1VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
95
Chain Sequence
MQFKVYTYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Plasmid
molecule keywords CCDB
total genus 26
structure length 95
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1vubA00
3G7ZA 5CO7A 4ME7A 2VUBA 1M1FA 5CKHA 4VUBA 5CKDA 3NFCA 4MDXA 3TCJA 5CKBA 5CQYA 4OF1A 3JRZA 5CR2A 3JSCA 2KMTA 1NE8A 5DLOA 5CKEA 4ELYC 3HPWA 2C06A 4MZPA 5HK0A 4ELZC 5CK9A 5CKFA 5CCAA 4HKEA 4MZMA 3VUBA 1X75C 2MF2A 1VUBA 5HKCA 5CQXA 5HK3A 4MZTA 1UB4A
chains in the Genus database with same CATH superfamily
2O9SA 2P0QA 2DTHA 4DQ2A 1VQ7T 4EMHA 3OBYA 3RKWA 2ZGWA 1N27A 3SHWA 3CCET 1K9MR 4EPCA 5GMKl 2OTJT 1KQSA 1YHQT 2RJDA 3X25B 2O9VA 5A0DA 2DETA 1G83A 5GANd 2W10A 3OA6A 1VQ8Q 3CCRT 1RUWA 4M77A 3TSZA 5LJ5j 3WVDB 3OYLA 2YLCA 2MIOA 4RTZA 1QLYA 2CZ1B 2VV5A 4FIBA 2KQWA 1CSKA 2DRMA 3QZ9B 3WVEB 2HQEA 2CT3A 1DJ7B 1VIFA 2FYKA 5ECAA 1K73C 2XKOC 2RPNA 2K3YA 5KCHA 1SRLA 2DL7A 3EG3A 4R0KA 4C92G 2H3JA 2QGGA 3G71A 4GY5A 1JU5C 2JS0A 2EWNA 2VVKA 2FZKB 1PKTA 2PU9B 2VUBA 4GLKA 3I5RA 3L2ZA 4XU0A 1A0NB 2JTEA 4M7AC 2QEXT 2QA4T 2DKGA 1JBMA 4CRIA 5J3BA 3FRNA 4C8QE 1QVFA 2PUOB 1X43A 3UPUA 4B9WA 3CMET 3EHRA 5LJ3f 2GTOA 3FLGA 3H0HA 1SG5A 4ZTFA 5D7UA 2DL5A 2LJ0A 1UHCA 4RUGA 2DPPB 4FT2A 4J9CA 4M7AE 1W70A 3OS5A 1TWBA 3MHXA 2J7IA 1WFWA 3TU4K 2LCCA 1MNEA 3I35A 1K76A 2MMPA 2O4XB 2L5QA 2D0NA 4M7DF 4C92F 2RNAA 2B8AA 2P84A 1K8AU 1TOVA 2JM8A 1OOTA 1RADB 3LGFA 1HD3A 1EIFA 4EIKA 1WHJA 4KUDK 1B7TA 2DFUA 3AHUA 1VQOQ 2RQRA 2CP2A 3VS0A 3NGPA 1FX7A 2ZPBB 2K3XA 5I2SA 1WJQA 1H92A 1VIEA 5FU6C 3ER0A 2K6DA 4J9DA 1U5SA 1WJSA 5J26A 1WGSA 1LOJA 2LQWA 4IKFA 1I0CA 5IHKA 4ZN3A 3QHSA 2M1HA 4BI8B 1BKBA 3R6NA 3P8HA 1KC8U 4DBQA 1VQ9T 2DMOA 4ZGDB 2E6NA 2RA2A 3JB9I 4YTLA 5CKEA 2L3PA 2XMFA 1Y96B 2QEXQ 1UGPB 2CZ6B 1WJRA 2IG0A 1YIJQ 2D1XA 2CGHA 4KGXB 3E2UA 2K3BA 1LPLA 3CMEQ 4C5HA 1FWZA 3BE3A 4ANJA 4M75C 2KGTA 3CMEA 3REBB 1VYUA 2EQMA 2VGMA 5A2QE 1PSFA 3CCRQ 4O5VA 5KE2A 1ACMB 3TEEA 1SSHA 4C0ZA 1WHLA 3CBOA 3CCMT 6AT1B 2C0TA 2RO0A 1WI7A 4E7SA 3LGLA 2DL8A 2LNVA 7AT1B 2FRYA 3CCQQ 5L8RE 1FYNA 1YWOA 2QAZA 5GANh 1SHFA 2E10A 2FB7A 2JT4A 3SFMA 3G6EQ 4BB7A 2XHCA 3C0CA 4QW2A 1QVFS 2RF0A 4PK4A 2HNIA 1OPLA 3HTRA 1NM7A 1QMCA 4Y28E 4QVDA 3A8OB 1ZSGA 1MNDA 1U06A 2J05A 4M77C 3M53A 1NBEB 3ZL7C 5CKBA 1R77A 4PJOG 1YJNQ 2KMTA 1MHNA 4M7AB 2EBPA 3OYIA 4PJOC 4AG1C 2K57A 5GAMd 2YUQA 1G3TA 1M90C 2KEAA 2XD0A 5GMKi 3L2WA 4DBRA 4ME7A 2A7YA 3CC4T 1IZ6A 1UTIA 1UDLA 1TUDA 1NYFA 4ZN1A 2L8DA 3G4SQ 4F7UG 5D6XA 1G5VA 2FZCB 2DYBA 1HSQA 1Q86R 2QYZA 1W6XA 4QQDA 2J6FA 1OU8A 1OQKA 1NJIU 3EGUA 1X75C 3L2VA 2YHTA 3CBMA 1Y0MA 2NUZA 4PJOD 4FL6A 4J6WA 3CD6Q 1VQ7A 1OPKA 5IHIA 3RNJA 3CCMQ 2J06A 2RQVA 1VQMT 1FMVA 2EGEA 1PC0A 2FZGB 3EGXB 1SF9A 3FJ5A 1D1CA 3A1PA 3OYDA 4J5YA 2YT6A 4C0DC 3C4SA 2CDTA 2DO3A 2JTMA 2C0IA 5LJ5h 1PNJA 2K4YA 1AT1B 1BIBA 1WLPB 4EMGA 1YJ9A 2GBQA 4E6RA 2D6FA 3Q1JA 2MAMA 4ZTJA 3CCJQ 3KBGA 3HSBA 1P92A 1IGUA 5FWCA 8AT1B 2OJ2A 1EZZB 1UEBA 1SSFA 1G2BA 4XTYA 2EKHA 3RKYA 1OX8A 3I56A 4XTWA 3BDLA 2GFUA 1VQ6A 3C94A 2RHIA 3A98A 3JCMP 2L2PA 4OB3B 1M4ZA 3AT1B 3EH1A 3GPLA 4X1VA 3VS6A 1UG1A 2EFIA 2YDLA 1IHVA 3UF4A 1PHTA 3NMZC 1FMKA 4FW2A 2DZ9A 2GF7A 1UGRB 3E9FA 1ZBXA 4F7UE 4HA8A 1QP3A 1OU9A 2DXBA 4Z02A 3UWNA 4XTZA 2K2VA 1CKBA 4LDYA 5KYXB 3L1AA 3G6EA 1WHMA 1UE9A 3P8DA 2ED1A 1I5OB 2KNBB 5HK3A 1HK9A 3O8VA 4FU6A 1W2BP 4ORZA 1B34B 4PJOE 2COWA 5LL6S 3LH0A 2EYYA 3HKSA 1Y07A 3PMTA 4M7AA 2DM1A 5EG2A 3JCMV 4M75A 4A53A 2KSSA 1ABOA 4KGZB 5LJ3g 3OW2A 1BI1A 3VV0A 3JCMe 3CBPA 1ZSZA 1FMWA 2QQBA 4OP0A 3GIBA 4PFPA 2LJ3A 4NL2A 4DBFA 4HKEA 4OMFB 2R5AA 4IUUA 1JXMA 4M77G 3WXMB 3G4SA 2DNUA 2O31A 3BW1A 3CC7A 2QQSA 2BE9B 3EGDA 5I22A 2KR3A 2RQTA 3GNGA 3UDCA 5GANf 2EJGA 1WX6A 5AT1B 1JJ2A 2D8HA 3ZEHA 3CMAQ 2FPDA 1KQ1A 1SEMA 3M59A 2JW4A 5KYYA 2ABLA 1S72T 4X9DA 2DLPA 4E47A 2HZYA 4JRQA 5GANj 2DEUA 3M0PA 2DBKA 3HRSA 1RAIB 1H8KA 2DK3A 2CZ7B 3M58A 2K5LA 1LNXA 4C92A 3I56Q 1IGQA 1K0SA 3HRUA 2HSEB 4D6WA 3H6ZA 4HXJA 2EIFA 4J6XA 4FW1A 3CXCA 2CP5A 5LJ3d 1WNLA 4C92D 1Q86C 3INZA 2KY9A 5HKCA 2HCKA 3VYHB 2I0NA 1RAAB 3URGA 4HT8A 1YJWQ 4C0DB 4Z89A 2CZ0B 4C5EA 3CC4A 3G71Q 4BE0A 4JZ4A 2CUDA 1TS9A 2CH4A 3HFOA 9ATCB 3KUFA 5KYXA 5I2MA 3A8LB 4MMLA 3MJXA 4HCZA 3G1JA 1I81A 4LD9K 2CH4W 2RD1A 3GBQA 2LCSA 1RAGB 2ROTA 3JCMd 2RMOA 4HVUA 2E3IA 4J9BA 3JSCA 3OS0A 2EQJA 2JOYA 3QDFA 5GJVB 4CC3A 2E5QA 1JB0E 1VQLA 3MEAA 5EC7A 1RLQC 2KRMA 4A4EA 4M7AG 2OX7A 1X01A 1SRMA 2A28A 4C8QD 4LDXA 4MDXA 1S72Q 2QG9B 2KXDA 3A5ZB 2FO0A 2LT1A 4IUVA 3PGGA 2VB6A 5LJ5e 2BKDN 3QDRB 2QTXA 5KYUB 3VU3C 3CCVT 1ZA1B 3FIFA 1M2VB 3LWIA 5HY6A 2QXFA 3CCMA 1TG0A 2PUKB 1Q82C 4DOVA 3LX7A 2HDAA 1WXTA 3NHNA 2WACA 2FG0A 1AHJB 3PVQA 3M57A 3QJ6A 2QA4A 1UJ0A 5LJ3e 1R8OB 4F04B 4J9EA 2C06A 3IQLA 1QCOA 2ZPHB 5CCAA 1JJ2S 1T0JA 1Q82U 3J7AF 2JTFA 2CUBA 4A4KA 3G71T 4M7DC 3E9GA 3PVLA 2HAXA 2FRWA 2LNHB 1QVFP 1SKUB 5FW9A 4J83A 4RMOA 1MMNA 1GCPA 3NFCA 3JCMQ 2GQVA 1CKAA 4UC4A 3V7RA 4AFUC 4M77B 3SWNC 4M7DE 2RB6A 2EYXA 3KXTA 2AKKA 1M1KU 4OGEA 5M9OA 2X51A 4M75E 1KD1U 4KH0B 4IURA 3C12A 2Y90A 3CQTA 5GMKj 3I55Q 1VQLT 3EGDB 5GAMf 4M7DA 1JQQA 2I2LA 2FL7A 2A37A 4M7AF 2L3RA 4OMLA 1PWTA 4BE1A 2COYA 1B3QA 1UGSB 1VQPA 2ZPEB 1BU1A 3MP6A 4PJOA 1ZSZB 2YUNA 5GANe 4E7LA 4JLGA 4J6YA 3A8HB 3OS1A 2JMCA 1QKXA 1VQOA 1GFCA 2O88A 1K8AR 1LVKA 1KQ2A 1Q7YC 3H8ZA 5FU7B 3HL8A 4F7UA 5FU6B 3CCLT 1MMAA 4FM4B 4PJOB 3DLMA 2FVUA 1M8VA 2V1QA 4EDUA 2YUOA 3ZBDA 2PTKA 4ZGJB 2VXFA 1VQNQ 2EGAA 4JJCA 4OMNA 3KFVA 1K73R 3JV3A 2AK5A 3QWXX 3V7CA 1JXOA 4BY6B 1M5Q1 2DE0X 3DB4A 2RH2A 1H3HA 5FRNA 2SEMA 2LC4A 1UHFA 3RDVA 2DBMA 2FHDA 4Q5WA 4M7DD 1D1AA 4C92E 2KT8A 4MDWA 5GAN2 1SHGA 2X9HA 3I55A 5CO7A 2HL5C 3E19A 4RTUA 2ZPGB 2XDBA 1K73U 1M90U 4J9FA 3SDZA 2QI2A 5IN1A 3CCRA 2LVMA 2F2VA 1K9MC 2LX9A 1QCFA 4EMKB 3MEVA 1RAEB 4XTUA 2RJFA 4N4IA 3VUZA 1AOJA 3CCUA 2JNGA 5GAN5 5D6WA 3M4YA 3QWYA 1UJYA 2RN8A 4FT4A 5GJWB 3GOXA 5KYWA 1BBZA 5CIUA 4M7DB 1VQ6T 2K5FA 1OV3A 1AWJA 4R55A 2M02A 1IO6A 2PVGB 4FYWB 4JPBW 2E4HA 4N4GA 2A0FB 3CCUT 1XQHA 2PQWA 5J39A 2E3HA 3QKJA 4E7JA 3OB9A 4C5GA 1JO8A 1WHGA 1Y96A 4PLIA 1I1JA 1QCNA 4N4HA 4KBMB 5KCOA 3JAME 1GL5A 1VQNA 3ASKA 3QYHB 2IVWA 2M0OA 4M77F 3ME9A 4Z88A 5HK0A 3I55T 