1VWEB

Streptavidin-cyclo-ac-[chpqfc]-nh2, ph 3.6
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
121
structure length
121
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Complex (biotin-binding protein/peptide)
total genus 26
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 1997-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vweB00
1VWCB 4BBOA 4GDAA 1VWOB 1VWNB 1Y53X 2RTHB 2UYWA 1NQNA 1SWAA 1SWFA 3RDMA 3T2XA 1LCVA 2AVIA 1VWGB 1Y52X 3FDCA 1VWAB 2OF9A 4EKVA 1HQQA 4YVBA 1LCWA 1STPA 5K68A 5K67A 3T6FA 1VWQB 3SZHA 4GD9A 1NDJA 1SWTA 2RTGB 2RTAA 1SRFA 1SWOA 4JNJA 2IZDB 1MM9A 2IZKA 3VGWA 1SWPA 1KL5A 3SZIA 4BX6B 1N9MA 1VWEB 2RTLA 1HXLA 1RSUB 4I60A 4GGZA 4U46A 3WZOA 3X00A 1VWIB 4JO6A 4Y59A 1I9HA 2RTIB 2A8GA 1NBXA 2Y32A 2IZJA 2IZAA 5B5FA 1SWNA 4Z2OA 1SLGB 1RXKA 1LELA 3RY1A 2FHNX 1AVEA 1STRB 2RTMA 4IRWA 2OFBA 5CSEA 3WZPA 3RY2A 3RDSA 4CPHA 5IRWA 1AVDA 1MEPA 2C1QA 1MOYA 1PTSA 2RTCB 3EW2A 4GGTA 1N43A 4BCSA 2IZHB 2QCBA 2IZCB 4Z27A 2IZGB 2C4IA 4GJVA 1N9YA 2IZFB 4Y5DA 3SZJA 1STSB 1VWLB 3WZNA 1RSTB 4GJSA 2Y3FA 1SWRA 1VWKB 5CHKA 2RTQB 1KFFA 1IJ8A 2RTOB 3WZQA 3RDQA 1RXHA 1VWFB 2OF8A 1SWEA 3EW1A 2G5LA 4JHQA 1VWHB 4GGRA 3MM0A 3RDUA 1LCZA 2C1SA 4BX5A 5F2BA 1RXJA 4CPEA 1SWKA 1VWPB 2OFAA 2FHLA 2WPUA 1LDOA 1DF8A 2RTRB 3VHMA 4BX7A 4Z2PA 1HXZA 1SWDA 2RTDB 3VHHA 3WYPA 4BJ8A 2IZLB 2RTJA 1SLEB 2CAMA 2RTEB 4Z2VA 1SWLA 1VWDB 2BC3A 2GH7A 1KL4A 4OKAA 3RE6A 3T6LA 5L3YA 1N7YA 1N4JA 1KL3A 3MG5A 1SWSA 1SLDB 3T2WA 1SRGA 4Z28A 1SWGA 2F01A 3PK2A 4Z6JA 1WBIA 3RE5A 2IZBA 1SWBA 2A5CA 1Y55X 1MK5A 2MF6A 1VWJB 1SWUA 1LDQA 1VWMB 1SRJA 2ZSCA 5B5GA 4BX5B 3VHIA 2IZIA 4CPFA 4CPHB 4BX7B 4DNEA 1SREA 2UZ2A 1SWJA 5IRAA 3WYQA 1SRIA 1VYOA 1SWHA 2RTKA 3RDOA 1SWCA 1SLFB 4CPIA 1VWRB 1LUQA 2Y3EA 2RTNB 1VWBB 2IZEB 1RAVA 5IRUA 1NQMA 2JGSA 2A5BA 4BX6A 1SRHA 2RTFB 1SWQA 5JD2A 2RTBB 1NC9A 1HY2A 2RTPB 3RDXA
chains in the Genus database with same CATH superfamily
2OY1O 3KFGA 1VWCB 4YDBA 1ADLA 1KOIA 1R0UA 4BBOA 1MVGA 5HZ8A 3TGBA 3O19A 5HA0A 2JW1A 2JU3A 2RTHB 3CWKA 3T2XA 1SWAA 1SWFA 2DJFA 4CK4A 2G7BA 1LCVA 1OPBA 1HMTA 4MVIA 5KICA 4EKVA 1T0VA 4ID2A 3HWFA 4ZHHA 3T6FA 5K67A 1CBSA 2JU7A 4KIIA 3ELXA 1NDJA 1HMSA 2F09A 1ERXA 2KTSA 2VDFA 4LZUA 1SRFA 4JNJA 2IZDB 1MM9A 3VGWA 3FELA 3VG7A 1KL5A 4RUNA 3S5XA 2AT3X 5F6BA 1K24A 4ALBA 3EC5A 5IO7A 4I60A 1GM6A 3G7XA 1RSUB 3FR2A 1UYNX 3JQOA 4GGZA 3WZOA 3X00A 1EIOA 4JO6A 3P6DA 4Y59A 5L8IA 2RTIB 2FS7A 2IZAA 4Z2OA 1JYDA 2JU8A 3DSZA 5HCEC 1LELA 3CQRA 3RY1A 2RCTA 1AVEA 2NNDA 2RTMA 2WUTA 2OFBA 4AYHA 2BS6A 4CPHA 3BDRA 5H9LA 1A57A 4O3ZA 1TOUA 3FIDA 1G7NA 1DZMA 3AUMO 2Q4NA 3WJEA 3Q6LA 4A60A 2IZHB 3NQKA 2QCBA 3P6FA 1BSOA 3VU1A 1JZUA 3BRNA 5H9AA 2CM9A 1IFBA 3D4RA 1N9YA 4MVEA 4GJSA 5CHKA 2VFBA 2DM5A 5HCCC 3BLGA 5D48A 1BBPA 1IKEA 1HBPA 2PY1A 1LIBA 2N93A 1VWFB 1A18A 3OJYC 4QGWA 2OFRX 1DF3A 1U17A 1MUPA 4KH8A 3EW1A 1BM5A 2G5LA 3IFBA 4A8ZA 4ZGUA 1HBQA 4WFVA 1ZNEA 2RQ0A 5AQ6A 4A1HA 1Y9TA 5F2BA 1RXJA 3CR6A 5KHPA 2OL6O 1OEJA 2QO4A 1PBOA 4CDCA 4YBUA 4BX7A 3FA9A 3ZW1A 2ANSA 3BU1A 2FGSA 2XKLA 4I3BA 2RTDB 4ORWA 5FQ8E 1PEEA 1QABE 3VHHA 3U0DA 3NBXX 4ORUA 4N7DA 1N0SA 3U03A 1U0XA 2JMBA 4XMDA 5LJGA 3SOTA 2GH7A 1E02A 3I0AA 4OKAA 3RE6A 3T6LA 1KT7A 4ZJ0A 3ZZVA 3ZUIA 1YP6A 2QO6A 1GT3A 1JJUA 1KL3A 1N4JA 1VPRA 2X4MA 1NP4A 4YH0A 1SWSA 4CDEA 1GGLA 4Z28A 2RA6A 1SWGA 4IMNA 