1VWHB

Streptavidin complexed with the head-to-tail disulfide-bonded peptide dimer of cyclo-ac-[chpqgppc]-nh2, ph 3.5
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
121
structure length
121
Chain Sequence
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Complex (biotin-binding protein/peptide)
total genus 23
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 1997-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vwhB00
4BX6A 1LELA 3T2XA 2RTJA 1SRIA 1VWBB 2IZAA 2GH7A 1SWEA 2RTGB 5K68A 2IZIA 3RDUA 4BX6B 1Y53X 2F01A 3SZIA 4BX7B 5K67A 1VWRB 1VWKB 3RDOA 1SWCA 1VWMB 2RTIB 3RY1A 5IRWA 3EW1A 2MF6A 3PK2A 1LDQA 1RSUB 1RAVA 2IZGB 1LCWA 1SWLA 1PTSA 1N9YA 1VWAB 2CAMA 4GGTA 2IZBA 1STPA 1VWJB 1MM9A 4CPEA 2IZJA 3WZQA 1I9HA 4I60A 4BX5B 2A5CA 1HQQA 4Z2PA 4JNJA 4BCSA 1KL4A 3FDCA 4GJVA 2RTMA 4Z27A 2RTQB 4BX7A 1RSTB 1VWCB 2RTAA 3SZHA 1RXJA 1N7YA 1SWQA 2C1QA 2FHNX 1NC9A 1SRHA 4CPHA 4Z2VA 1VWQB 1AVDA 1STRB 2IZDB 4CPIA 2A8GA 1VWFB 4CPHB 2G5LA 4Z28A 3RDQA 1Y55X 2OF8A 3VGWA 3WYPA 3WYQA 3VHMA 4OKAA 4Y59A 1LDOA 3T6LA 1LCVA 4EKVA 4GDAA 3RY2A 1VWNB 4Y5DA 1MK5A 1VWOB 2IZEB 4GJSA 5JD2A 2OFAA 4BX5A 1VWLB 2A5BA 4JO6A 1N4JA 1SRJA 2RTLA 2Y3EA 4GGZA 1VWIB 3EW2A 3X00A 1N9MA 2IZLB 1SWHA 3RE5A 1SLGB 2Y32A 1HXZA 4DNEA 3RDXA 1SWKA 2C4IA 3MG5A 2RTRB 2RTKA 2RTNB 1MEPA 5CSEA 3VHIA 3WZNA 1SWSA 4GD9A 2UZ2A 4JHQA 5IRUA 1SRGA 1SWAA 1KL3A 1NQNA 5F2BA 2UYWA 1SWOA 1HXLA 1N43A 1SWTA 5IRAA 1RXHA 4CPFA 2AVIA 2IZKA 1SWNA 5L3YA 1STSB 4GGRA 1KFFA 4U46A 5B5FA 1SWUA 2FHLA 1KL5A 1SWBA 2IZCB 1SWRA 1SWPA 2BC3A 4Z2OA 1VYOA 1LUQA 2RTCB 1VWGB 2RTBB 1SLDB 4IRWA 1SWDA 2ZSCA 1SWJA 2RTOB 2QCBA 1SLEB 3VHHA 3WZPA 1RXKA 2RTPB 3RDMA 1IJ8A 1SRFA 1SLFB 1HY2A 4YVBA 1NQMA 1MOYA 5B5GA 3SZJA 2JGSA 1VWDB 1AVEA 5CHKA 1NBXA 3RE6A 3T2WA 4BBOA 2WPUA 2RTFB 4Z6JA 1SWGA 3T6FA 1Y52X 1VWHB 2RTDB 2Y3FA 2IZHB 1NDJA 1DF8A 1SWFA 1VWEB 2OFBA 2RTHB 3WZOA 1VWPB 4BJ8A 1LCZA 1WBIA 3RDSA 3MM0A 2OF9A 2C1SA 2RTEB 1SREA 2IZFB
chains in the Genus database with same CATH superfamily
1EW3A 1KT6A 3PPTA 1O8VA 1BSYA 5IO5A 3T2XA 3KQ0A 4ALOA 4FBVA 5H9NA 1KGLA 2N93A 4IABA 4ES7A 2WEXA 2WSJA 1JYJA 2JU3A 2KD2A 1QABE 4GH7A 1SWEA 4YKOA 3RDUA 4QGVA 5IO6A 5L8OA 5LJEA 1Y53X 5FENA 4YDAA 5KICA 2VFCA 5K67A 1VWRB 5AJBA 3RDOA 1SWCA 1BEBA 1BRPA 4HPBA 1E2TA 1Y9LA 2A3FX 5FQ7E 1ZNDA 3LV4A 3PK2A 4CDDA 2OY1O 3RWXA 1ADLA 4IAXA 1RAVA 3EC5A 3S60A 3ZUIA 1SWLA 1A3YA 2Q2MA 1N9YA 2HZQA 3O22A 3WJFA 4O3ZA 2K23A 2IZBA 1STPA 1VWJB 4EDEA 4CPEA 1X8PA 2IZJA 2AT3X 3HTYA 4OS3A 1HBPA 1SXWA 4WFVA 4Y0SA 2VFBA 2M4LA 