3L42A 1VQLQ 1OYXA 1LJOA 3M0RA 2MF2A 1ZLMA 4FSSA 1NPRA 3SD4A 3RBBB 4M75G 3ZFJA 1VYVA 3H41A 4LUDA 2VYTA 3CCSA 5GAMj 4M78B 2R58A 4OMOA 4F14A 5GAN6 1N9SA 3QUIA 2NYSA 5IHNA 3EFOB 4IIMA 1YJ9T 2VKNA 4WCIA 2JN0A 1M9SA 2RJCA 2ROLA 3H9NA 1UECA 1WA7A 4JRPA 3OMCA 2L3SA 2CREA 2JZ2A 2EQIA 2DJQA 3THKA 2HL3A 4N0AC 1YHQQ 3OW2P 4BACA 2BIVA 1M2OA 5DLOA 3NPFA 5GAMh 2HSPA 2ZPIB 1T0HA 1Y7XA 3CD6T 2OAWA 4HT9A 5KH6A 1KFZA 2P0PA 1I4K1 1ZHIA 3GLXA 3RESA 1AEYA 3PTAA 1RABB 4QVZA 2F69A 3QBYA 1WYXA 1NZ9A 4M78D 3CXCP 1YJNA 1WQWA 3MP8A 4LDVA 2LCLA 1Q7YR 4NS5A 3QSUA 1R0BG 1KG1A 2PVDB 1OI1A 3VKIA 1K8AC 4F17A 2DVEA 1IREB 5IH2A 5CAIA 4PJOF 1ZUUA 2X4YA 4JJBA 5GAN3 2ZAEA 1G8XA 4E7HA 1V29B 4PJJA 3QPHA 1XTDA 4CC2A 4BI3A 5GAMe 2CS7A 2NUPB 1TXQA 1K4US 3EG9A 1V76A 2EQKA 3M0TA 1YN8A 3VS5A 2WSEE 4ATOA 4WF2A 3H0IA 1RAHB 2M0YA 4C0GA 4ELYC 1ABQA 3EG1A 4F7UF 3GF5A 2RK1A 1VQ7Q 2R5MA 3MCAB 3EG0A 2VXEA 2MWOA 4XQ3A 4M77D 1MMDA 5CQXA 4XU2A 1M1GA 1X6GA 5FROA 3FJPA 1D1BA 1YJ9Q 4RTXA 4IIOA 1MMGA 4JUVA 4J8OA 3VRYA 4M4ZA 4KUIA 1AZGB 4MMKA 3SWNA 3HPWA 2K79A 1W1FA 5GAOr 3EFRA 4A4HA 2X4JA 4E7ZA 1K1ZA 1VQ6Q 2H3EB 2O01E 2XI9A 4O6JA 2V8KA 4II1A 2HQHA 4F16A 4ESRA 1BIAA 3CCUQ 2FPFA 1D0ZA 2KRSA 1U3OA 1MUZA 4C8QF 1PD0A 1WHKA 1TSFA 2YWWA 1EX4A 1M27C 2P0KA 1YI2A 1VQOT 3V8KA 2DD4A 4QKUA 1TUGB 1Q82R 5GAOq 5GMKh 1M3BA 4XTVA 2W0ZA 1I5LA 1GXIE 2QQRA 5CVIA 1X2KA 2F5KA 2LP5A 3QYGB 4M75B 2CP0A 4BUGA 2RI3A 4DA4A 4LDUA 1B07A 5GANg 4R56A 2OTLA 1U1TA 1UB4A 2E5KA 2RM4A 3V8JA 2LQNA 2LDMA 3RKXA 2E65A 5IAYA 1N9RA 3M5AA 2EAYA 1YIJT 1KQSS 2M9UA 1YWPA 1D3BB 3RERA 2MWPA 1G3YA 1C6VX 1GRIA 2ZPFB 1VUBA 1YIJA 4MZTA 1OX9A 2KT1A 3JCMW 1YCSB 4L6V5 3CPWS 4M7DG 4HVWA 4FYVB 1Q81R 5AYFA 1YBYA 2MOXA 1Y71A 2DX1A 2ZZDA 2NLUA 3QIIA 2DEQA 1Y57A 4KULA 5LJ5f 5HCKA 8ATCB 4BE2A 1NPPA 4OGCA 2BZXA 4MZMA 3FEOA 2AIRB 2QASA 1O75A 2F1LA 4FYYB 5FLXE 4J7IA 2EW3A 1GFDA 2XICA 2CSQA 1JRIA 2SRCA 3OSSC 3VJPA 1I07A 1N6AA 2VWFA 2DA9A 3CC2Q 2L0AA 1RACB 1UUEA 1TH7A 1NEGA 1VQ5T 4QQ6A 3M9QA 4RTWA 3OQ5A 2E1HA 1M2VA 4QVCA 4JS5A 1YJWA 4AFQC 3M56A 1NEBA 3JCMX 2VASA 1F1BB 3DB3A 1MV0B 4V2SA 3EGXA 3JB9G 2JVVA 5GMKe 3CCSQ 1T3SA 1IHWA 3JCMf 2MPXC 5FU7C 3OYCA 2DXUA 3CC7T 1YITT 2Z0WA 3G4ST 3OYYA 4PKCC 3RMQA 1KK7A 1QWFA 4DEXA 3A8GB 1NJIC 3NTIA 1PKSA 1N8RC 1AD5A 1RI9A 1YHQA 2ENMA 2DRKA 3M0SA 3JRZA 4XU3A 4M78E 4JDSA 2HQXA 1UGQB 3L2QA 1H641 2CP6A 2LX7A 3CCQT 3MKDA 1RLPC 1GBRA 3CCEA 1VQMQ 4RTVA 5GAN4 4OMQA 3G6ET 4QQGA 5KYNA 3MEUA 5GAOm 5CKHA 4M78A 3D7SB 5CQYA 1PG5B 5KYUA 3CPFA 2OTJA 1NYGA 3T9NA 4PJLA 4CI0C 2VGNA 3TREA 3S6WA 3JB9F 3UA6A 1XOVA 4J9HA 3M0QA 1JJ2P 3OYHA 1R0CB 1ZUKA 4WTOB 2RQWA 1YJNT 1VQ5Q 2X35A 3M55A 3OYKA 3JCMb 2AZSA 4JJNK 3FDRA 1KQSP 5GAN8 4XK8E 2PZ1A 4X34A 2COZA 1ZSZC 2AKLA 3LWHA 1IRXA 2E6ZA 3CC4Q 3U23A 3CCST 1RAFB 3CCEQ 2EJ9A 5LJ5d 5KYYB 4OVAA 1ZBJA 2AT1B 4Y92A 3PFSA 4JRIA 2YRCA 5CKDA 4A63B 3PIPA 3MPUB 2OI3A 4FYXB 3QG1A 1LCKA 1PRMC 5KYWB 3I9QA 3H0FA 4JS4A 3OYFA 4ZNXA 4HCBA 2YRDA 2QDLA 1JEGA 5CK9A 2DL4A 1Z9QA 4QT7A 2ZCFB 2A36A 1FXXA 5KE3A 5IT9E 4JZ3A 1QKWA 4X9CA 4EMKA 2YXYA 3DLLA 4J7FA 2X4XA 2OAUA 4PJMA 2HBPA 4NL3A 1D09B 2BZ8A 1BCOA 2E41A 1G3WA 5GAN7 3CMAA 1KC8R 3JB9H 1VYTA 3N5BB 3CC2T 1M30A 3GNFB 4XTXA 2JS2A 1D0YA 4C8QC 1HXDA 3EFSA 3RUXA 1E6HA 4TVRA 2BE7D 2HKQB 4M78C 3EH2A 2YRVA 1E6GA 1QP2A 2HBWA 2DVJA 3O5ZA 3L2UA 1KC8C 5L23A 3VS4A 4ZGEB 2Y4YA 4FCYA 1ARKA 2D0QB 1QW1A 1GBQA 2QA4Q 3C95A 4OB0B 3CC2A 1VQPQ 1X2QA 2DILA 2J6KA 3CMAT 1BB9A 3VRZA 2H8HA 2A3LA 2EQUA 5CR2A 4RG2A 3CCQA 1WIEA 3CC7Q 4M78G 2CP3A 4VUBA 2RJEA 2CKKA 3UA7A 1M90R 2KYMA 4DEYA 2X3WD 5C0MA 2EJFA 1XJWB 2JM9A 2P4TA 4Y91A 3EAEA 5CKFA 2CSIA 1B34A 4A4FA 2RHYA 2QQAA 2LJ1A 2LRQA 3FB9A 1YITA 2MYSA 1AWXA 1W2BS 2RI2A 1ZQ1A 3SB2A 4B6MA 4OF1A 3X28B 1X69A 2WSFE 2F5TX 2KE9A 3PIOA 4B9XA 1N5ZA 1D0XA 1Q95G 4NOYA 4AFZC 2DF6A 1H3ZA 1YJWT 2ESWA 2K9GA 1T3LA 2PVOB 2ED0A 2E12A 3M4GA 3REAB 2LTOA 2XDDA 1NG2A 4KGVB 5I21A 2DYIA 1M3CA 4LUEA 3CCLA 1AVZC 1PCXA 2JMAA 2KXCA 3BY7A 3RIRA 2FPEA 4C8QG 4LXCA 3JCMc 2OTLQ 3UT1A 1BCMA 1U1SA 1YI2Q 4DOWA 4HCCA 2E64A 2NWMA 3CPWP 5FRMA 1EFNA 4JLIA 2JJ9A 1BI3A 4GLMA 4ELZC 1VQKT 1WPYA 1AWOA 3LW5E 3J81E 2NUTB 3OMGA 2V26A 1OEBA 2JUFA 1C1AA 3MP1A 1VQPT 1M1FA 2IIMA 1K9AA 2DXTA 1U8RA 4BI4A 2DIGA 3VYGA 1VQ9A 2XIDA 3R6OA 1KIKA 3PNWC 2EYWA 5GAOp 2DJZA 2JXBA 3OYEA 4JJDA 1RI0A 3S3MA 3ULRB 1VQ4T 3CCJA 2K5IA 5IXFA 2EGCA 4OB1B 1N8RR 5I11A 2LMJA 2LQKA 1NJIR 4BDZA 4RCBA 4K11A 2PNIA 3OY9A 3P8BB 5LJ3h 2WSCE 4FSXA 3JCMJ 1W4SA 1NE8A 2DD5A 2G3RA 2HKNA 4PL6A 1XNIA 2C0OA 1C0MA 1QWEA 3SWNB 2DL3A 3OYAA 3PMIA 2RI5A 3PE0A 4BDYA 2CT4A 2DTIA 3LYIA 2YSQA 3TQ7P 1NLOC 3V8LA 1K9MU 4A4GA 1OZ2A 1YI2T 1OZ3A 3HRTA 1SPKA 4N0AA 1MV3A 3J80E 1VQ5A 3G7ZA 2AHJB 4C92B 2KRNA 1N8RU 2L89A 1GCQC 3JB9J 3X26B 1YFNA 1S1NA 4C92C 2KVQG 2XU8A 4RTTA 4PFOA 4PLLA 3EHQA 4E2FB 2A08A 1QVGS 3HHTB 3VUBA 2NUTA 2XG8D 2D9TA 2R57A 3JB9D 1Q81C 4P5NA 2V8JA 1K0XA 1WDXA 1Z9ZA 4C0FA 1M8MA 4C8QA 5D6YA 3CCVQ 2Y4XA 2RHZA 2GCXA 2GFAA 3CEYA 1IXDA 2KAFA 1Q86U 3CCVA 2J6OA 2NUPA 5LJ3j 3HFNA 4KH1B 4BY6C 3I5SA 5A0LA 4M75F 4E7KA 3OYBA 3OW2S 1QQJA 3NTHA 5C6SA 3RMSA 3QO3A 4E7IA 4IUQA 3JCMg 1WQ7A 2O2OA 3S3OA 2HMAA 3E1SA 2MI6A 1PM3A 2HD0A 1TU0B 1PSEA 1VQ4A 3NTKA 2GNCA 2LT4A 2V1RA 3EG9B 3CXCS 2QDYB 3EG2A 2M16A 2OTLT 3V7SA 2CP7A 4KRTA 4J9IA 1BYMA 3VS2A 1HYOA 1QVPA 2XDPA 2DAQA 3M0UA 5LJ5g 1M3AA 1VQKQ 2F2XA 3CCJT 4AT1B 4AG2C 4RCCA 5DY9A 4XAXB 2BTTA 1VQKA 2RQUA 2DXCA 3TVTA 4OMMA 1E7OA 2B86A 1ZA2B 3X24B 3GP8A 3X20B 2G6FX 2FEIA 4L59A 2E70A 3UATA 4EMKC 4PJNA 1YP5A 4D8KA 1PRLC 2DIQA 2HEQA 4LNPA 3OYNA 2QTVA 3JCMh 1WZOA 2ECZA 3TCJA 1BI2A 1YCYA 2CYZB 1S72A 2QEXA 1VQ4Q 3S3NA 1QVGA 1KHIA 1QVGP 3LH5A 2RHXA 1AWWA 1I8FA 2MK5A 5GAMg 4XU1A 2KBTA 3BDUA 1PD1A 3VS1A 2GQIA 2LZ6B 1O9SA 1X6BA 2KK4A 2MCNA 4C5IA 4IUPA 1NLPC 3EFOA 5GMKm 3OYGA 2O4XA 3OYJA 4L5GA 1M1KR 2KI7A 3BFMA 2VC8A 4MZPA 3PT9A 3A8MB 4CC7A 1VQ8T 3MEWA 5FWBA 3CCLQ 1KD1C 1G3SA 5IXBA 2L3QA 4Z8AA 2KROA 2QK0A 1HJDA 4M75D 2EYQA 2DTOA 2EYZA 4M7AD 3META 2KYBA 2M51A 1VQNT 4CC4B 3RR6A 4HCKA 4A54A 4OB2B 3MO8A 1BI0A 1OULA 3VS3A 1WXBA 1D3BA 2BUDA 2BZYA 1J3TA 3HP9A 1KSWA 2YUPA 3OS2A 2X3XD 2EKOA 5GAOl 1Q81U 1V1CA 1IB8A 4PFZA 2GGRA 2QGFB 2XK0A 3TSWA 4LDWA 4LE9A 2P4RA 4RG8A 3I56T 4M78F 1Q7YU 3FC3A 1AZEA 3L2RA 4RKUE 2K2MA 2K7AA 2D8JA 3CD6A 4JRKA 3OSVA 4OMPA 3DKMA 3QZ5B 2QQ9A 1VA7A 2KDSA 4IUTA 1MGQA 1YITQ 2RHUA 2IPOB 4LD6A 2OTJQ 4LN2A 1ZX6A 4D8DA 2GTJA 4BD3A 1TUCA 5A0GA 1TTHB 4C8QB 2ATCB 1WXUA 2EPDA 3M54A 2LQ8A 1VQ8A 4AMCA 2DERA 1UGVA 4J9GA 1UFFA 3QJYA 1KD1R 1X27A 2YLBA 2EVRA 5DLQE 1X6OA 4AFSC 2F2WA 3F70A 3OYMA 4GBQA 1GCQA 1RL2A 1VQMA 3QXEB 3SEMA 1M1KC 1WHHA 1W2BA 5GAOn 1VOMA 1KHCA 2X4WA 4HVVA 1KJWA 4PNOA 5DM7R 4DBHA 4KT0E 1ZUYA 2AZVA 1YNZA 3VS7A 3LLRA 2DZCA 3OBWA 4F7UB 2V8IA 1BK2A 2RK2A 1VQ9Q 3CPWA 4RTYA 4M77E