1WBIA 1O1VA 2WEXA 4MVKA 2GJ5A 1Y55X 3O22A 1I4UA 4BX5B 1LDQA 1E06A 4NV7A 3KFFA 2MHDA 3VHIA 2MJIA 4O4SA 2IZIA 5HZ5A 1LKEA 3HOEA 1TXLA 3JS1A 2UZ2A 3WJDA 1SXUA 1KZXA 1OSPO 5HZ6A 1X89A 3B2KA 2RTKA 3P24A 3TGCA 4ORYA 2RTNB 3F6ZB 4ZHGA 1RAVA 1DZPA 1HMRA 5B29A 1NGLA 3AKNA 1L6MA 2R74A 5JD2A 1XCAA 4GDZA 1U18A 1O1UA 1HY2A 4TKHA 3BX7A 4Y0QA 5LJDA 4GDAA 1VWOB 5EPQA 2X32A 5HTDA 3WJBA 4IAXA 4QZTA 3CKGA 1A2DA 1NQNA 3RDMA 1MX8A 1YIVA 4QAEA 1VWGB 1LPJA 4FQBB 2Q9SA 1ZNKA 2OF9A 4B55A 4YVBA 1S7DA 2HKDA 4GH7A 4CSBA 1STPA 1O8VA 2OFMX 1JMZA 2X8FA 3RKGA 1SWTA 2OY8A 1S2PA 2RTGB 1EALA 3FR4A 5HBSA 1E2TA 1NP1A 2AT8X 5K06A 5LJKA 3FW4A 3BY0A 3KQ0A 3PQSA 1JMXA 3ZUOA 4DQ3A 4WHIA 2YMSA 2HYSA 3C77X 3FA6A 1ALBA 2FRSA 4AZQA 2DJGA 4BX6B 3CKFA 3NX1A 2OY5O 1DZKA 1I04A 1VWIB 3CMPA 3OD9A 1JQPA 2FLJA 1I9HA 1KT4A 1QWDA 2ACOA 2Y32A 4AW8A 1SLGB 4KCAA 3PH6A 4TKJA 2FR2A 4XMFA 2ZAGA 3WZPA 2FHNX 2LFOA 4IRWA 1OEEA 4WFUA 4I9RA 3RDSA 3S5VA 4ZHFA 1CBIA 2C1QA 2JN3A 3ZQ3A 5KIDA 4AZNA 2RTCB 1KZWA 1KXOA 3U9PC 3GAQA 4R0BA 4Z27A 2CM4A 2P8GA 3E3CA 3NQ9A 3SZJA 1TOWA 1E00A 4TLJA 1BLRA 3FA7A 4QZUA 1IJ8A 4HPAA 2AH7X 3STMX 4CV7A 1X8PA 2WQAE 3NQ3A 4YCHA 1LIEA 1SWEA 4FBVA 4U8UM 5LJHA 4AZPA 3MM0A 3RDUA 3STNA 4BVMA 4EDEA 1SMPI 3MX7A 1LCZA 2IFBA 3EM0A 4OS8A 5H8TA 4AZRA 1BJ7A 4NYQA 2HLVA 3TGAA 2FHLA 2X45A 4I9SA 1W6FA 4NLJA 4YBPA 4GNYA 1DF8A 5BVQA 4Z2PA 2OVDA 5EDCA 4FBRA 1VYFA 5H9NA 1AB0A 3WYPA 4BJ8A 4TNNA 1JJJA 2RTJA 3DTQA 2LBVA 1GX9A 4Z2VA 1OEKA 1VWDB 2BC3A 3ZI8A 4YMYA 3CBCA 3O2YA 3SLTA 3EBWA 5IXGA 2Q2PA 3APWA 5B2AO 1GX8A 2POAA 2W2BA 3UEVA 4NW4A 1BSQA 3NPOA 1OPAA 4QYPA 1G74A 1EUOA 2CBRA 4M6SA 3PK2A 4O4XA 4Z6JA 5C0NA 3APXA 1FDQA 3FW5A 4QRLA 4Y0SA 2A3FX 3UEUA 4XMEA 1SWBA 4K19A 1FTPA 1VWJB 1AVGI 2K23A 4IB7A 4IB8A 4O49A 4ON1A 1OBUA 3WVMA 5D47A 3PP6A 3F8AA 4MIRA 1X8NA 3UAQA 4BX7B 2CZUA 2X56A 3VE2A 1SREA 4LZVA 1KT3A 3T1DA 3ZW1B 5F6ZA 1SWJA 4ZR2A 3WYQA 3NR3A 1SRIA 2HMBA 2HZRA 5LKEA 4ZH9A 3NP1A 3HWDA 1SLFB 2AKQA 1VWRB 4ORSA 3TZSA 3C76X 1VWBB 2IZEB 1GKAA 2RN4A 4O4UA 4A1YA 2JGSA 2QOSC 2FWVA 3HTYA 3L4RA 3BX8A 1UYOX 2M4LA 2X8SA 1JBHA 1SY2A 2RTFB 5BVTA 2OF8A 5LJBA 2RTPB 2OYBO 1EI5A 1DFVA 2WEWA 1KQXA 4U8UO 2BT9A 3RDXA 4ZHDA 1KGLA 1EW3A 1VWNB 2XSTA 4MEEA 1ML7A 1GX3A 4ML7B 3ELZA 2ACPX 2W2FA 1PM1X 1KQWA 3EBKA 1BRQA 1OBPA 4GK9A 5D4AA 1BSYA 1RLBE 4O4OA 1HQQA 1ZNLA 5EEDA 1LCWA 2VFCA 5K68A 4BX6A 4QGVA 4LKTA 2AT0X 1BRPA 3D97A 4GD9A 5FQ6E 3SZHA 2LA7A 3FIQA 5JR8A 3FR5A 1SXWA 2RTAA 1EPAA 4GETA 3S26A 3QQ2A 1SWPA 3EMMA 3NADA 5F1EA 3STKA 3ZW0B 1FEMA 4C5PA 4Y0PA 4BOEA 3SZIA 3BSZE 3FENA 1IKJA 1VWEB 4U3QA 1HXLA 4Y0RA 5IO6A 3VG5A 4L1NA 3CQNA 3ZW2A 2FT9A 1SXXA 3B2JA 2Z4HA 1QY2A 5AEOA 1EQDA 4XMCA 2I5VO 3P02A 5B5FA 1LFOA 1WUBA 1QY0A 1RXKA 3MBTA 3PECA 1Z24A 4I6SA 3VG6A 3AEHA 3WOVA 1STRB 4NYRA 1D3SA 2PI3O 3LTWA 1IFCA 1GXAA 1A3YA 4QYNA 4UU2A 3FA8A 4OS0A 5EDBA 1MEPA 2G78A 2L9CA 1KT6A 3VPJE 1MOYA 1EIIA 4HPCA 4U8UN 1PTSA 4OMWA 5BVSA 3PPTA 5HA1A 2WQ9A 1N43A 4GGTA 1KT5A 2QM9A 3QKGA 2FTBA 2E4JA 4BGFA 1AELA 5BYPA 2KD2A 4YGGA 2IZGB 2C4IA 2X55A 4Y5DA 2IZFB 3HWGA 1VWLB 3HK1A 3WBGA 1GT1A 1YWBA 3RWXA 3WXQA 3WZNA 2Y3FA 2ASNX 1JYJA 1LIFA 1VWKB 2GTLM 1B4MA 1TW4A 2HNXA 4IABA 3WZQA 1PBYA 1RXHA 4ARHA 2L68A 2WWPA 4ES7A 2LKKA 3APUA 4HWMA 3WJGA 4I3CA 4D6AA 5IRWA 2AT5X 3D95A 3K3LA 2C1SA 4QGXA 2A2GA 1X8UA 2OFAA 2WR6A 2WPUA 2RTRB 3VHMA 1P6PA 2MO5A 