLG A;  3SFM A;  2DO3 A;  1NZ9 A;  2L5Q A;  4IUT A;  5DLQ E;  4PNO A;  4BY6 B;  3JRZ A;  4M78 E;  3LWH A;  4Z02 A;  4N0A C;  2QA4 T;  3JB9 G;  1BYM A;  4MML A;  4IUR A;  3C95 A;  3CCE T;  3RKY A;  2DD5 A;  2LDM A;  3CPW S;  5GAN h;  2EJ9 A;  2ZCF B;  3QXE B;  3EFS A;  3JCM e;  3CME A;  2LNV A;  3CBM A;  4EPC A;  2LT1 A;  4JS5 A;  4ZTF A;  1KQS A;  4OGE A;  4RG2 A;  2CGH A;  2JTF A;  5GAN 3;  1YBY A;  5LJ3 d;  4XTU A;  3JCM g;  4OF1 A;  3RES A;  4LDU A;  5CKB A;  2DJZ A;  2HNI A;  2KY9 A;  1Q7Y U;  1AHJ B;  1QP2 A;  2AHJ B;  5GAM g;  5CCA A;  2X35 A;  3X25 B;  3CCR T;  5M9O A;  4GY5 A;  4NL2 A;  1IRE B;  4C8Q E;  1Y96 A;  4KT0 E;  3CCQ T;  3VKI A;  5A0G A;  3JCM W;  1W4S A;  4EDU A;  1VQO A;  1K8A C;  4FL6 A;  3DLM A;  1JB0 E;  1R8O B;  4OGC A;  1QVG A;  3ER0 A;  1NPP A;  2K4Y A;  3TCJ A;  4C5I A;  2XD0 A;  2EJF A;  3M9Q A;  3HRU A;  2E6N A;  2JOY A;  5LL6 S;  4C0D C;  1Q86 U;  4XU0 A;  3UWN A;  3TEE A;  1M5Q 1;  4C92 C;  3JCM f;  4II1 A;  2QEX A;  4J7F A;  5IAY A;  3GPL A;  4M7D D;  3QPH A;  3OYJ A;  1YIJ A;  4M77 E;  5GMK i;  3NTI A;  4RCC A;  5CQX A;  4L6V 5;  4Q5W A;  4C0D B;  5LJ3 e;  4PJO B;  2QDY B;  2EFI A;  2QQS A;  3INZ A;  5GAO l;  3BDU A;  3L2V A;  1Q82 C;  5HKC A;  4E47 A;  4XTX A;  2X4J A;  2QQR A;  3L2R A;  2YLC A;  1ZHI A;  5HY6 A;  5KE3 A;  3MCA B;  2CKK A;  2XDP A;  4O5V A;  2MAM A;  5LJ5 g;  2BUD A;  2QQ9 A;  3RUX A;  3S6W A;  4XU1 A;  1JBM A;  2JN0 A;  4OB0 B;  2VUB A;  5LJ5 e;  2E41 A;  3LWI A;  2DAQ A;  4VUB A;  4C8Q B;  5C6S A;  5I2S A;  5KCO A;  2VGM A;  1WNL A;  5GMK e;  1B34 B;  4LD6 A;  2K2V A;  2L89 A;  3ZFJ A;  1GXI E;  2LTO A;  4O6J A;  2EAY A;  3HP9 A;  4M75 E;  3OA6 A;  2DXB A;  3DKM A;  4M7A C;  5FLX E;  2F5K A;  2GQV A;  2K57 A;  4M77 D;  4PLI A;  4XK8 E;  2EJG A;  3LGF A;  3JCM Q;  2WAC A;  4M75 G;  4IUP A;  4BY6 C;  3L1A A;  3FB9 A;  3BY7 A;  2VXF A;  2VYT A;  1PSE A;  2CYZ B;  4HKE A;  4PKC C;  4JRP A;  1YIT T;  2QXF A;  1VQ9 A;  3M58 A;  4Y28 E;  1XNI A;  3MEV A;  4C92 D;  3V8K A;  1YI2 T;  1YJ9 A;  3F70 A;  3PTA A;  3LGL A;  3CD6 A;  3MP8 A;  4BI8 B;  4M7A F;  3CCS T;  1LOJ A;  2K5L A;  1JRI A;  3KUF A;  3ME9 A;  1M1G A;  2LRQ A;  1M1F A;  4JRQ A;  4OB3 B;  3VU3 C;  5GAN 8;  3SD4 A;  2X4W A;  1KD1 C;  5L8R E;  3HHT B;  2RJF A;  2ZPB B;  3QBY A;  5D6W A;  5LJ5 d;  4PJO C;  2E65 A;  1Q86 C;  3BDL A;  2PVG B;  4JRI A;  3HKS A;  3G4S T;  4HCC A;  4IUU A;  1M4Z A;  4HCB A;  4EMK B;  2DZC A;  3H8Z A;  4OVA A;  1O9S A;  1Y71 A;  2L8D A;  3OBY A;  3JCM X;  2D0Q B;  3JB9 D;  1VQ5 T;  3FC3 A;  2RHX A;  4D6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...