chains in the Genus database with same CATH topology
4QVZA 2F69A 2P0QA 3BW1A 3QBYA 3CC7A 1YITA 2QQSA 1NZ9A 4M78D 2DTHA 4DQ2A 1YJNA 1WQWA 4EMHA 1W2BS 1VQ7T 3MP8A 3OBYA 3GNGA 4LDVA 2LCLA 3UDCA 2RI2A 1ZQ1A 3RKWA 3SB2A 5GANf 2EJGA 2ZGWA 4NS5A 4OF1A 1JJ2A 1N27A 3X28B 3QSUA 3ZEHA 2PVDB 1KG1A 1OI1A 2WSFE 2F5TX 3VKIA 1K8AC 3CCET 1KQ1A 3M59A 3PIOA 2DVEA 1IREB 4B9XA 4NOYA 4EPCA 4PJOF 5CAIA 5GMKl 1H3ZA 1YJWT 2X4YA 5GAN3 3M4GA 2OTJT 2PVOB 2E12A 2LTOA 4E7HA 2XDDA 1S72T 4X9DA 4E47A 5I21A 1V29B 4JRQA 2RJDA 1YHQT 1KQSA 3QPHA 5GANj 3X25B 1XTDA 5A0DA 3CCLA 5GANd 3RIRA 4BI3A 3OA6A 3BY7A 5GAMe 3CCRT 2CS7A 3HRSA 4C8QG 4M77A 5LJ5j 3JCMc 3WVDB 3UT1A 3OYLA 1U1SA 2DK3A 2EQKA 2CZ7B 2YLCA 2K5LA 1LNXA 2WSEE 3M58A 4C92A 4DOWA 4HCCA 4ATOA 4WF2A 2E64A 4C0GA 3HRUA 5FRMA 4JLIA 4D6WA 3H6ZA 4ELYC 4F7UF 2EIFA 3GF5A 2RK1A 4J6XA 1BI3A 4ELZC 3CXCA 2CZ1B 2VV5A 1WNLA 4FIBA 5LJ3d 4C92D 1VQKT 2R5MA 2KQWA 3MCAB 3INZA 1Q86C 4XQ3A 2VXEA 2MWOA 1WPYA 2KY9A 4M77D 3LW5E 3QZ9B 5CQXA 5HKCA 3J81E 4XU2A 1VQ9A 1M1GA 3OMGA 3VYHB 3WVEB 2JUFA 5FROA 3FJPA 3MP1A 3URGA 1VQPT 1M1FA 2HQEA 1DJ7B 4HT8A 1VIFA 4JUVA 2DXTA 1U8RA 4C0DB 4J8OA 2FYKA 1K73C 2CZ0B 4BI4A 4KUIA 2DIGA 2XKOC 3VYGA 2XIDA 2K3YA 3R6OA 3PNWC 4MMKA 4C5EA 5KCHA 3SWNA 3HPWA 5GAOp 3CC4A 2DJZA 4C92G 3OYEA 2H3JA 4BE0A 5GAOr 3EFRA 3G71A 4A4HA 3HFOA 1RI0A 2X4JA 4GY5A 3S3MA 3KUFA 1VQ4T 3CCJA 5I2MA 2EWNA 2K5IA 3A8LB 2O01E 2XI9A 4MMLA 4O6JA 4OB1B 4HCZA 1I81A 4LD9K 2PU9B 2V8KA 2VUBA 4GLKA 4II1A 2LQKA 3L2ZA 2RD1A 1BIAA 4RCBA 4BDZA 4XU0A 3OY9A 3P8BB 3JCMd 4M7AC 5LJ3h 2WSCE 2QEXT 2QA4T 4FSXA 3JCMJ 2DKGA 3JSCA 1JBMA 4CRIA 1W4SA 1NE8A 2DD5A 3OS0A 2G3RA 5J3BA 3FRNA 4C8QF 2EQJA 2JOYA 4PL6A 4C8QE 1QVFA 4HT9A 2PUOB 1XNIA 3UPUA 4B9WA 3CMET 2E5QA 1JB0E 2P0KA 1VQLA 3MEAA 3SWNB 3OYAA 5LJ3f 3PMIA 3FLGA 1YI2A 1VQOT 4ZTFA 2RI5A 4A4EA 4M7AG 3V8KA 1X01A 4C8QD 4LDXA 4MDXA 4BDYA 2DD4A 5GAOq 2DTIA 5GMKh 2DPPB 3A5ZB 4FT2A 4XTVA 3LYIA 2LT1A 4M7AE 1I5LA 1GXIE 2QQRA 5CVIA 2F5KA 4IUVA 3PGGA 3OS5A 3V8LA 5LJ5e 1K9MU 2BKDN 3MHXA 3QDRB 3QYGB 4M75B 2QTXA 2RI3A 4A4GA 4BUGA 1OZ2A 4DA4A 3VU3C 3CCVT 3TU4K 3FIFA 4LDUA 1OZ3A 2LCCA 4F7UB 1YI2T 3LWIA 5HY6A 2MMPA 3HRTA 2O4XB 2QXFA 5GANg 2L5QA 4N0AA 2PUKB 4R56A 3CCMA 1Q82C 4DOVA 3LX7A 2OTLA 3J80E 1UB4A 1U1TA 3G7ZA 4C92F 1VQ5A 2AHJB 4M7DF 2RM4A 2WACA 2B8AA 4C92B 1N8RU 3V8JA 2LDMA 3RKXA 2E65A 5IAYA 2L89A 1K8AU 1N9RA 1AHJB 3M5AA 3M57A 2EAYA 3JB9J 1YIJT 3X26B 3QJ6A 1KQSS 4C92C 2QA4A 3LGFA 2M9UA 2KVQG 1EIFA 2XU8A 5LJ3e 1R8OB 4KUDK 4PLLA 2C06A 3AHUA 1D3BB 1FX7A 3RERA 2ZPHB 2ZPBB 2K3XA 2MWPA 5CCAA 3HHTB 1WJQA 1G3YA 3VUBA 2XG8D 5I2SA 2D9TA 1QVGS 1VIEA 2ZPFB 5FU6C 2R57A 3ER0A 3JB9D 1Q82U 1WJSA 1VUBA 5J26A 4P5NA 1WGSA 1YIJA 1Q81C 4MZTA 2V8JA 1LOJA 3J7AF 2JTFA 4IKFA 4A4KA 4C0FA 3G71T 3E9GA 4M7DC 4ZN3A 2HAXA 3QHSA 4C8QA 2M1HA 4BI8B 1BKBA 4J83A 4RMOA 5D6YA 3JCMW 3NFCA 3P8HA 3JCMQ 1KC8U 2Y4XA 1VQ9T 4L6V5 2RHZA 2GCXA 3CPWS 4M7DG 2GQVA 2GFAA 5AYFA 4ZGDB 3CEYA 2E6NA 1YBYA 2RA2A 4UC4A 3V7RA 3JB9I 2KAFA 1Y71A 4YTLA 1Q86U 2ZZDA 2NLUA 4M77B 3CCVA 3QIIA 5CKEA 5LJ3j 2DEQA 3HFNA 3SWNC 2RB6A 4M7DE 1Y96B 4KULA 4BY6C 5LJ5f 5A0LA 3KXTA 1M1KU 4BE2A 1NPPA 1UGPB 4M75F 4OGCA 2CZ6B 4MZMA 4OGEA 5M9OA 3OYBA 3OW2S 4E7KA 1WJRA 2IG0A 3FEOA 3NTHA 2CGHA 4M75E 5C6SA 1KD1U 3RMSA 3QO3A 4E7IA 4IURA 1O75A 4IUQA 3C12A 3JCMg 1WQ7A 5FLXE 3S3OA 2Y90A 3E1SA 4J7IA 4C5HA 1FWZA 2MI6A 2XICA 2HD0A 1PSEA 5GMKj 4M75C 1JRIA 3OSSC 1VQ4A 3VJPA 1VQLT 1N6AA 3NTKA 3CMEA 2LT4A 2EQMA 2VGMA 5GAMf 5A2QE 3CXCS 4M7DA 1PSFA 2I2LA 2QDYB 1TH7A 2M16A 4O5VA 5KE2A 2FL7A 1VQ5T 3TEEA 4QQ6A 3M9QA 3V7SA 4C0ZA 2OTLT 4M7AF 2L3RA 3CBOA 3OQ5A 3CCMT 2E1HA 1BYMA 4QVCA 2RO0A 4JS5A 4BE1A 1YJWA 3M56A 3LGLA 2LNVA 1QVPA 3JCMX 1UGSB 2DAQA 2XDPA 2ZPEB 5LJ5g 1VQPA 3MP6A 5L8RE 4PJOA 3DB3A 3CCJT 4V2SA 5GANh 2E10A 2FB7A 4RCCA 3JB9G 2JVVA 5DY9A 5GMKe 3SFMA 3G4SA 4XAXB 5GANe 4E7LA 4BB7A 2XHCA 3JCMf 1VQKA 4JLGA 4QW2A 4J6YA 2DXCA 3A8HB 3OS1A 1QVFS 5FU7C 3OYCA 2DXUA 1VQOA 3CC7T 1YITT 3X24B 3G4ST 2HNIA 3OYYA 4PKCC 3GP8A 3PTAA 1KQ2A 3X20B 1Q7YC 3H8ZA 5FU7B 3RMQA 3A8GB 4Y28E 3HL8A 2E70A 4L59A 4QVDA 4EMKC 4F7UA 1NJIC 3A8OB 3NTIA 2DIQA 5FU6B 3OYNA 1N8RC 3CCLT 4M77C 3M53A 3JCMh 4FM4B 3TCJA 1BI2A 1YCYA 5CKBA 1YHQA 2CYZB 1S72A 2QEXA 4PJOB 3DLMA 2FVUA 3JRZA 3S3NA 4XU3A 4M78E 4PJOG 1QVGA 1M8VA 1KHIA 1MHNA 2KMTA 2RHXA 4JDSA 2HQXA 1I8FA 1UGQB 4M7AB 4EDUA 3L2QA 1H641 5GAMg 3ZBDA 4XU1A 3BDUA 3OYIA 3CCQT 4ZGJB 4PJOC 2VXFA 2K57A 3CCEA 5GAMd 1O9SA 1JJ2S 1G3TA 3V7CA 1M90C 2XD0A 5GMKi 4BY6B 2KK4A 1M5Q1 5GAN4 4C5IA 3L2WA 4IUPA 3G6ET 4QQGA 4ME7A 3DB4A 2RH2A 2A7YA 5GMKm 3MEUA 3CC4T 1IZ6A 5GAOm 2O4XA 3OYGA 3OYJA 5CKHA 5FRNA 4M78A 4L5GA 4ZN1A 2LC4A 5CQYA 2L8DA 4F7UG 5D6XA 1G5VA 3CPFA 2OTJA 2FHDA 2VC8A 3BFMA 4QQDA 3T9NA 4CI0C 2VGNA 4MZPA 3PT9A 3A8MB 4Q5WA 3S6WA 3TREA 1VQ8T 1NJIU 3JB9F 3MEWA 1XOVA 4M7DD 1KD1C 1X75C 1G3SA 2YHTA 4C92E 3L2VA 3CBMA 4MDWA 3OYHA 5GAN2 4PJOD 4FL6A 3I55A 4J6WA 1YJNT 5CO7A 4M75D 1VQ7A 3E19A 2EYQA 2DTOA 2X35A 4M7AD 3M55A 3OYKA 3META 2ZPGB 2XDBA 3JCMb 1VQNT 4JJNK 1VQMT 3FDRA 1K73U 1M90U 4A54A 3SDZA 5GAN8 4XK8E 4X34A 4OB2B 3LWHA 3MO8A 2QI2A 5IN1A 1BI0A 3CCRA 2E6ZA 2LVMA 1K9MC 2LX9A 4EMKB 3MEVA 3CCST 4XTUA 2RJFA 4N4IA 2EJ9A 3VUZA 1D3BA 2BUDA 5LJ5d 3OYDA 4J5YA 4OVAA 3CCUA 2JNGA 3HP9A 5GAN5 5D6WA 3PFSA 3C4SA 4C0DC 2DO3A 2JTMA 3M4YA 4FT4A 4JRIA 5LJ5h 5CKDA 3GOXA 2K4YA 3OS2A 1BIBA 5CIUA 3PIPA 4M7DB 2EKOA 5GAOl 1Q81U 3QG1A 4EMGA 1YJ9A 2K5FA 1VQ6T 4R55A 2PVGB 4JS4A 2XK0A 3OYFA 4HCBA 4LDWA 2D6FA 5CK9A 3Q1JA 4N4GA 4RG8A 2MAMA 4M78F 3I56T 3CCUT 1Q7YU 2ZCFB 1XQHA 2PQWA 5J39A 3L2RA 3FC3A 4ZTJA 4RKUE 1FXXA 5KE3A 3KBGA 5IT9E 3HSBA 4X9CA 