3IA8A 1YWCA 4AZMA 5FENA 3APVA 3BU9A 2X8TA 2CZTA 3KFHA 4L3RA 3KFIA 2IZLB 1LNMA 4LQZA 4PJ2A 5HZ9A 4YCEA 1ICNA 3RZYA 1KL4A 3WJFA 1JJXA 5DG4A 1SA8A 5L3YA 1ZRYA 4NNTA 4LKPA 3Q34A 4INNA 1N7YA 1DV9A 4O3XB 4ODDA 5AJCA 4NNSA 2NNEA 4EXZA 3MG5A 4QNIA 2R73A 3FEKA 1SRGA 5EEEA 3T2WA 1FENA 2BSZA 3RE5A 2A2UA 1T8VA 2A5CA 4OEMA 4DQ4A 2O62A 3S60A 2AMMX 2MF6A 3P6EA 1SWUA 2ZSCA 1SRJA 1SY1A 1YWAA 1ZNHA 1EPBA 2F73A 2OL8O 3CBSA 5D45A 4GZVA 5F7GA 3FMZA 4CPHB 4DNEA 1ZNGA 3PH5A 1UREA 4IMOA 4YFPA 3RBYA 2FKGA 2FS6A 2LBAA 3JSQA 4GKCA 1VYOA 1SWHA 1X8QA 1FE3A 3AKMA 4YGZA 3RDOA 4BQUA 5HAEA 1LICA 1SWCA 3SLOA 4CPIA 4IAWA 2MM3A 1D2UA 1OBQA 3F9DA 4CDDA 1PMPA 2GTLO 4HPDA 4GE1A 5CYBA 1SRHA 3PEDA 4ORXA 1SWQA 4HFOA 2X46A 1QFVA 5F58A 1G5WA 4ORRA 1BEBA 3HPEA 2NP1A 1DC9A 5HWZA 4WBKA 2AF5A 2G8CO 4GNWA 1S44A 5L8NA 1Y53X 2UYWA 1GT5A 5AJBA 1RBPA 2RD7C 1UZ2X 1ACDA 2AVIA 1Y52X 3FDCA 2OVEA 3D96A 4YDAA 4OMXA 1VWAB 3VG2A 2CBSA 1HQPA 2QMIA 1W5RA 1ZNDA 4TKBA 1QQSA 1B8EA 5LJCA 3WJCA 2JOZA 3P6CA 1VWQB 3VE1A 2Q2MA 3PQUA 2MWHA 2KT4B 4YKMA 5B11O 1MX7A 4KC8A 1SWOA 2Z4IA 3BS2A 1E5PA 3OE3A 2IZKA 4GU8A 2OY7A 3LV4A 4YFRA 1YP7A 5LJEA 2Q39A 3NX2A 1W4TA 1Y0GA 1GKAB 4MVLA 1HN2A 1EXSA 2HZQA 3VG4A 5FQ7E 1N9MA 1H91A 2RTLA 3C78X 3HWEA 1G85A 3P6GA 5LKFA 1GT4A 4U46A 5CE4A 2QOMA 3N91A 2A8GA 1NBXA 2IZJA 1I78A 1SWNA 3KVNA 3B2HA 4ZGFA 5HTEA 2OVAA 4FGIB 2GTLN 3OBLA 2BS5A 4XMHA 4ZHCA 4ZFXA 5CSEA 1LF7A 2GTFX 3RY2A 5H9KA 5HCDC 4JGLA 4ZCBA 1AVDA 4YFQA 1I05A 2A13A 4TJZA 4KC7A 2OL7A 4CDFA 2GC9A 3EW2A 3MVFA 1B0OA 4GRJA 2AL0X 4MISA 4NLIA 5B10O 4BCSA 1DZJA 2IZCB 1SY3A 4GJVA 2EU7X 2RCQA 1STSB 2A0AA 3V8UA 1RSTB 4YGHA 1SWRA 4O3YA 2RTQB 2FR3A 4O9SA 1KFFA 2RTOB 2L5PA 3RDQA 3TF6A 4EEJA 1BWYA 5B27A 1IW2A 4JHQA 4AZOA 1VWHB 4HPBA 4XMGA 4GGRA 4OS3A 3UEWA 1CRBA 2OVSA 1XKIA 5HZQA 4BX5A 4PSQA 5DPQA 3VG3A 4CPEA 1SWKA 1VWPB 3B2IA 1LIDA 4YKOA 3I17A 1LDOA 3PDFA 2X34A 4QQ1A 1CJ5A 5FFHA 1HXZA 3RSWA 1SWDA 1B56A 3FLLA 3P6HA 1JIWI 1SLEB 1FELA 3SLJA 2CAMA 1TVQA 2QO5A 2RTEB 4I3DA 3ZW0A 1SWLA 5L8OA 4RUUA 5EZ2A 4I95A 4IB9A 1QY1A 4O3WA 1I06A 2I5ZO 1MDCA 1QFTA 2BLGA 4IBAA 3KZAA 4ALOA 1ERBA 1SLDB 2ALLX 4FBOA 3SAOA 3EYCA 2F01A 3B2LA 3FEPA 3FYFA 2KTDA 2AT6X 1CBQA 2IZBA 1YUPA 2WSJA 2NNQA 1MK5A 4IB6A 5B5GA 1VWMB 2G79A 1ICMA 1YWDA 4GUZA 2FKJA 1JV4A 1SXYA 1QG5A 4CPFA 2W2AA 1X8OA 1AQBA 1FJ1E 4KT5A 4OELA 5IRAA 1CBRA 3UEXA 4EQAC 2KW1A 5B3MO 1Y9LA 4ZH6A 4DCBA 3HOLA 4NV8A 4D6BA 1SY0A 2ZAIA 3ZWEA 3GE2A 2Y3EA 1LUQA 2R56A 1IIUA 4N7CA 4EFGA 5IRUA 1NQMA 2OZQA 5IO5A 2A5BA 4M7MA 1T68X 1K3BA 2K62A 1VYGA 3LHNA 2LB6A 4NP1A 4U9CA 4UU3A 2YG2A 3D9WA 5D8JA 5FAZA 3H3IA 4COTA 2BHVA 2RTBB 1NC9A 4TQ2A 1X71A 2L67A
chains in the Genus database with same CATH topology
1VWCB 4BBOA 4GDAA 1VWOB 1VWNB 1Y53X 2RTHB 2UYWA 1NQNA 1SWAA 1SWFA 3RDMA 3T2XA 1LCVA 2AVIA 1VWGB 1Y52X 3FDCA 1VWAB 2OF9A 4EKVA 1HQQA 4YVBA 1LCWA 1STPA 5K68A 5K67A 3T6FA 1VWQB 3SZHA 4GD9A 1NDJA 1SWTA 2RTGB 2RTAA 1SRFA 1SWOA 4JNJA 2IZDB 1MM9A 2IZKA 3VGWA 1SWPA 1KL5A 3SZIA 4BX6B 1N9MA 1VWEB 2RTLA 1HXLA 1RSUB 4I60A 4GGZA 4U46A 3WZOA 3X00A 1VWIB 4JO6A 4Y59A 1I9HA 2RTIB 2A8GA 1NBXA 2Y32A 2IZJA 2IZAA 5B5FA 1SWNA 4Z2OA 1SLGB 1RXKA 1LELA 3RY1A 2FHNX 1AVEA 1STRB 2RTMA 4IRWA 2OFBA 5CSEA 3WZPA 3RY2A 3RDSA 4CPHA 5IRWA 1AVDA 1MEPA 2C1QA 1MOYA 1PTSA 2RTCB 3EW2A 4GGTA 1N43A 4BCSA 2IZHB 2QCBA 2IZCB 4Z27A 2IZGB 2C4IA 