1P92A 3QKJA 4EMKA 3CD6A 4E7JA 3OB9A 4JRKA 3OSVA 4C5GA 3DKMA 3QZ5B 2QQ9A 1Y96A 2KDSA 3DLLA 1SSFA 1MGQA 1UEBA 4IUTA 4J7FA 4N4HA 4PLIA 4XTYA 2RHUA 2X4XA 4KBMB 4LD6A 3RKYA 5KCOA 3JAME 1VQNA 2OAUA 3ASKA 3QYHB 3I56A 2IVWA 2M0OA 4XTWA 4M77F 3ME9A 2HBPA 4NL3A 4BD3A 5HK0A 2E41A 1G3WA 3BDLA 5A0GA 5GAN7 3I55T 2GFUA 3L42A 4C8QB 3CMAA 3JB9H 1OYXA 1VQ6A 1LJOA 3C94A 2MF2A 2RHIA 3N5BB 3JCMP 3M54A 3CC2T 4OB3B 1M4ZA 1NPRA 3GNFB 4XTXA 3SD4A 3GPLA 4M75G 3ZFJA 2EFIA 2LQ8A 1VQ8A 4C8QC 1HXDA 3EFSA 3RUXA 2DZ9A 2GF7A 1UGRB 3E9FA 4TVRA 1ZBXA 4M78C 4F7UE 2YRVA 4HA8A 1QP3A 1QP2A 2VYTA 3QJYA 2DXBA 3L2UA 1KC8C 4Z02A 3CCSA 5GAMj 2YLBA 3UWNA 4XTZA 5DLQE 1X6OA 4ZGEB 2K2VA 2Y4YA 4M78B 4LDYA 2D0QB 1QW1A 2R58A 3L1AA 5GAN6 1N9SA 3F70A 3QUIA 3OYMA 3G6EA 3C95A 4OB0B 1YJ9T 3CC2A 1RL2A 3P8DA 2JN0A 1VQMA 5HK3A 1M9SA 3QXEB 1M1KC 3CMAT 2RJCA 1HK9A 2A3LA 2EQUA 3O8VA 4FU6A 4RG2A 5CR2A 1W2BA 3CCQA 5GAOn 1B34B 1KHCA 4M78G 4PJOE 4VUBA 5LL6S 4JRPA 3LH0A 2X4WA 3OMCA 4M7AA 2JZ2A 1Y07A 3HKSA 3PMTA 2RJEA 2CKKA 5EG2A 3JCMV 4M75A 4A53A 2KSSA 4N0AC 4PNOA 5DM7R 5C0MA 5LJ3g 4BACA 3OW2A 2EJFA 1BI1A 4KT0E 3VV0A 2BIVA 5DLOA 3CBPA 3JCMe 2P4TA 5GAMh 2ZPIB 2QQBA 1Y7XA 3EAEA 4OP0A 4Y91A 3GIBA 3CD6T 3LLRA 4NL2A 2DZCA 3OBWA 5CKFA 2V8IA 4HKEA 4OMFB 2RK2A 2P0PA 1I4K1 2R5AA 4IUUA 1ZHIA 5KH6A 1B34A 3GLXA 4A4FA 2RHYA 3RESA 2QQAA 4M77G 3CPWA 3WXMB 2LRQA 3FB9A 4M77E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7Z A;  5CO7 A;  4ME7 A;  2VUB A;  1M1F A;  5CKH A;  4VUB A;  5CKD A;  3NFC A;  4MDX A;  3TCJ A;  5CKB A;  5CQY A;  4OF1 A;  3JRZ A;  5CR2 A;  3JSC A;  2KMT A;  1NE8 A;  5DLO A;  5CKE A;  4ELY C;  3HPW A;  2C06 A;  4MZP A;  5HK0 A;  4ELZ C;  5CK9 A;  5CKF A;  5CCA A;  4HKE A;  4MZM A;  3VUB A;  1X75 C;  2MF2 A;  1VUB A;  5HKC A;  5CQX A;  5HK3 A;  4MZT A;  1UB4 A; 
#chains in the Genus database with same CATH topology
 2O9S A;  2P0Q A;  2DTH A;  4DQ2 A;  1VQ7 T;  4EMH A;  3OBY A;  3RKW A;  2ZGW A;  1N27 A;  3SHW A;  3CCE T;  1K9M R;  4EPC A;  5GMK l;  2OTJ T;  1KQS A;  1YHQ T;  2RJD A;  3X25 B;  2O9V A;  5A0D A;  2DET A;  1G83 A;  5GAN d;  2W10 A;  3OA6 A;  1VQ8 Q;  3CCR T;  1RUW A;  4M77 A;  3TSZ A;  5LJ5 j;  3WVD B;  3OYL A;  2YLC A;  2MIO A;  4RTZ A;  1QLY A;  2CZ1 B;  2VV5 A;  4FIB A;  2KQW A;  1CSK A;  2DRM A;  3QZ9 B;  3WVE B;  2HQE A;  2CT3 A;  1DJ7 B;  1VIF A;  2FYK A;  5ECA A;  1K73 C;  2XKO C;  2RPN A;  2K3Y A;  5KCH A;  1SRL A;  2DL7 A;  3EG3 A;  4R0K A;  4C92 G;  2H3J A;  2QGG A;  3G71 A;  4GY5 A;  1JU5 C;  2JS0 A;  2EWN A;  2VVK A;  2FZK B;  1PKT A;  2PU9 B;  2VUB A;  4GLK A;  3I5R A;  3L2Z A;  4XU0 A;  1A0N B;  2JTE A;  4M7A C;  2QEX T;  2QA4 T;  2DKG A;  1JBM A;  4CRI A;  5J3B A;  3FRN A;  4C8Q E;  1QVF A;  2PUO B;  1X43 A;  3UPU A;  4B9W A;  3CME T;  3EHR A;  5LJ3 f;  2GTO A;  3FLG A;  3H0H A;  1SG5 A;  4ZTF A;  5D7U A;  2DL5 A;  2LJ0 A;  1UHC A;  4RUG A;  2DPP B;  4FT2 A;  4J9C A;  4M7A E;  1W70 A;  3OS5 A;  1TWB A;  3MHX A;  2J7I A;  1WFW A;  3TU4 K;  2LCC A;  1MNE A;  3I35 A;  1K76 A;  2MMP A;  2O4X B;  2L5Q A;  2D0N A;  4M7D F;  4C92 F;  2RNA A;  2B8A A;  2P84 A;  1K8A U;  1TOV A;  2JM8 A;  1OOT A;  1RAD B;  3LGF A;  1HD3 A;  1EIF A;  4EIK A;  1WHJ A;  4KUD K;  1B7T A;  2DFU A;  3AHU A;  1VQO Q;  2RQR A;  2CP2 A;  3VS0 A;  3NGP A;  1FX7 A;  2ZPB B;  2K3X A;  5I2S A;  1WJQ A;  1H92 A;  1VIE A;  5FU6 C;  3ER0 A;  2K6D A;  4J9D A;  1U5S A;  1WJS A;  5J26 A;  1WGS A;  1LOJ A;  2LQW A;  4IKF A;  1I0C A;  5IHK A;  4ZN3 A;  3QHS A;  2M1H A;  4BI8 B;  1BKB A;  3R6N A;  3P8H A;  1KC8 U;  4DBQ A;  1VQ9 T;  2DMO A;  4ZGD B;  2E6N A;  2RA2 A;  3JB9 I;  4YTL A;  5CKE A;  2L3P A;  2XMF A;  1Y96 B;  2QEX Q;  1UGP B;  2CZ6 B;  1WJR A;  2IG0 A;  1YIJ Q;  2D1X A;  2CGH A;  4KGX B;  3E2U A;  2K3B A;  1LPL A;  3CME Q;  4C5H A;  1FWZ A;  3BE3 A;  4ANJ A;  4M75 C;  2KGT A;  3CME A;  3REB B;  1VYU A;  2EQM A;  2VGM A;  5A2Q E;  1PSF A;  3CCR Q;  4O5V A;  5KE2 A;  1ACM B;  3TEE A;  1SSH A;  4C0Z A;  1WHL A;  3CBO A;  3CCM T;  6AT1 B;  2C0T A;  2RO0 A;  1WI7 A;  4E7S A;  3LGL A;  2DL8 A;  2LNV A;  7AT1 B;  2FRY A;  3CCQ Q;  5L8R E;  1FYN A;  1YWO A;  2QAZ A;  5GAN h;  1SHF A;  2E10 A;  2FB7 A;  2JT4 A;  3SFM A;  3G6E Q;  4BB7 A;  2XHC A;  3C0C A;  4QW2 A;  1QVF S;  2RF0 A;  4PK4 A;  2HNI A;  1OPL A;  3HTR A;  1NM7 A;  1QMC A;  4Y28 E;  4QVD A;  3A8O B;  1ZSG A;  1MND A;  1U06 A;  2J05 A;  4M77 C;  3M53 A;  1NBE B;  3ZL7 C;  5CKB A;  1R77 A;  4PJO G;  1YJN Q;  2KMT A;  1MHN A;  4M7A B;  2EBP A;  3OYI A;  4PJO C;  4AG1 C;  2K57 A;  5GAM d;  2YUQ A;  1G3T A;  1M90 C;  2KEA A;  2XD0 A;  5GMK i;  3L2W A;  4DBR A;  4ME7 A;  2A7Y A;  3CC4 T;  1IZ6 A;  1UTI A;  1UDL A;  1TUD A;  1NYF A;  4ZN1 A;  2L8D A;  3G4S Q;  4F7U G;  5D6X A;  1G5V A;  2FZC B;  2DYB A;  1HSQ A;  1Q86 R;  2QYZ A;  1W6X A;  4QQD A;  2J6F A;  1OU8 A;  1OQK A;  1NJI U;  3EGU A;  1X75 C;  3L2V A;  2YHT A;  3CBM A;  1Y0M A;  2NUZ A;  4PJO D;  4FL6 A;  4J6W A;  3CD6 Q;  1VQ7 A;  1OPK A;  5IHI A;  3RNJ A;  3CCM Q;  2J06 A;  2RQV A;  1VQM T;  1FMV A;  2EGE A;  1PC0 A;  2FZG B;  3EGX B;  1SF9 A;  3FJ5 A;  1D1C A;  3A1P A;  3OYD A;  4J5Y A;  2YT6 A;  4C0D C;  3C4S A;  2CDT A;  2DO3 A;  2JTM A;  2C0I A;  5LJ5 h;  1PNJ A;  2K4Y A;  1AT1 B;  1BIB A;  1WLP B;  4EMG A;  1YJ9 A;  2GBQ A;  4E6R A;  2D6F A;  3Q1J A;  2MAM A;  4ZTJ A;  3CCJ Q;  3KBG A;  3HSB A;  1P92 A;  1IGU A;  5FWC A;  8AT1 B;  2OJ2 A;  1EZZ B;  1UEB A;  1SSF A;  1G2B A;  4XTY A;  2EKH A;  3RKY A;  1OX8 A;  3I56 A;  4XTW A;  3BDL A;  2GFU A;  1VQ6 A;  3C94 A;  2RHI A;  3A98 A;  3JCM P;  2L2P A;  4OB3 B;  1M4Z A;  3AT1 B;  3EH1 A;  3GPL A;  4X1V A;  3VS6 A;  1UG1 A;  2EFI A;  2YDL A;  1IHV A;  3UF4 A;  1PHT A;  3NMZ C;  1FMK A;  4FW2 A;  2DZ9 A;  2GF7 A;  1UGR B;  3E9F A;  1ZBX A;  4F7U E;  4HA8 A;  1QP3 A;  1OU9 A;  2DXB A;  4Z02 A;  3UWN A;  4XTZ A;  2K2V A;  1CKB A;  4LDY A;  5KYX B;  3L1A A;  3G6E A;  1WHM A;  1UE9 A;  3P8D A;  2ED1 A;  1I5O B;  2KNB B;  5HK3 A;  1HK9 A;  3O8V A;  4FU6 A;  1W2B P;  4ORZ A;  1B34 B;  4PJO E;  2COW A;  5LL6 S;  3LH0 A;  2EYY A;  3HKS A;  1Y07 A;  3PMT A;  4M7A A;  2DM1 A;  5EG2 A;  3JCM V;  4M75 A;  4A53 A;  2KSS A;  1ABO A;  4KGZ B;  5LJ3 g;  3OW2 A;  1BI1 A;  3VV0 A;  3JCM e;  3CBP A;  1ZSZ A;  1FMW A;  2QQB A;  4OP0 A;  3GIB A;  4PFP A;  2LJ3 A;  4NL2 A;  4DBF A;  4HKE A;  4OMF B;  2R5A A;  4IUU A;  1JXM A;  4M77 G;  3WXM B;  3G4S A;  2DNU A;  2O31 A;  3BW1 A;  3CC7 A;  2QQS A;  2BE9 B;  3EGD A;  5I22 A;  2KR3 A;  2RQT A;  3GNG A;  3UDC A;  5GAN f;  2EJG A;  1WX6 A;  5AT1 B;  1JJ2 A;  2D8H A;  3ZEH A;  3CMA Q;  2FPD A;  1KQ1 A;  1SEM A;  3M59 A;  2JW4 A;  5KYY A;  2ABL A;  1S72 T;  4X9D A;  2DLP A;  4E47 A;  2HZY A;  4JRQ A;  5GAN j;  2DEU A;  3M0P A;  2DBK A;  3HRS A;  1RAI B;  1H8K A;  2DK3 A;  2CZ7 B;  3M58 A;  2K5L A;  1LNX A;  4C92 A;  3I56 Q;  1IGQ A;  1K0S A;  3HRU A;  2HSE B;  4D6W A;  3H6Z A;  4HXJ A;  2EIF A;  4J6X A;  4FW1 A;  3CXC A;  2CP5 A;  5LJ3 d;  1WNL A;  4C92 D;  1Q86 C;  3INZ A;  2KY9 A;  5HKC A;  2HCK A;  3VYH B;  2I0N A;  1RAA B;  3URG A;  4HT8 A;  1YJW Q;  4C0D B;  4Z89 A;  2CZ0 B;  4C5E A;  3CC4 A;  3G71 Q;  4BE0 A;  4JZ4 A;  2CUD A;  1TS9 A;  2CH4 A;  3HFO A;  9ATC B;  3KUF A;  5KYX A;  5I2M A;  3A8L B;  4MML A;  3MJX A;  4HCZ A;  3G1J A;  1I81 A;  4LD9 K;  2CH4 W;  2RD1 A;  3GBQ A;  2LCS A;  1RAG B;  2ROT A;  3JCM d;  2RMO A;  4HVU A;  2E3I A;  4J9B A;  3JSC A;  3OS0 A;  2EQJ A;  2JOY A;  3QDF A;  5GJV B;  4CC3 A;  2E5Q A;  1JB0 E;  1VQL A;  3MEA A;  5EC7 A;  1RLQ C;  2KRM A;  4A4E A;  4M7A G;  2OX7 A;  1X01 A;  1SRM A;  2A28 A;  4C8Q D;  4LDX A;  4MDX A;  1S72 Q;  2QG9 B;  2KXD A;  3A5Z B;  2FO0 A;  2LT1 A;  4IUV A;  3PGG A;  2VB6 A;  5LJ5 e;  2BKD N;  3QDR B;  2QTX A;  5KYU B;  3VU3 C;  3CCV T;  1ZA1 B;  3FIF A;  1M2V B;  3LWI A;  5HY6 A;  2QXF A;  3CCM A;  1TG0 A;  2PUK B;  1Q82 C;  4DOV A;  3LX7 A;  2HDA A;  1WXT A;  3NHN A;  2WAC A;  2FG0 A;  1AHJ B;  3PVQ A;  3M57 A;  3QJ6 A;  2QA4 A;  1UJ0 A;  5LJ3 e;  1R8O B;  4F04 B;  4J9E A;  2C06 A;  3IQL A;  1QCO A;  2ZPH B;  5CCA A;  1JJ2 S;  1T0J A;  1Q82 U;  3J7A F;  2JTF A;  2CUB A;  4A4K A;  3G71 T;  4M7D C;  3E9G A;  3PVL A;  2HAX A;  2FRW A;  2LNH B;  1QVF P;  1SKU B;  5FW9 A;  4J83 A;  4RMO A;  1MMN A;  1GCP A;  3NFC A;  3JCM Q;  2GQV A;  1CKA A;  4UC4 A;  3V7R A;  4AFU C;  4M77 B;  3SWN C;  4M7D E;  2RB6 A;  2EYX A;  3KXT A;  2AKK A;  1M1K U;  4OGE A;  5M9O A;  2X51 A;  4M75 E;  1KD1 U;  4KH0 B;  4IUR A;  3C12 A;  2Y90 A;  3CQT A;  5GMK j;  3I55 Q;  1VQL T;  3EGD B;  5GAM f;  4M7D A;  1JQQ A;  2I2L A;  2FL7 A;  2A37 A;  4M7A F;  2L3R A;  4OML A;  1PWT A;  4BE1 A;  2COY A;  1B3Q A;  1UGS B;  1VQP A;  2ZPE B;  1BU1 A;  3MP6 A;  4PJO A;  1ZSZ B;  2YUN A;  5GAN e;  4E7L A;  4JLG A;  4J6Y A;  3A8H B;  3OS1 A;  2JMC A;  1QKX A;  1VQO A;  1GFC A;  2O88 A;  1K8A R;  1LVK A;  1KQ2 A;  1Q7Y C;  3H8Z A;  5FU7 B;  3HL8 A;  4F7U A;  5FU6 B;  3CCL T;  1MMA A;  4FM4 B;  4PJO B;  3DLM A;  2FVU A;  1M8V A;  2V1Q A;  4EDU A;  2YUO A;  3ZBD A;  2PTK A;  4ZGJ B;  2VXF A;  1VQN Q;  2EGA A;  4JJC A;  4OMN A;  3KFV A;  1K73 R;  3JV3 A;  2AK5 A;  3QWX X;  3V7C A;  1JXO A;  4BY6 B;  1M5Q 1;  2DE0 X;  3DB4 A;  2RH2 A;  1H3H A;  5FRN A;  2SEM A;  2LC4 A;  1UHF A;  3RDV A;  2DBM A;  2FHD A;  4Q5W A;  4M7D D;  1D1A A;  4C92 E;  2KT8 A;  4MDW A;  5GAN 2;  1SHG A;  2X9H A;  3I55 A;  5CO7 A;  2HL5 C;  3E19 A;  4RTU A;  2ZPG B;  2XDB A;  1K73 U;  1M90 U;  4J9F A;  3SDZ A;  2QI2 A;  5IN1 A;  3CCR A;  2LVM A;  2F2V A;  1K9M C;  2LX9 A;  1QCF A;  4EMK B;  3MEV A;  1RAE B;  4XTU A;  2RJF A;  4N4I A;  3VUZ A;  1AOJ A;  3CCU A;  2JNG A;  5GAN 5;  5D6W A;  3M4Y A;  3QWY A;  1UJY A;  2RN8 A;  4FT4 A;  5GJW B;  3GOX A;  5KYW A;  1BBZ A;  5CIU A;  4M7D B;  1VQ6 T;  2K5F A;  1OV3 A;  1AWJ A;  4R55 A;  2M02 A;  1IO6 A;  2PVG B;  4FYW B;  4JPB W;  2E4H A;  4N4G A;  2A0F B;  3CCU T;  1XQH A;  2PQW A;  5J39 A;  2E3H A;  3QKJ A;  4E7J A;  3OB9 A;  4C5G A;  1JO8 A;  1WHG A;  1Y96 A;  4PLI A;  1I1J A;  1QCN A;  4N4H A;  4KBM B;  5KCO A;  3JAM E;  1GL5 A;  1VQN A;  3ASK A;  3QYH B;  2IVW A;  2M0O A;  4M77 F;  3ME9 A;  4Z88 A;  5HK0 A;  3I55 T;  3L42 A;  1VQL Q;  1OYX A;  1LJO A;  3M0R A;  2MF2 A;  1ZLM A;  4FSS A;  1NPR A;  3SD4 A;  3RBB B;  4M75 G;  3ZFJ A;  1VYV A;  3H41 A;  4LUD A;  2VYT A;  3CCS A;  5GAM j;  4M78 B;  2R58 A;  4OMO A;  4F14 A;  5GAN 6;  1N9S A;  3QUI A;  2NYS A;  5IHN A;  3EFO B;  4IIM A;  1YJ9 T;  2VKN A;  4WCI A;  2JN0 A;  1M9S A;  2RJC A;  2ROL A;  3H9N A;  1UEC A;  1WA7 A;  4JRP A;  3OMC A;  2L3S A;  2CRE A;  2JZ2 A;  2EQI A;  2DJQ A;  3THK A;  2HL3 A;  4N0A C;  1YHQ Q;  3OW2 P;  4BAC A;  2BIV A;  1M2O A;  5DLO A;  3NPF A;  5GAM h;  2HSP A;  2ZPI B;  1T0H A;  1Y7X A;  3CD6 T;  2OAW A;  4HT9 A;  5KH6 A;  1KFZ A;  2P0P A;  1I4K 1;  1ZHI A;  3GLX A;  3RES A;  1AEY A;  3PTA A;  1RAB B;  4QVZ A;  2F69 A;  3QBY A;  1WYX A;  1NZ9 A;  4M78 D;  3CXC P;  1YJN A;  1WQW A;  3MP8 A;  4LDV A;  2LCL A;  1Q7Y R;  4NS5 A;  3QSU A;  1R0B G;  1KG1 A;  2PVD B;  1OI1 A;  3VKI A;  1K8A C;  4F17 A;  2DVE A;  1IRE B;  5IH2 A;  5CAI A;  4PJO F;  1ZUU A;  2X4Y A;  4JJB A;  5GAN 3;  2ZAE A;  1G8X A;  4E7H A;  1V29 B;  4PJJ A;  3QPH A;  1XTD A;  4CC2 A;  4BI3 A;  5GAM e;  2CS7 A;  2NUP B;  1TXQ A;  1K4U S;  3EG9 A;  1V76 A;  2EQK A;  3M0T A;  1YN8 A;  3VS5 A;  2WSE E;  4ATO A;  4WF2 A;  3H0I A;  1RAH B;  2M0Y A;  4C0G A;  4ELY C;  1ABQ A;  3EG1 A;  4F7U F;  3GF5 A;  2RK1 A;  1VQ7 Q;  2R5M A;  3MCA B;  3EG0 A;  2VXE A;  2MWO A;  4XQ3 A;  4M77 D;  1MMD A;  5CQX A;  4XU2 A;  1M1G A;  1X6G A;  5FRO A;  3FJP A;  1D1B A;  1YJ9 Q;  4RTX A;  4IIO A;  1MMG A;  4JUV A;  4J8O A;  3VRY A;  4M4Z A;  4KUI A;  1AZG B;  4MMK A;  3SWN A;  3HPW A;  2K79 A;  1W1F A;  5GAO r;  3EFR A;  4A4H A;  2X4J A;  4E7Z A;  1K1Z A;  1VQ6 Q;  2H3E B;  2O01 E;  2XI9 A;  4O6J A;  2V8K A;  4II1 A;  2HQH A;  4F16 A;  4ESR A;  1BIA A;  3CCU Q;  2FPF A;  1D0Z A;  2KRS A;  1U3O A;  1MUZ A;  4C8Q F;  1PD0 A;  1WHK A;  1TSF A;  2YWW A;  1EX4 A;  1M27 C;  2P0K A;  1YI2 A;  1VQO T;  3V8K A;  2DD4 A;  4QKU A;  1TUG B;  1Q82 R;  5GAO q;  5GMK h;  1M3B A;  4XTV A;  2W0Z A;  1I5L A;  1GXI E;  2QQR A;  5CVI A;  1X2K A;  2F5K A;  2LP5 A;  3QYG B;  4M75 B;  2CP0 A;  4BUG A;  2RI3 A;  4DA4 A;  4LDU A;  1B07 A;  5GAN g;  4R56 A;  2OTL A;  1U1T A;  1UB4 A;  2E5K A;  2RM4 A;  3V8J A;  2LQN A;  2LDM A;  3RKX A;  2E65 A;  5IAY A;  1N9R A;  3M5A A;  2EAY A;  1YIJ T;  1KQS S;  2M9U A;  1YWP A;  1D3B B;  3RER A;  2MWP A;  1G3Y A;  1C6V X;  1GRI A;  2ZPF B;  1VUB A;  1YIJ A;  4MZT A;  1OX9 A;  2KT1 A;  3JCM W;  1YCS B;  4L6V 5;  3CPW S;  4M7D G;  4HVW A;  4FYV B;  1Q81 R;  5AYF A;  1YBY A;  2MOX A;  1Y71 A;  2DX1 A;  2ZZD A;  2NLU A;  3QII A;  2DEQ A;  1Y57 A;  4KUL A;  5LJ5 f;  5HCK A;  8ATC B;  4BE2 A;  1NPP A;  4OGC A;  2BZX A;  4MZM A;  3FEO A;  2AIR B;  2QAS A;  1O75 A;  2F1L A;  4FYY B;  5FLX E;  4J7I A;  2EW3 A;  1GFD A;  2XIC A;  2CSQ A;  1JRI A;  2SRC A;  3OSS C;  3VJP A;  1I07 A;  1N6A A;  2VWF A;  2DA9 A;  3CC2 Q;  2L0A A;  1RAC B;  1UUE A;  1TH7 A;  1NEG A;  1VQ5 T;  4QQ6 A;  3M9Q A;  4RTW A;  3OQ5 A;  2E1H A;  1M2V A;  4QVC A;  4JS5 A;  1YJW A;  4AFQ C;  3M56 A;  1NEB A;  3JCM X;  2VAS A;  1F1B B;  3DB3 A;  1MV0 B;  4V2S A;  3EGX A;  3JB9 G;  2JVV A;  5GMK e;  3CCS Q;  1T3S A;  1IHW A;  3JCM f;  2MPX C;  5FU7 C;  3OYC A;  2DXU A;  3CC7 T;  1YIT T;  2Z0W A;  3G4S T;  3OYY A;  4PKC C;  3RMQ A;  1KK7 A;  1QWF A;  4DEX A;  3A8G B;  1NJI C;  3NTI A;  1PKS A;  1N8R C;  1AD5 A;  1RI9 A;  1YHQ A;  2ENM A;  2DRK A;  3M0S A;  3JRZ A;  4XU3 A;  4M78 E;  4JDS A;  2HQX A;  1UGQ B;  3L2Q A;  1H64 1;  2CP6 A;  2LX7 A;  3CCQ T;  3MKD A;  1RLP C;  1GBR A;  3CCE A;  1VQM Q;  4RTV A;  5GAN 4;  4OMQ A;  3G6E T;  4QQG A;  5KYN A;  3MEU A;  5GAO m;  5CKH A;  4M78 A;  3D7S B;  5CQY A;  1PG5 B;  5KYU A;  3CPF A;  2OTJ A;  1NYG A;  3T9N A;  4PJL A;  4CI0 C;  2VGN A;  3TRE A;  3S6W A;  3JB9 F;  3UA6 A;  1XOV A;  4J9H A;  3M0Q A;  1JJ2 P;  3OYH A;  1R0C B;  1ZUK A;  4WTO B;  2RQW A;  1YJN T;  1VQ5 Q;  2X35 A;  3M55 A;  3OYK A;  3JCM b;  2AZS A;  4JJN K;  3FDR A;  1KQS P;  5GAN 8;  4XK8 E;  2PZ1 A;  4X34 A;  2COZ A;  1ZSZ C;  2AKL A;  3LWH A;  1IRX A;  2E6Z A;  3CC4 Q;  3U23 A;  3CCS T;  1RAF B;  3CCE Q;  2EJ9 A;  5LJ5 d;  5KYY B;  4OVA A;  1ZBJ A;  2AT1 B;  4Y92 A;  3PFS A;  4JRI A;  2YRC A;  5CKD A;  4A63 B;  3PIP A;  3MPU B;  2OI3 A;  4FYX B;  3QG1 A;  1LCK A;  1PRM C;  5KYW B;  3I9Q A;  3H0F A;  4JS4 A;  3OYF A;  4ZNX A;  4HCB A;  2YRD A;  2QDL A;  1JEG A;  5CK9 A;  2DL4 A;  1Z9Q A;  4QT7 A;  2ZCF B;  2A36 A;  1FXX A;  5KE3 A;  5IT9 E;  4JZ3 A;  1QKW A;  4X9C A;  4EMK A;  2YXY A;  3DLL A;  4J7F A;  2X4X A;  2OAU A;  4PJM A;  2HBP A;  4NL3 A;  1D09 B;  2BZ8 A;  1BCO A;  2E41 A;  1G3W A;  5GAN 7;  3CMA A;  1KC8 R;  3JB9 H;  1VYT A;  3N5B B;  3CC2 T;  1M30 A;  3GNF B;  4XTX A;  2JS2 A;  1D0Y A;  4C8Q C;  1HXD A;  3EFS A;  3RUX A;  1E6H A;  4TVR A;  2BE7 D;  2HKQ B;  4M78 C;  3EH2 A;  2YRV A;  1E6G A;  1QP2 A;  2HBW A;  2DVJ A;  3O5Z A;  3L2U A;  1KC8 C;  5L23 A;  3VS4 A;  4ZGE B;  2Y4Y A;  4FCY A;  1ARK A;  2D0Q B;  1QW1 A;  1GBQ A;  2QA4 Q;  3C95 A;  4OB0 B;  3CC2 A;  1VQP Q;  1X2Q A;  2DIL A;  2J6K A;  3CMA T;  1BB9 A;  3VRZ A;  2H8H A;  2A3L A;  2EQU A;  5CR2 A;  4RG2 A;  3CCQ A;  1WIE A;  3CC7 Q;  4M78 G;  2CP3 A;  4VUB A;  2RJE A;  2CKK A;  3UA7 A;  1M90 R;  2KYM A;  4DEY A;  2X3W D;  5C0M A;  2EJF A;  1XJW B;  2JM9 A;  2P4T A;  4Y91 A;  3EAE A;  5CKF A;  2CSI A;  1B34 A;  4A4F A;  2RHY A;  2QQA A;  2LJ1 A;  2LRQ A;  3FB9 A;  1YIT A;  2MYS A;  1AWX A;  1W2B S;  2RI2 A;  1ZQ1 A;  3SB2 A;  4B6M A;  4OF1 A;  3X28 B;  1X69 A;  2WSF E;  2F5T X;  2KE9 A;  3PIO A;  4B9X A;  1N5Z A;  1D0X A;  1Q95 G;  4NOY A;  4AFZ C;  2DF6 A;  1H3Z A;  1YJW T;  2ESW A;  2K9G A;  1T3L A;  2PVO B;  2ED0 A;  2E12 A;  3M4G A;  3REA B;  2LTO A;  2XDD A;  1NG2 A;  4KGV B;  5I21 A;  2DYI A;  1M3C A;  4LUE A;  3CCL A;  1AVZ C;  1PCX A;  2JMA A;  2KXC A;  3BY7 A;  3RIR A;  2FPE A;  4C8Q G;  4LXC A;  3JCM c;  2OTL Q;  3UT1 A;  1BCM A;  1U1S A;  1YI2 Q;  4DOW A;  4HCC A;  2E64 A;  2NWM A;  3CPW P;  5FRM A;  1EFN A;  4JLI A;  2JJ9 A;  1BI3 A;  4GLM A;  4ELZ C;  1VQK T;  1WPY A;  1AWO A;  3LW5 E;  3J81 E;  2NUT B;  3OMG A;  2V26 A;  1OEB A;  2JUF A;  1C1A A;  3MP1 A;  1VQP T;  1M1F A;  2IIM A;  1K9A A;  2DXT A;  1U8R A;  4BI4 A;  2DIG A;  3VYG A;  1VQ9 A;  2XID A;  3R6O A;  1KIK A;  3PNW C;  2EYW A;  5GAO p;  2DJZ A;  2JXB A;  3OYE A;  4JJD A;  1RI0 A;  3S3M A;  3ULR B;  1VQ4 T;  3CCJ A;  2K5I A;  5IXF A;  2EGC A;  4OB1 B;  1N8R R;  5I11 A;  2LMJ A;  2LQK A;  1NJI R;  4BDZ A;  4RCB A;  4K11 A;  2PNI A;  3OY9 A;  3P8B B;  5LJ3 h;  2WSC E;  4FSX A;  3JCM J;  1W4S A;  1NE8 A;  2DD5 A;  2G3R A;  2HKN A;  4PL6 A;  1XNI A;  2C0O A;  1C0M A;  1QWE A;  3SWN B;  2DL3 A;  3OYA A;  3PMI A;  2RI5 A;  3PE0 A;  4BDY A;  2CT4 A;  2DTI A;  3LYI A;  2YSQ A;  3TQ7 P;  1NLO C;  3V8L A;  1K9M U;  4A4G A;  1OZ2 A;  1YI2 T;  1OZ3 A;  3HRT A;  1SPK A;  4N0A A;  1MV3 A;  3J80 E;  1VQ5 A;  3G7Z A;  2AHJ B;  4C92 B;  2KRN A;  1N8R U;  2L89 A;  1GCQ C;  3JB9 J;  3X26 B;  1YFN A;  1S1N A;  4C92 C;  2KVQ G;  2XU8 A;  4RTT A;  4PFO A;  4PLL A;  3EHQ A;  4E2F B;  2A08 A;  1QVG S;  3HHT B;  3VUB A;  2NUT A;  2XG8 D;  2D9T A;  2R57 A;  3JB9 D;  1Q81 C;  4P5N A;  2V8J A;  1K0X A;  1WDX A;  1Z9Z A;  4C0F A;  1M8M A;  4C8Q A;  5D6Y A;  3CCV Q;  2Y4X A;  2RHZ A;  2GCX A;  2GFA A;  3CEY A;  1IXD A;  2KAF A;  1Q86 U;  3CCV A;  2J6O A;  2NUP A;  5LJ3 j;  3HFN A;  4KH1 B;  4BY6 C;  3I5S A;  5A0L A;  4M75 F;  4E7K A;  3OYB A;  3OW2 S;  1QQJ A;  3NTH A;  5C6S A;  3RMS A;  3QO3 A;  4E7I A;  4IUQ A;  3JCM g;  1WQ7 A;  2O2O A;  3S3O A;  2HMA A;  3E1S A;  2MI6 A;  1PM3 A;  2HD0 A;  1TU0 B;  1PSE A;  1VQ4 A;  3NTK A;  2GNC A;  2LT4 A;  2V1R A;  3EG9 B;  3CXC S;  2QDY B;  3EG2 A;  2M16 A;  2OTL T;  3V7S A;  2CP7 A;  4KRT A;  4J9I A;  1BYM A;  3VS2 A;  1HYO A;  1QVP A;  2XDP A;  2DAQ A;  3M0U A;  5LJ5 g;  1M3A A;  1VQK Q;  2F2X A;  3CCJ T;  4AT1 B;  4AG2 C;  4RCC A;  5DY9 A;  4XAX B;  2BTT A;  1VQK A;  2RQU A;  2DXC A;  3TVT A;  4OMM A;  1E7O A;  2B86 A;  1ZA2 B;  3X24 B;  3GP8 A;  3X20 B;  2G6F X;  2FEI A;  4L59 A;  2E70 A;  3UAT A;  4EMK C;  4PJN A;  1YP5 A;  4D8K A;  1PRL C;  2DIQ A;  2HEQ A;  4LNP A;  