4GJVA 1N9YA 2IZFB 4Y5DA 3SZJA 1STSB 1VWLB 3WZNA 1RSTB 4GJSA 2Y3FA 1SWRA 1VWKB 5CHKA 2RTQB 1KFFA 1IJ8A 2RTOB 3WZQA 3RDQA 1RXHA 1VWFB 2OF8A 1SWEA 3EW1A 2G5LA 4JHQA 1VWHB 4GGRA 3MM0A 3RDUA 1LCZA 2C1SA 4BX5A 5F2BA 1RXJA 4CPEA 1SWKA 1VWPB 2OFAA 2FHLA 2WPUA 1LDOA 1DF8A 2RTRB 3VHMA 4BX7A 4Z2PA 1HXZA 1SWDA 2RTDB 3VHHA 3WYPA 4BJ8A 2IZLB 2RTJA 1SLEB 2CAMA 2RTEB 4Z2VA 1SWLA 1VWDB 2BC3A 2GH7A 1KL4A 4OKAA 3RE6A 3T6LA 5L3YA 1N7YA 1N4JA 1KL3A 3MG5A 1SWSA 1SLDB 3T2WA 1SRGA 4Z28A 1SWGA 2F01A 3PK2A 4Z6JA 1WBIA 3RE5A 2IZBA 1SWBA 2A5CA 1Y55X 1MK5A 2MF6A 1VWJB 1SWUA 1LDQA 1VWMB 1SRJA 2ZSCA 5B5GA 4BX5B 3VHIA 2IZIA 4CPFA 4CPHB 4BX7B 4DNEA 1SREA 2UZ2A 1SWJA 5IRAA 3WYQA 1SRIA 1VYOA 1SWHA 2RTKA 3RDOA 1SWCA 1SLFB 4CPIA 1VWRB 1LUQA 2Y3EA 2RTNB 1VWBB 2IZEB 1RAVA 5IRUA 1NQMA 2JGSA 2A5BA 4BX6A 1SRHA 2RTFB 1SWQA 5JD2A 2RTBB 1NC9A 1HY2A 2RTPB 3RDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VWC B;  4BBO A;  4GDA A;  1VWO B;  1VWN B;  1Y53 X;  2RTH B;  2UYW A;  1NQN A;  1SWA A;  1SWF A;  3RDM A;  3T2X A;  1LCV A;  2AVI A;  1VWG B;  1Y52 X;  3FDC A;  1VWA B;  2OF9 A;  4EKV A;  1HQQ A;  4YVB A;  1LCW A;  1STP A;  5K68 A;  5K67 A;  3T6F A;  1VWQ B;  3SZH A;  4GD9 A;  1NDJ A;  1SWT A;  2RTG B;  2RTA A;  1SRF A;  1SWO A;  4JNJ A;  2IZD B;  1MM9 A;  2IZK A;  3VGW A;  1SWP A;  1KL5 A;  3SZI A;  4BX6 B;  1N9M A;  1VWE B;  2RTL A;  1HXL A;  1RSU B;  4I60 A;  4GGZ A;  4U46 A;  3WZO A;  3X00 A;  1VWI B;  4JO6 A;  4Y59 A;  1I9H A;  2RTI B;  2A8G A;  1NBX A;  2Y32 A;  2IZJ A;  2IZA A;  5B5F A;  1SWN A;  4Z2O A;  1SLG B;  1RXK A;  1LEL A;  3RY1 A;  2FHN X;  1AVE A;  1STR B;  2RTM A;  4IRW A;  2OFB A;  5CSE A;  3WZP A;  3RY2 A;  3RDS A;  4CPH A;  5IRW A;  1AVD A;  1MEP A;  2C1Q A;  1MOY A;  1PTS A;  2RTC B;  3EW2 A;  4GGT A;  1N43 A;  4BCS A;  2IZH B;  2QCB A;  2IZC B;  4Z27 A;  2IZG B;  2C4I A;  4GJV A;  1N9Y A;  2IZF B;  4Y5D A;  3SZJ A;  1STS B;  1VWL B;  3WZN A;  1RST B;  4GJS A;  2Y3F A;  1SWR A;  1VWK B;  5CHK A;  2RTQ B;  1KFF A;  1IJ8 A;  2RTO B;  3WZQ A;  3RDQ A;  1RXH A;  1VWF B;  2OF8 A;  1SWE A;  3EW1 A;  2G5L A;  4JHQ A;  1VWH B;  4GGR A;  3MM0 A;  3RDU A;  1LCZ A;  2C1S A;  4BX5 A;  5F2B A;  1RXJ A;  4CPE A;  1SWK A;  1VWP B;  2OFA A;  2FHL A;  2WPU A;  1LDO A;  1DF8 A;  2RTR B;  3VHM A;  4BX7 A;  4Z2P A;  1HXZ A;  1SWD A;  2RTD B;  3VHH A;  3WYP A;  4BJ8 A;  2IZL B;  2RTJ A;  1SLE B;  2CAM A;  2RTE B;  4Z2V A;  1SWL A;  1VWD B;  2BC3 A;  2GH7 A;  1KL4 A;  4OKA A;  3RE6 A;  3T6L A;  5L3Y A;  1N7Y A;  1N4J A;  1KL3 A;  3MG5 A;  1SWS A;  1SLD B;  3T2W A;  1SRG A;  4Z28 A;  1SWG A;  2F01 A;  3PK2 A;  4Z6J A;  1WBI A;  3RE5 A;  2IZB A;  1SWB A;  2A5C A;  1Y55 X;  1MK5 A;  2MF6 A;  1VWJ B;  1SWU A;  1LDQ A;  1VWM B;  1SRJ A;  2ZSC A;  5B5G A;  4BX5 B;  3VHI A;  2IZI A;  4CPF A;  4CPH B;  4BX7 B;  4DNE A;  1SRE A;  2UZ2 A;  1SWJ A;  5IRA A;  3WYQ A;  1SRI A;  1VYO A;  1SWH A;  2RTK A;  3RDO A;  1SWC A;  1SLF B;  4CPI A;  1VWR B;  1LUQ A;  2Y3E A;  2RTN B;  1VWB B;  2IZE B;  1RAV A;  5IRU A;  1NQM A;  2JGS A;  2A5B A;  4BX6 A;  1SRH A;  2RTF B;  1SWQ A;  5JD2 A;  2RTB B;  1NC9 A;  1HY2 A;  2RTP B;  3RDX A; 
#chains in the Genus database with same CATH topology
 2OY1 O;  3KFG A;  1VWC B;  4YDB A;  1ADL A;  1KOI A;  1R0U A;  4BBO A;  1MVG A;  5HZ8 A;  3TGB A;  3O19 A;  5HA0 A;  2JW1 A;  2JU3 A;  2RTH B;  3CWK A;  3T2X A;  1SWA A;  1SWF A;  2DJF A;  4CK4 A;  2G7B A;  1LCV A;  1OPB A;  1HMT A;  4MVI A;  5KIC A;  4EKV A;  1T0V A;  4ID2 A;  3HWF A;  4ZHH A;  3T6F A;  5K67 A;  1CBS A;  2JU7 A;  4KII A;  3ELX A;  1NDJ A;  1HMS A;  2F09 A;  1ERX A;  2KTS A;  2VDF A;  4LZU A;  1SRF A;  4JNJ A;  2IZD B;  1MM9 A;  3VGW A;  3FEL A;  3VG7 A;  1KL5 A;  4RUN A;  3S5X A;  2AT3 X;  5F6B A;  1K24 A;  4ALB A;  3EC5 A;  5IO7 A;  4I60 A;  1GM6 A;  3G7X A;  1RSU B;  3FR2 A;  1UYN X;  3JQO A;  4GGZ A;  3WZO A;  3X00 A;  1EIO A;  4JO6 A;  3P6D A;  4Y59 A;  5L8I A;  2RTI B;  2FS7 A;  2IZA A;  4Z2O A;  1JYD A;  2JU8 A;  3DSZ A;  5HCE C;  1LEL A;  3CQR A;  3RY1 A;  2RCT A;  1AVE A;  2NND A;  2RTM A;  2WUT A;  2OFB A;  4AYH A;  2BS6 A;  4CPH A;  3BDR A;  5H9L A;  1A57 A;  4O3Z A;  1TOU A;  3FID A;  1G7N A;  1DZM A;  3AUM O;  2Q4N A;  3WJE A;  3Q6L A;  4A60 A;  2IZH B;  3NQK A;  2QCB A;  3P6F A;  1BSO A;  3VU1 A;  1JZU A;  3BRN A;  5H9A A;  2CM9 A;  1IFB A;  3D4R A;  1N9Y A;  4MVE A;  4GJS A;  5CHK A;  2VFB A;  2DM5 A;  5HCC C;  3BLG A;  5D48 A;  1BBP A;  1IKE A;  1HBP A;  2PY1 A;  1LIB A;  2N93 A;  1VWF B;  1A18 A;  3OJY C;  4QGW A;  2OFR X;  1DF3 A;  1U17 A;  1MUP A;  4KH8 A;  3EW1 A;  1BM5 A;  2G5L A;  3IFB A;  4A8Z A;  4ZGU A;  1HBQ A;  4WFV A;  1ZNE A;  2RQ0 A;  5AQ6 A;  4A1H A;  1Y9T A;  5F2B A;  1RXJ A;  3CR6 A;  5KHP A;  2OL6 O;  1OEJ A;  2QO4 A;  1PBO A;  4CDC A;  4YBU A;  4BX7 A;  3FA9 A;  3ZW1 A;  2ANS A;  3BU1 A;  2FGS A;  2XKL A;  4I3B A;  2RTD B;  4ORW A;  5FQ8 E;  1PEE A;  1QAB E;  3VHH A;  3U0D A;  3NBX X;  4ORU A;  4N7D A;  1N0S A;  3U03 A;  1U0X A;  2JMB A;  4XMD A;  5LJG A;  3SOT A;  2GH7 A;  1E02 A;  3I0A A;  4OKA A;  3RE6 A;  3T6L A;  1KT7 A;  4ZJ0 A;  3ZZV A;  3ZUI A;  1YP6 A;  2QO6 A;  1GT3 A;  1JJU A;  1KL3 A;  1N4J A;  1VPR A;  2X4M A;  1NP4 A;  4YH0 A;  1SWS A;  4CDE A;  1GGL A;  4Z28 A;  2RA6 A;  1SWG A;  4IMN A;  1WBI A;  1O1V A;  2WEX A;  4MVK A;  2GJ5 A;  1Y55 X;  3O22 A;  1I4U A;  4BX5 B;  1LDQ A;  1E06 A;  4NV7 A;  3KFF A;  2MHD A;  3VHI A;  2MJI A;  4O4S A;  2IZI A;  5HZ5 A;  1LKE A;  3HOE A;  1TXL A;  3JS1 A;  2UZ2 A;  3WJD A;  1SXU A;  1KZX A;  1OSP O;  5HZ6 A;  1X89 A;  3B2K A;  2RTK A;  3P24 A;  3TGC A;  4ORY A;  2RTN B;  3F6Z B;  4ZHG A;  1RAV A;  1DZP A;  1HMR A;  5B29 A;  1NGL A;  3AKN A;  1L6M A;  2R74 A;  5JD2 A;  1XCA A;  4GDZ A;  1U18 A;  1O1U A;  1HY2 A;  4TKH A;  3BX7 A;  4Y0Q A;  5LJD A;  4GDA A;  1VWO B;  5EPQ A;  2X32 A;  5HTD A;  3WJB A;  4IAX A;  4QZT A;  3CKG A;  1A2D A;  1NQN A;  3RDM A;  1MX8 A;  1YIV A;  4QAE A;  1VWG B;  1LPJ A;  4FQB B;  2Q9S A;  1ZNK A;  2OF9 A;  4B55 A;  4YVB A;  1S7D A;  2HKD A;  4GH7 A;  4CSB A;  1STP A;  1O8V A;  2OFM X;  1JMZ A;  2X8F A;  3RKG A;  1SWT A;  2OY8 A;  1S2P A;  2RTG B;  1EAL A;  3FR4 A;  5HBS A;  1E2T A;  1NP1 A;  2AT8 X;  5K06 A;  5LJK A;  3FW4 A;  3BY0 A;  3KQ0 A;  3PQS A;  1JMX A;  3ZUO A;  4DQ3 A;  4WHI A;  2YMS A;  2HYS A;  3C77 X;  3FA6 A;  1ALB A;  2FRS A;  4AZQ A;  2DJG A;  4BX6 B;  3CKF A;  3NX1 A;  2OY5 O;  1DZK A;  1I04 A;  1VWI B;  3CMP A;  3OD9 A;  1JQP A;  2FLJ A;  1I9H A;  1KT4 A;  1QWD A;  2ACO A;  2Y32 A;  4AW8 A;  1SLG B;  4KCA A;  3PH6 A;  4TKJ A;  2FR2 A;  4XMF A;  2ZAG A;  