3OYN A;  2QTV A;  3JCM h;  1WZO A;  2ECZ A;  3TCJ A;  1BI2 A;  1YCY A;  2CYZ B;  1S72 A;  2QEX A;  1VQ4 Q;  3S3N A;  1QVG A;  1KHI A;  1QVG P;  3LH5 A;  2RHX A;  1AWW A;  1I8F A;  2MK5 A;  5GAM g;  4XU1 A;  2KBT A;  3BDU A;  1PD1 A;  3VS1 A;  2GQI A;  2LZ6 B;  1O9S A;  1X6B A;  2KK4 A;  2MCN A;  4C5I A;  4IUP A;  1NLP C;  3EFO A;  5GMK m;  3OYG A;  2O4X A;  3OYJ A;  4L5G A;  1M1K R;  2KI7 A;  3BFM A;  2VC8 A;  4MZP A;  3PT9 A;  3A8M B;  4CC7 A;  1VQ8 T;  3MEW A;  5FWB A;  3CCL Q;  1KD1 C;  1G3S A;  5IXB A;  2L3Q A;  4Z8A A;  2KRO A;  2QK0 A;  1HJD A;  4M75 D;  2EYQ A;  2DTO A;  2EYZ A;  4M7A D;  3MET A;  2KYB A;  2M51 A;  1VQN T;  4CC4 B;  3RR6 A;  4HCK A;  4A54 A;  4OB2 B;  3MO8 A;  1BI0 A;  1OUL A;  3VS3 A;  1WXB A;  1D3B A;  2BUD A;  2BZY A;  1J3T A;  3HP9 A;  1KSW A;  2YUP A;  3OS2 A;  2X3X D;  2EKO A;  5GAO l;  1Q81 U;  1V1C A;  1IB8 A;  4PFZ A;  2GGR A;  2QGF B;  2XK0 A;  3TSW A;  4LDW A;  4LE9 A;  2P4R A;  4RG8 A;  3I56 T;  4M78 F;  1Q7Y U;  3FC3 A;  1AZE A;  3L2R A;  4RKU E;  2K2M A;  2K7A A;  2D8J A;  3CD6 A;  4JRK A;  3OSV A;  4OMP A;  3DKM A;  3QZ5 B;  2QQ9 A;  1VA7 A;  2KDS A;  4IUT A;  1MGQ A;  1YIT Q;  2RHU A;  2IPO B;  4LD6 A;  2OTJ Q;  4LN2 A;  1ZX6 A;  4D8D A;  2GTJ A;  4BD3 A;  1TUC A;  5A0G A;  1TTH B;  4C8Q B;  2ATC B;  1WXU A;  2EPD A;  3M54 A;  2LQ8 A;  1VQ8 A;  4AMC A;  2DER A;  1UGV A;  4J9G A;  1UFF A;  3QJY A;  1KD1 R;  1X27 A;  2YLB A;  2EVR A;  5DLQ E;  1X6O A;  4AFS C;  2F2W A;  3F70 A;  3OYM A;  4GBQ A;  1GCQ A;  1RL2 A;  1VQM A;  3QXE B;  3SEM A;  1M1K C;  1WHH A;  1W2B A;  5GAO n;  1VOM A;  1KHC A;  2X4W A;  4HVV A;  1KJW A;  4PNO A;  5DM7 R;  4DBH A;  4KT0 E;  1ZUY A;  2AZV A;  1YNZ A;  3VS7 A;  3LLR A;  2DZC A;  3OBW A;  4F7U B;  2V8I A;  1BK2 A;  2RK2 A;  1VQ9 Q;  3CPW A;  4RTY A;  4M77 E; 
#chains in the Genus database with same CATH homology
 4QVZ A;  2F69 A;  2P0Q A;  3BW1 A;  3QBY A;  3CC7 A;  1YIT A;  2QQS A;  1NZ9 A;  4M78 D;  2DTH A;  4DQ2 A;  1YJN A;  1WQW A;  4EMH A;  1W2B S;  1VQ7 T;  3MP8 A;  3OBY A;  3GNG A;  4LDV A;  2LCL A;  3UDC A;  2RI2 A;  1ZQ1 A;  3RKW A;  3SB2 A;  5GAN f;  2EJG A;  2ZGW A;  4NS5 A;  4OF1 A;  1JJ2 A;  1N27 A;  3X28 B;  3QSU A;  3ZEH A;  2PVD B;  1KG1 A;  1OI1 A;  2WSF E;  2F5T X;  3VKI A;  1K8A C;  3CCE T;  1KQ1 A;  3M59 A;  3PIO A;  2DVE A;  1IRE B;  4B9X A;  4NOY A;  4EPC A;  4PJO F;  5CAI A;  5GMK l;  1H3Z A;  1YJW T;  2X4Y A;  5GAN 3;  3M4G A;  2OTJ T;  2PVO B;  2E12 A;  2LTO A;  4E7H A;  2XDD A;  1S72 T;  4X9D A;  4E47 A;  5I21 A;  1V29 B;  4JRQ A;  2RJD A;  1YHQ T;  1KQS A;  3QPH A;  5GAN j;  3X25 B;  1XTD A;  5A0D A;  3CCL A;  5GAN d;  3RIR A;  4BI3 A;  3OA6 A;  3BY7 A;  5GAM e;  3CCR T;  2CS7 A;  3HRS A;  4C8Q G;  4M77 A;  5LJ5 j;  3JCM c;  3WVD B;  3UT1 A;  3OYL A;  1U1S A;  2DK3 A;  2EQK A;  2CZ7 B;  2YLC A;  2K5L A;  1LNX A;  2WSE E;  3M58 A;  4C92 A;  4DOW A;  4HCC A;  4ATO A;  4WF2 A;  2E64 A;  4C0G A;  3HRU A;  5FRM A;  4JLI A;  4D6W A;  3H6Z A;  4ELY C;  4F7U F;  2EIF A;  3GF5 A;  2RK1 A;  4J6X A;  1BI3 A;  4ELZ C;  3CXC A;  2CZ1 B;  2VV5 A;  1WNL A;  4FIB A;  5LJ3 d;  4C92 D;  1VQK T;  2R5M A;  2KQW A;  3MCA B;  3INZ A;  1Q86 C;  4XQ3 A;  2VXE A;  2MWO A;  1WPY A;  2KY9 A;  4M77 D;  3LW5 E;  3QZ9 B;  5CQX A;  5HKC A;  3J81 E;  4XU2 A;  1VQ9 A;  1M1G A;  3OMG A;  3VYH B;  3WVE B;  2JUF A;  5FRO A;  3FJP A;  3MP1 A;  3URG A;  1VQP T;  1M1F A;  2HQE A;  1DJ7 B;  4HT8 A;  1VIF A;  4JUV A;  2DXT A;  1U8R A;  4C0D B;  4J8O A;  2FYK A;  1K73 C;  2CZ0 B;  4BI4 A;  4KUI A;  2DIG A;  2XKO C;  3VYG A;  2XID A;  2K3Y A;  3R6O A;  3PNW C;  4MMK A;  4C5E A;  5KCH A;  3SWN A;  3HPW A;  5GAO p;  3CC4 A;  2DJZ A;  4C92 G;  3OYE A;  2H3J A;  4BE0 A;  5GAO r;  3EFR A;  3G71 A;  4A4H A;  3HFO A;  1RI0 A;  2X4J A;  4GY5 A;  3S3M A;  3KUF A;  1VQ4 T;  3CCJ A;  5I2M A;  2EWN A;  2K5I A;  3A8L B;  2O01 E;  2XI9 A;  4MML A;  4O6J A;  4OB1 B;  4HCZ A;  1I81 A;  4LD9 K;  2PU9 B;  2V8K A;  2VUB A;  4GLK A;  4II1 A;  2LQK A;  3L2Z A;  2RD1 A;  1BIA A;  4RCB A;  4BDZ A;  4XU0 A;  3OY9 A;  3P8B B;  3JCM d;  4M7A C;  5LJ3 h;  2WSC E;  2QEX T;  2QA4 T;  4FSX A;  3JCM J;  2DKG A;  3JSC A;  1JBM A;  4CRI A;  1W4S A;  1NE8 A;  2DD5 A;  3OS0 A;  2G3R A;  5J3B A;  3FRN A;  4C8Q F;  2EQJ A;  2JOY A;  4PL6 A;  4C8Q E;  1QVF A;  4HT9 A;  2PUO B;  1XNI A;  3UPU A;  4B9W A;  3CME T;  2E5Q A;  1JB0 E;  2P0K A;  1VQL A;  3MEA A;  3SWN B;  3OYA A;  5LJ3 f;  3PMI A;  3FLG A;  1YI2 A;  1VQO T;  4ZTF A;  2RI5 A;  4A4E A;  4M7A G;  3V8K A;  1X01 A;  4C8Q D;  4LDX A;  4MDX A;  4BDY A;  2DD4 A;  5GAO q;  2DTI A;  5GMK h;  2DPP B;  3A5Z B;  4FT2 A;  4XTV A;  3LYI A;  2LT1 A;  4M7A E;  1I5L A;  1GXI E;  2QQR A;  5CVI A;  2F5K A;  4IUV A;  3PGG A;  3OS5 A;  3V8L A;  5LJ5 e;  1K9M U;  2BKD N;  3MHX A;  3QDR B;  3QYG B;  4M75 B;  2QTX A;  2RI3 A;  4A4G A;  4BUG A;  1OZ2 A;  4DA4 A;  3VU3 C;  3CCV T;  3TU4 K;  3FIF A;  4LDU A;  1OZ3 A;  2LCC A;  4F7U B;  1YI2 T;  3LWI A;  5HY6 A;  2MMP A;  3HRT A;  2O4X B;  2QXF A;  5GAN g;  2L5Q A;  4N0A A;  2PUK B;  4R56 A;  3CCM A;  1Q82 C;  4DOV A;  3LX7 A;  2OTL A;  3J80 E;  1UB4 A;  1U1T A;  3G7Z A;  4C92 F;  1VQ5 A;  2AHJ B;  4M7D F;  2RM4 A;  2WAC A;  2B8A A;  4C92 B;  1N8R U;  3V8J A;  2LDM A;  3RKX A;  2E65 A;  5IAY A;  2L89 A;  1K8A U;  1N9R A;  1AHJ B;  3M5A A;  3M57 A;  2EAY A;  3JB9 J;  1YIJ T;  3X26 B;  3QJ6 A;  1KQS S;  4C92 C;  2QA4 A;  3LGF A;  2M9U A;  2KVQ G;  1EIF A;  2XU8 A;  5LJ3 e;  1R8O B;  4KUD K;  4PLL A;  2C06 A;  3AHU A;  1D3B B;  1FX7 A;  3RER A;  2ZPH B;  2ZPB B;  2K3X A;  2MWP A;  5CCA A;  3HHT B;  1WJQ A;  1G3Y A;  3VUB A;  2XG8 D;  5I2S A;  2D9T A;  1QVG S;  1VIE A;  2ZPF B;  5FU6 C;  2R57 A;  3ER0 A;  3JB9 D;  1Q82 U;  1WJS A;  1VUB A;  5J26 A;  4P5N A;  1WGS A;  1YIJ A;  1Q81 C;  4MZT A;  2V8J A;  1LOJ A;  3J7A F;  2JTF A;  4IKF A;  4A4K A;  4C0F A;  3G71 T;  3E9G A;  4M7D C;  4ZN3 A;  2HAX A;  3QHS A;  4C8Q A;  2M1H A;  4BI8 B;  1BKB A;  4J83 A;  4RMO A;  5D6Y A;  3JCM W;  3NFC A;  3P8H A;  3JCM Q;  1KC8 U;  2Y4X A;  1VQ9 T;  4L6V 5;  2RHZ A;  2GCX A;  3CPW S;  