3WZP A;  2FHN X;  2LFO A;  4IRW A;  1OEE A;  4WFU A;  4I9R A;  3RDS A;  3S5V A;  4ZHF A;  1CBI A;  2C1Q A;  2JN3 A;  3ZQ3 A;  5KID A;  4AZN A;  2RTC B;  1KZW A;  1KXO A;  3U9P C;  3GAQ A;  4R0B A;  4Z27 A;  2CM4 A;  2P8G A;  3E3C A;  3NQ9 A;  3SZJ A;  1TOW A;  1E00 A;  4TLJ A;  1BLR A;  3FA7 A;  4QZU A;  1IJ8 A;  4HPA A;  2AH7 X;  3STM X;  4CV7 A;  1X8P A;  2WQA E;  3NQ3 A;  4YCH A;  1LIE A;  1SWE A;  4FBV A;  4U8U M;  5LJH A;  4AZP A;  3MM0 A;  3RDU A;  3STN A;  4BVM A;  4EDE A;  1SMP I;  3MX7 A;  1LCZ A;  2IFB A;  3EM0 A;  4OS8 A;  5H8T A;  4AZR A;  1BJ7 A;  4NYQ A;  2HLV A;  3TGA A;  2FHL A;  2X45 A;  4I9S A;  1W6F A;  4NLJ A;  4YBP A;  4GNY A;  1DF8 A;  5BVQ A;  4Z2P A;  2OVD A;  5EDC A;  4FBR A;  1VYF A;  5H9N A;  1AB0 A;  3WYP A;  4BJ8 A;  4TNN A;  1JJJ A;  2RTJ A;  3DTQ A;  2LBV A;  1GX9 A;  4Z2V A;  1OEK A;  1VWD B;  2BC3 A;  3ZI8 A;  4YMY A;  3CBC A;  3O2Y A;  3SLT A;  3EBW A;  5IXG A;  2Q2P A;  3APW A;  5B2A O;  1GX8 A;  2POA A;  2W2B A;  3UEV A;  4NW4 A;  1BSQ A;  3NPO A;  1OPA A;  4QYP A;  1G74 A;  1EUO A;  2CBR A;  4M6S A;  3PK2 A;  4O4X A;  4Z6J A;  5C0N A;  3APX A;  1FDQ A;  3FW5 A;  4QRL A;  4Y0S A;  2A3F X;  3UEU A;  4XME A;  1SWB A;  4K19 A;  1FTP A;  1VWJ B;  1AVG I;  2K23 A;  4IB7 A;  4IB8 A;  4O49 A;  4ON1 A;  1OBU A;  3WVM A;  5D47 A;  3PP6 A;  3F8A A;  4MIR A;  1X8N A;  3UAQ A;  4BX7 B;  2CZU A;  2X56 A;  3VE2 A;  1SRE A;  4LZV A;  1KT3 A;  3T1D A;  3ZW1 B;  5F6Z A;  1SWJ A;  4ZR2 A;  3WYQ A;  3NR3 A;  1SRI A;  2HMB A;  2HZR A;  5LKE A;  4ZH9 A;  3NP1 A;  3HWD A;  1SLF B;  2AKQ A;  1VWR B;  4ORS A;  3TZS A;  3C76 X;  1VWB B;  2IZE B;  1GKA A;  2RN4 A;  4O4U A;  4A1Y A;  2JGS A;  2QOS C;  2FWV A;  3HTY A;  3L4R A;  3BX8 A;  1UYO X;  2M4L A;  2X8S A;  1JBH A;  1SY2 A;  2RTF B;  5BVT A;  2OF8 A;  5LJB A;  2RTP B;  2OYB O;  1EI5 A;  1DFV A;  2WEW A;  1KQX A;  4U8U O;  2BT9 A;  3RDX A;  4ZHD A;  1KGL A;  1EW3 A;  1VWN B;  2XST A;  4MEE A;  1ML7 A;  1GX3 A;  4ML7 B;  3ELZ A;  2ACP X;  2W2F A;  1PM1 X;  1KQW A;  3EBK A;  1BRQ A;  1OBP A;  4GK9 A;  5D4A A;  1BSY A;  1RLB E;  4O4O A;  1HQQ A;  1ZNL A;  5EED A;  1LCW A;  2VFC A;  5K68 A;  4BX6 A;  4QGV A;  4LKT A;  2AT0 X;  1BRP A;  3D97 A;  4GD9 A;  5FQ6 E;  3SZH A;  2LA7 A;  3FIQ A;  5JR8 A;  3FR5 A;  1SXW A;  2RTA A;  1EPA A;  4GET A;  3S26 A;  3QQ2 A;  1SWP A;  3EMM A;  3NAD A;  5F1E A;  3STK A;  3ZW0 B;  1FEM A;  4C5P A;  4Y0P A;  4BOE A;  3SZI A;  3BSZ E;  3FEN A;  1IKJ A;  1VWE B;  4U3Q A;  1HXL A;  4Y0R A;  5IO6 A;  3VG5 A;  4L1N A;  3CQN A;  3ZW2 A;  2FT9 A;  1SXX A;  3B2J A;  2Z4H A;  1QY2 A;  5AEO A;  1EQD A;  4XMC A;  2I5V O;  3P02 A;  5B5F A;  1LFO A;  1WUB A;  1QY0 A;  1RXK A;  3MBT A;  3PEC A;  1Z24 A;  4I6S A;  3VG6 A;  3AEH A;  3WOV A;  1STR B;  4NYR A;  1D3S A;  2PI3 O;  3LTW A;  1IFC A;  1GXA A;  1A3Y A;  4QYN A;  4UU2 A;  3FA8 A;  4OS0 A;  5EDB A;  1MEP A;  2G78 A;  2L9C A;  1KT6 A;  3VPJ E;  1MOY A;  1EII A;  4HPC A;  4U8U N;  1PTS A;  4OMW A;  5BVS A;  3PPT A;  5HA1 A;  2WQ9 A;  1N43 A;  4GGT A;  1KT5 A;  2QM9 A;  3QKG A;  2FTB A;  2E4J A;  4BGF A;  1AEL A;  5BYP A;  2KD2 A;  4YGG A;  2IZG B;  2C4I A;  2X55 A;  4Y5D A;  2IZF B;  3HWG A;  1VWL B;  3HK1 A;  3WBG A;  1GT1 A;  1YWB A;  3RWX A;  3WXQ A;  3WZN A;  2Y3F A;  2ASN X;  1JYJ A;  1LIF A;  1VWK B;  2GTL M;  1B4M A;  1TW4 A;  2HNX A;  4IAB A;  3WZQ A;  1PBY A;  1RXH A;  4ARH A;  2L68 A;  2WWP A;  4ES7 A;  2LKK A;  3APU A;  4HWM A;  3WJG A;  4I3C A;  4D6A A;  5IRW A;  2AT5 X;  3D95 A;  3K3L A;  2C1S A;  4QGX A;  2A2G A;  1X8U A;  2OFA A;  2WR6 A;  2WPU A;  2RTR B;  3VHM A;  1P6P A;  2MO5 A;  3IA8 A;  1YWC A;  4AZM A;  5FEN A;  3APV A;  3BU9 A;  2X8T A;  2CZT A;  3KFH A;  4L3R A;  3KFI A;  2IZL B;  1LNM A;  4LQZ A;  4PJ2 A;  5HZ9 A;  4YCE A;  1ICN A;  3RZY A;  1KL4 A;  3WJF A;  1JJX A;  5DG4 A;  1SA8 A;  5L3Y A;  1ZRY A;  4NNT A;  4LKP A;  3Q34 A;  4INN A;  1N7Y A;  1DV9 A;  4O3X B;  4ODD A;  5AJC A;  4NNS A;  2NNE A;  4EXZ A;  3MG5 A;  4QNI A;  2R73 A;  3FEK A;  1SRG A;  5EEE A;  3T2W A;  1FEN A;  2BSZ A;  3RE5 A;  2A2U A;  1T8V A;  2A5C A;  4OEM A;  4DQ4 A;  2O62 A;  3S60 A;  2AMM X;  2MF6 A;  3P6E A;  1SWU A;  2ZSC A;  1SRJ A;  1SY1 A;  1YWA A;  1ZNH A;  1EPB A;  2F73 A;  2OL8 O;  3CBS A;  5D45 A;  4GZV A;  5F7G A;  3FMZ A;  4CPH B;  4DNE A;  1ZNG A;  3PH5 A;  1URE A;  4IMO A;  4YFP A;  3RBY A;  2FKG A;  2FS6 A;  2LBA A;  3JSQ A;  4GKC A;  1VYO A;  1SWH A;  1X8Q A;  1FE3 A;  3AKM A;  4YGZ A;  3RDO A;  4BQU A;  5HAE A;  1LIC A;  1SWC A;  3SLO A;  4CPI A;  4IAW A;  2MM3 A;  1D2U A;  1OBQ A;  3F9D A;  4CDD A;  1PMP A;  2GTL O;  4HPD A;  4GE1 A;  5CYB A;  1SRH A;  3PED A;  4ORX A;  1SWQ A;  4HFO A;  2X46 A;  1QFV A;  5F58 A;  1G5W A;  4ORR A;  1BEB A;  3HPE A;  2NP1 A;  1DC9 A;  5HWZ A;  4WBK A;  2AF5 A;  2G8C O;  4GNW A;  1S44 A;  5L8N A;  1Y53 X;  2UYW A;  1GT5 A;  5AJB A;  1RBP A;  2RD7 C;  1UZ2 X;  1ACD A;  2AVI A;  1Y52 X;  3FDC A;  2OVE A;  3D96 A;  4YDA A;  4OMX A;  1VWA B;  3VG2 A;  2CBS A;  1HQP A;  2QMI A;  1W5R A;  1ZND A;  4TKB A;  1QQS A;  1B8E A;  5LJC A;  3WJC A;  2JOZ A;  3P6C A;  1VWQ B;  3VE1 A;  2Q2M A;  3PQU A;  2MWH A;  2KT4 B;  4YKM A;  5B11 O;  1MX7 A;  4KC8 A;  1SWO A;  2Z4I A;  3BS2 A;  1E5P A;  3OE3 A;  2IZK A;  4GU8 A;  2OY7 A;  3LV4 A;  4YFR A;  1YP7 A;  5LJE A;  2Q39 A;  3NX2 A;  1W4T A;  1Y0G A;  1GKA B;  4MVL A;  1HN2 A;  1EXS A;  2HZQ A;  3VG4 A;  5FQ7 E;  1N9M A;  1H91 A;  2RTL A;  3C78 X;  3HWE A;  1G85 A;  3P6G A;  5LKF A;  1GT4 A;  4U46 A;  5CE4 A;  2QOM A;  3N91 A;  2A8G A;  1NBX A;  2IZJ A;  1I78 A;  1SWN A;  3KVN A;  3B2H A;  4ZGF A;  5HTE A;  2OVA A;  4FGI B;  2GTL N;  3OBL A;  2BS5 A;  4XMH A;  4ZHC A;  4ZFX A;  5CSE A;  1LF7 A;  2GTF X;  3RY2 A;  5H9K A;  5HCD C;  4JGL A;  4ZCB A;  1AVD A;  4YFQ A;  1I05 A;  2A13 A;  4TJZ A;  4KC7 A;  2OL7 A;  4CDF A;  2GC9 A;  3EW2 A;  3MVF A;  1B0O A;  4GRJ A;  2AL0 X;  4MIS A;  4NLI A;  5B10 O;  4BCS A;  1DZJ A;  2IZC B;  1SY3 A;  4GJV A;  2EU7 X;  2RCQ A;  1STS B;  2A0A A;  3V8U A;  1RST B;  4YGH A;  1SWR A;  4O3Y A;  2RTQ B;  2FR3 A;  4O9S A;  1KFF A;  2RTO B;  2L5P A;  3RDQ A;  3TF6 A;  4EEJ A;  1BWY A;  5B27 A;  1IW2 A;  4JHQ A;  4AZO A;  1VWH B;  4HPB A;  4XMG A;  4GGR A;  4OS3 A;  3UEW A;  1CRB A;  2OVS A;  1XKI A;  5HZQ A;  4BX5 A;  4PSQ A;  5DPQ A;  3VG3 A;  4CPE A;  1SWK A;  1VWP B;  3B2I A;  1LID A;  4YKO A;  3I17 A;  1LDO A;  3PDF A;  2X34 A;  4QQ1 A;  1CJ5 A;  5FFH A;  1HXZ A;  3RSW A;  1SWD A;  1B56 A;  3FLL A;  3P6H A;  1JIW I;  1SLE B;  1FEL A;  3SLJ A;  2CAM A;  1TVQ A;  2QO5 A;  2RTE B;  4I3D A;  