4M7D G;  2GQV A;  2GFA A;  5AYF A;  4ZGD B;  3CEY A;  2E6N A;  1YBY A;  2RA2 A;  4UC4 A;  3V7R A;  3JB9 I;  2KAF A;  1Y71 A;  4YTL A;  1Q86 U;  2ZZD A;  2NLU A;  4M77 B;  3CCV A;  3QII A;  5CKE A;  5LJ3 j;  2DEQ A;  3HFN A;  3SWN C;  2RB6 A;  4M7D E;  1Y96 B;  4KUL A;  4BY6 C;  5LJ5 f;  5A0L A;  3KXT A;  1M1K U;  4BE2 A;  1NPP A;  1UGP B;  4M75 F;  4OGC A;  2CZ6 B;  4MZM A;  4OGE A;  5M9O A;  3OYB A;  3OW2 S;  4E7K A;  1WJR A;  2IG0 A;  3FEO A;  3NTH A;  2CGH A;  4M75 E;  5C6S A;  1KD1 U;  3RMS A;  3QO3 A;  4E7I A;  4IUR A;  1O75 A;  4IUQ A;  3C12 A;  3JCM g;  1WQ7 A;  5FLX E;  3S3O A;  2Y90 A;  3E1S A;  4J7I A;  4C5H A;  1FWZ A;  2MI6 A;  2XIC A;  2HD0 A;  1PSE A;  5GMK j;  4M75 C;  1JRI A;  3OSS C;  1VQ4 A;  3VJP A;  1VQL T;  1N6A A;  3NTK A;  3CME A;  2LT4 A;  2EQM A;  2VGM A;  5GAM f;  5A2Q E;  3CXC S;  4M7D A;  1PSF A;  2I2L A;  2QDY B;  1TH7 A;  2M16 A;  4O5V A;  5KE2 A;  2FL7 A;  1VQ5 T;  3TEE A;  4QQ6 A;  3M9Q A;  3V7S A;  4C0Z A;  2OTL T;  4M7A F;  2L3R A;  3CBO A;  3OQ5 A;  3CCM T;  2E1H A;  1BYM A;  4QVC A;  2RO0 A;  4JS5 A;  4BE1 A;  1YJW A;  3M56 A;  3LGL A;  2LNV A;  1QVP A;  3JCM X;  1UGS B;  2DAQ A;  2XDP A;  2ZPE B;  5LJ5 g;  1VQP A;  3MP6 A;  5L8R E;  4PJO A;  3DB3 A;  3CCJ T;  4V2S A;  5GAN h;  2E10 A;  2FB7 A;  4RCC A;  3JB9 G;  2JVV A;  5DY9 A;  5GMK e;  3SFM A;  3G4S A;  4XAX B;  5GAN e;  4E7L A;  4BB7 A;  2XHC A;  3JCM f;  1VQK A;  4JLG A;  4QW2 A;  4J6Y A;  2DXC A;  3A8H B;  3OS1 A;  1QVF S;  5FU7 C;  3OYC A;  2DXU A;  1VQO A;  3CC7 T;  1YIT T;  3X24 B;  3G4S T;  2HNI A;  3OYY A;  4PKC C;  3GP8 A;  3PTA A;  1KQ2 A;  3X20 B;  1Q7Y C;  3H8Z A;  5FU7 B;  3RMQ A;  3A8G B;  4Y28 E;  3HL8 A;  2E70 A;  4L59 A;  4QVD A;  4EMK C;  4F7U A;  1NJI C;  3A8O B;  3NTI A;  2DIQ A;  5FU6 B;  3OYN A;  1N8R C;  3CCL T;  4M77 C;  3M53 A;  3JCM h;  4FM4 B;  3TCJ A;  1BI2 A;  1YCY A;  5CKB A;  1YHQ A;  2CYZ B;  1S72 A;  2QEX A;  4PJO B;  3DLM A;  2FVU A;  3JRZ A;  3S3N A;  4XU3 A;  4M78 E;  4PJO G;  1QVG A;  1M8V A;  1KHI A;  1MHN A;  2KMT A;  2RHX A;  4JDS A;  2HQX A;  1I8F A;  1UGQ B;  4M7A B;  4EDU A;  3L2Q A;  1H64 1;  5GAM g;  3ZBD A;  4XU1 A;  3BDU A;  3OYI A;  3CCQ T;  4ZGJ B;  4PJO C;  2VXF A;  2K57 A;  3CCE A;  5GAM d;  1O9S A;  1JJ2 S;  1G3T A;  3V7C A;  1M90 C;  2XD0 A;  5GMK i;  4BY6 B;  2KK4 A;  1M5Q 1;  5GAN 4;  4C5I A;  3L2W A;  4IUP A;  3G6E T;  4QQG A;  4ME7 A;  3DB4 A;  2RH2 A;  2A7Y A;  5GMK m;  3MEU A;  3CC4 T;  1IZ6 A;  5GAO m;  2O4X A;  3OYG A;  3OYJ A;  5CKH A;  5FRN A;  4M78 A;  4L5G A;  4ZN1 A;  2LC4 A;  5CQY A;  2L8D A;  4F7U G;  5D6X A;  1G5V A;  3CPF A;  2OTJ A;  2FHD A;  2VC8 A;  3BFM A;  4QQD A;  3T9N A;  4CI0 C;  2VGN A;  4MZP A;  3PT9 A;  3A8M B;  4Q5W A;  3S6W A;  3TRE A;  1VQ8 T;  1NJI U;  3JB9 F;  3MEW A;  1XOV A;  4M7D D;  1KD1 C;  1X75 C;  1G3S A;  2YHT A;  4C92 E;  3L2V A;  3CBM A;  4MDW A;  3OYH A;  5GAN 2;  4PJO D;  4FL6 A;  3I55 A;  4J6W A;  1YJN T;  5CO7 A;  4M75 D;  1VQ7 A;  3E19 A;  2EYQ A;  2DTO A;  2X35 A;  4M7A D;  3M55 A;  3OYK A;  3MET A;  2ZPG B;  2XDB A;  3JCM b;  1VQN T;  4JJN K;  1VQM T;  3FDR A;  1K73 U;  1M90 U;  4A54 A;  3SDZ A;  5GAN 8;  4XK8 E;  4X34 A;  4OB2 B;  3LWH A;  3MO8 A;  2QI2 A;  5IN1 A;  1BI0 A;  3CCR A;  2E6Z A;  2LVM A;  1K9M C;  2LX9 A;  4EMK B;  3MEV A;  3CCS T;  4XTU A;  2RJF A;  4N4I A;  2EJ9 A;  3VUZ A;  1D3B A;  2BUD A;  5LJ5 d;  3OYD A;  4J5Y A;  4OVA A;  3CCU A;  2JNG A;  3HP9 A;  5GAN 5;  5D6W A;  3PFS A;  3C4S A;  4C0D C;  2DO3 A;  2JTM A;  3M4Y A;  4FT4 A;  4JRI A;  5LJ5 h;  5CKD A;  3GOX A;  2K4Y A;  3OS2 A;  1BIB A;  5CIU A;  3PIP A;  4M7D B;  2EKO A;  5GAO l;  1Q81 U;  3QG1 A;  4EMG A;  1YJ9 A;  2K5F A;  1VQ6 T;  4R55 A;  2PVG B;  4JS4 A;  2XK0 A;  3OYF A;  4HCB A;  4LDW A;  2D6F A;  5CK9 A;  3Q1J A;  4N4G A;  4RG8 A;  2MAM A;  4M78 F;  3I56 T;  3CCU T;  1Q7Y U;  2ZCF B;  1XQH A;  2PQW A;  5J39 A;  3L2R A;  3FC3 A;  4ZTJ A;  4RKU E;  1FXX A;  5KE3 A;  3KBG A;  5IT9 E;  3HSB A;  4X9C A;  1P92 A;  3QKJ A;  4EMK A;  3CD6 A;  4E7J A;  3OB9 A;  4JRK A;  3OSV A;  4C5G A;  3DKM A;  3QZ5 B;  2QQ9 A;  1Y96 A;  2KDS A;  3DLL A;  1SSF A;  1MGQ A;  1UEB A;  4IUT A;  4J7F A;  4N4H A;  4PLI A;  4XTY A;  2RHU A;  2X4X A;  4KBM B;  4LD6 A;  3RKY A;  5KCO A;  3JAM E;  1VQN A;  2OAU A;  3ASK A;  3QYH B;  3I56 A;  2IVW A;  2M0O A;  4XTW A;  4M77 F;  3ME9 A;  2HBP A;  4NL3 A;  4BD3 A;  5HK0 A;  2E41 A;  1G3W A;  3BDL A;  5A0G A;  5GAN 7;  3I55 T;  2GFU A;  3L42 A;  4C8Q B;  3CMA A;  3JB9 H;  1OYX A;  1VQ6 A;  1LJO A;  3C94 A;  2MF2 A;  2RHI A;  3N5B B;  3JCM P;  3M54 A;  3CC2 T;  4OB3 B;  1M4Z A;  1NPR A;  3GNF B;  4XTX A;  3SD4 A;  3GPL A;  4M75 G;  3ZFJ A;  2EFI A;  2LQ8 A;  1VQ8 A;  4C8Q C;  1HXD A;  3EFS A;  3RUX A;  2DZ9 A;  2GF7 A;  1UGR B;  3E9F A;  4TVR A;  1ZBX A;  4M78 C;  4F7U E;  2YRV A;  4HA8 A;  1QP3 A;  1QP2 A;  2VYT A;  3QJY A;  2DXB A;  3L2U A;  1KC8 C;  4Z02 A;  3CCS A;  5GAM j;  2YLB A;  3UWN A;  4XTZ A;  5DLQ E;  1X6O A;  4ZGE B;  2K2V A;  2Y4Y A;  4M78 B;  4LDY A;  2D0Q B;  1QW1 A;  2R58 A;  3L1A A;  5GAN 6;  1N9S A;  3F70 A;  3QUI A;  3OYM A;  3G6E A;  3C95 A;  4OB0 B;  1YJ9 T;  3CC2 A;  1RL2 A;  3P8D A;  2JN0 A;  1VQM A;  5HK3 A;  1M9S A;  3QXE B;  1M1K C;  3CMA T;  2RJC A;  1HK9 A;  2A3L A;  2EQU A;  3O8V A;  4FU6 A;  4RG2 A;  5CR2 A;  1W2B A;  3CCQ A;  5GAO n;  1B34 B;  1KHC A;  4M78 G;  4PJO E;  4VUB A;  5LL6 S;  4JRP A;  3LH0 A;  2X4W A;  3OMC A;  4M7A A;  2JZ2 A;  1Y07 A;  3HKS A;  3PMT A;  2RJE A;  2CKK A;  5EG2 A;  3JCM V;  4M75 A;  4A53 A;  2KSS A;  4N0A C;  4PNO A;  5DM7 R;  5C0M A;  5LJ3 g;  4BAC A;  3OW2 A;  2EJF A;  1BI1 A;  4KT0 E;  3VV0 A;  2BIV A;  5DLO A;  3CBP A;  3JCM e;  2P4T A;  5GAM h;  2ZPI B;  2QQB A;  1Y7X A;  3EAE A;  4OP0 A;  4Y91 A;  3GIB A;  3CD6 T;  3LLR A;  4NL2 A;  2DZC A;  3OBW A;  5CKF A;  2V8I A;  4HKE A;  4OMF B;  2RK2 A;  2P0P A;  1I4K 1;  2R5A A;  4IUU A;  1ZHI A;  5KH6 A;  1B34 A;  3GLX A;  4A4F A;  2RHY A;  3RES A;  2QQA A;  4M77 G;  3CPW A;  3WXM B;  2LRQ A;  3FB9 A;  4M77 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...