3ZW0 A;  1SWL A;  5L8O A;  4RUU A;  5EZ2 A;  4I95 A;  4IB9 A;  1QY1 A;  4O3W A;  1I06 A;  2I5Z O;  1MDC A;  1QFT A;  2BLG A;  4IBA A;  3KZA A;  4ALO A;  1ERB A;  1SLD B;  2ALL X;  4FBO A;  3SAO A;  3EYC A;  2F01 A;  3B2L A;  3FEP A;  3FYF A;  2KTD A;  2AT6 X;  1CBQ A;  2IZB A;  1YUP A;  2WSJ A;  2NNQ A;  1MK5 A;  4IB6 A;  5B5G A;  1VWM B;  2G79 A;  1ICM A;  1YWD A;  4GUZ A;  2FKJ A;  1JV4 A;  1SXY A;  1QG5 A;  4CPF A;  2W2A A;  1X8O A;  1AQB A;  1FJ1 E;  4KT5 A;  4OEL A;  5IRA A;  1CBR A;  3UEX A;  4EQA C;  2KW1 A;  5B3M O;  1Y9L A;  4ZH6 A;  4DCB A;  3HOL A;  4NV8 A;  4D6B A;  1SY0 A;  2ZAI A;  3ZWE A;  3GE2 A;  2Y3E A;  1LUQ A;  2R56 A;  1IIU A;  4N7C A;  4EFG A;  5IRU A;  1NQM A;  2OZQ A;  5IO5 A;  2A5B A;  4M7M A;  1T68 X;  1K3B A;  2K62 A;  1VYG A;  3LHN A;  2LB6 A;  4NP1 A;  4U9C A;  4UU3 A;  2YG2 A;  3D9W A;  5D8J A;  5FAZ A;  3H3I A;  4COT A;  2BHV A;  2RTB B;  1NC9 A;  4TQ2 A;  1X71 A;  2L67 A; 
#chains in the Genus database with same CATH homology
 1VWC B;  4BBO A;  4GDA A;  1VWO B;  1VWN B;  1Y53 X;  2RTH B;  2UYW A;  1NQN A;  1SWA A;  1SWF A;  3RDM A;  3T2X A;  1LCV A;  2AVI A;  1VWG B;  1Y52 X;  3FDC A;  1VWA B;  2OF9 A;  4EKV A;  1HQQ A;  4YVB A;  1LCW A;  1STP A;  5K68 A;  5K67 A;  3T6F A;  1VWQ B;  3SZH A;  4GD9 A;  1NDJ A;  1SWT A;  2RTG B;  2RTA A;  1SRF A;  1SWO A;  4JNJ A;  2IZD B;  1MM9 A;  2IZK A;  3VGW A;  1SWP A;  1KL5 A;  3SZI A;  4BX6 B;  1N9M A;  1VWE B;  2RTL A;  1HXL A;  1RSU B;  4I60 A;  4GGZ A;  4U46 A;  3WZO A;  3X00 A;  1VWI B;  4JO6 A;  4Y59 A;  1I9H A;  2RTI B;  2A8G A;  1NBX A;  2Y32 A;  2IZJ A;  2IZA A;  5B5F A;  1SWN A;  4Z2O A;  1SLG B;  1RXK A;  1LEL A;  3RY1 A;  2FHN X;  1AVE A;  1STR B;  2RTM A;  4IRW A;  2OFB A;  5CSE A;  3WZP A;  3RY2 A;  3RDS A;  4CPH A;  5IRW A;  1AVD A;  1MEP A;  2C1Q A;  1MOY A;  1PTS A;  2RTC B;  3EW2 A;  4GGT A;  1N43 A;  4BCS A;  2IZH B;  2QCB A;  2IZC B;  4Z27 A;  2IZG B;  2C4I A;  4GJV A;  1N9Y A;  2IZF B;  4Y5D A;  3SZJ A;  1STS B;  1VWL B;  3WZN A;  1RST B;  4GJS A;  2Y3F A;  1SWR A;  1VWK B;  5CHK A;  2RTQ B;  1KFF A;  1IJ8 A;  2RTO B;  3WZQ A;  3RDQ A;  1RXH A;  1VWF B;  2OF8 A;  1SWE A;  3EW1 A;  2G5L A;  4JHQ A;  1VWH B;  4GGR A;  3MM0 A;  3RDU A;  1LCZ A;  2C1S A;  4BX5 A;  5F2B A;  1RXJ A;  4CPE A;  1SWK A;  1VWP B;  2OFA A;  2FHL A;  2WPU A;  1LDO A;  1DF8 A;  2RTR B;  3VHM A;  4BX7 A;  4Z2P A;  1HXZ A;  1SWD A;  2RTD B;  3VHH A;  3WYP A;  4BJ8 A;  2IZL B;  2RTJ A;  1SLE B;  2CAM A;  2RTE B;  4Z2V A;  1SWL A;  1VWD B;  2BC3 A;  2GH7 A;  1KL4 A;  4OKA A;  3RE6 A;  3T6L A;  5L3Y A;  1N7Y A;  1N4J A;  1KL3 A;  3MG5 A;  1SWS A;  1SLD B;  3T2W A;  1SRG A;  4Z28 A;  1SWG A;  2F01 A;  3PK2 A;  4Z6J A;  1WBI A;  3RE5 A;  2IZB A;  1SWB A;  2A5C A;  1Y55 X;  1MK5 A;  2MF6 A;  1VWJ B;  1SWU A;  1LDQ A;  1VWM B;  1SRJ A;  2ZSC A;  5B5G A;  4BX5 B;  3VHI A;  2IZI A;  4CPF A;  4CPH B;  4BX7 B;  4DNE A;  1SRE A;  2UZ2 A;  1SWJ A;  5IRA A;  3WYQ A;  1SRI A;  1VYO A;  1SWH A;  2RTK A;  3RDO A;  1SWC A;  1SLF B;  4CPI A;  1VWR B;  1LUQ A;  2Y3E A;  2RTN B;  1VWB B;  2IZE B;  1RAV A;  5IRU A;  1NQM A;  2JGS A;  2A5B A;  4BX6 A;  1SRH A;  2RTF B;  1SWQ A;  5JD2 A;  2RTB B;  1NC9 A;  1HY2 A;  2RTP B;  3RDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...