5HTDA 5LJCA 4ARHA 3GAQA 2OVDA 3WJCA 4ZGUA 1KL4A 3BS2A 3FDCA 2RTMA 4I3CA 2RTQB 4O49A 5HCEC 1BWYA 1GXAA 2RTAA 3EBWA 1MVGA 1SXYA 4GKCA 3WJEA 1N7YA 1SWQA 2C1QA 4COTA 1NC9A 1YUPA 1JZUA 2A2UA 4M7MA 1T68X 1STRB 2GTFX 4CPIA 1NGLA 2KW1A 2G5LA 3CR6A 3PQUA 2X8FA 1X8NA 3D9WA 4OKAA 5H8TA 3C78X 4EKVA 1TW4A 3CWKA 3LHNA 1VWNB 4ZH9A 1A57A 5KHPA 3FELA 4GJSA 3B2JA 4YGZA 3D97A 1IKEA 5L8IA 1ICMA 1MUPA 1VWLB 4JO6A 3NBXX 1SRJA 4ZHDA 3FLLA 5F1EA 3N91A 3D4RA 1HQPA 2BHVA 3FEPA 5B10O 3UAQA 4BOEA 1EPBA 2CM4A 4GE1A 2X8SA 3RDXA 4Y0QA 5AJCA 3U9PC 2IFBA 4EFGA 2FRSA 4ORSA 2PY1A 1GX3A 2RTKA 1CBSA 2LB6A 3APUA 3FR4A 5EEEA 4KC7A 4L3RA 2R56A 3SAOA 3VHIA 4U3QA 5IRUA 3WZNA 1SWAA 1WUBA 2X45A 2FKJA 1KL3A 3VPJE 1W6FA 4HFOA 1HXLA 2OL6O 2PI3O 1SY1A 2MWHA 4NW4A 1E06A 3ZW2A 5IO7A 3FA9A 3NPOA 1JBHA 1KFFA 1A2DA 2Q2PA 3P6HA 4U46A 2VDFA 1SWUA 1PEEA 2FHLA 4CDCA 1GGLA 1BLRA 1X8OA 2AF5A 3P24A 3WJGA 4YH0A 3IFBA 4O4XA 1N0SA 1IKJA 3BU9A 4DQ4A 3P6EA 3BX7A 3BRNA 2ZSCA 1SWJA 1ML7A 5HAEA 1B0OA 3MX7A 4O9SA 2WR6A 3STKA 3ZUOA 1OEEA 1P6PA 3RDMA 3PQSA 1GT3A 3UEWA 1K24A 4AZRA 4IB9A 4O4OA 4YVBA 5LJKA 5D4AA 1MOYA 3P6FA 2MO5A 3P6GA 1QQSA 1AVEA 1VWDB 1NBXA 3VG5A 3ZQ3A 5HCCC 3NQKA 3HOEA 4I3DA 4AZQA 1OSPO 4MIRA 3EYCA 1K3BA 2RTDB 4KC8A 4ORUA 1LICA 2CZUA 2OFBA 2Z4HA 4BJ8A 2I5VO 4ODDA 1KQXA 4BVMA 3WXQA 3CKFA 3TGBA 2OF9A 1G85A 4JGLA 2CZTA 5LJHA 1AELA 2GTLO 4B55A 4ZHGA 1CRBA 4NNTA 4ORRA 1E02A 2IZAA 2RTGB 3AEHA 2JU8A 4MVEA 2IZIA 1A18A 4TLJA 3RSWA 1RBPA 3VG6A 1KT5A 2L67A 3IA8A 4BX7B 1KZXA 1TOUA 3C76X 4CDEA 4KH8A 4BQUA 3RY1A 4O4UA 1SY2A 2LKKA 5IRWA 3EW1A 4ALBA 1HMRA 4A1HA 5JR8A 1RSUB 3CQNA 3FR2A 2F09A 2OFMX 1UZ2X 1LNMA 1PTSA 4QYNA 4GGTA 1VPRA 1HMSA 4O3XB 1GT1A 3CBSA 2FLJA 1QFTA 1ICNA 2OL8O 2WWPA 1AB0A 2RQ0A 3B2IA 4YCEA 3B2KA 5D8JA 3WOVA 4BX5B 2A5CA 1E00A 1HQQA 1IW2A 2X46A 1DFVA 1KQWA 5HCDC 3B2HA 1OBPA 2BLGA 4Z27A 3U0DA 1JJXA 2QOSC 3G7XA 4QGXA 1YWCA 3FR5A 3SZHA 2FHNX 1PBOA 4CPHA 3V8UA 5AEOA 2AL0X 1AVDA 4FBOA 1D2UA 2ASNX 2JN3A 1SMPI 3JSQA 4ZHCA 4CPHB 1LIEA 2RCTA 2OFRX 2RD7C 2W2BA 3AUMO 4Y59A 1LDOA 4Y5DA 1MK5A 2IZEB 3ELXA 4QRLA 4O4SA 2NNQA 4FBRA 3L4RA 2OFAA 3RZYA 5B29A 5B2AO 2JU7A 3ZW0B 2A5BA 5BVTA 2OVSA 2Y3EA 4GGZA 3SLTA 1JMXA 3KVNA 1N9MA 5EEDA 3UEXA 1SWHA 1SLGB 2Y32A 1HXZA 4U8UM 3PEDA 4YFQA 3H3IA 1GM6A 1SWKA 3P6DA 3MG5A 3SLOA 4YGGA 5CSEA 2AKQA 1SWSA 4NV8A 1SRGA 4MEEA 2ACPX 1I4UA 1VYGA 1UREA 3B2LA 4HPDA 1NQNA 2UYWA 1SWOA 1EUOA 1N43A 1SWTA 4AZNA 2HLVA 3FEKA 3VE1A 2AVIA 2FGSA 2IZKA 4I95A 2FR2A 1STSB 1DZPA 4LZVA 5HZ5A 2QMIA 1TVQA 1JYDA 2JOZA 4U9CA 5B5FA 5D47A 5K06A 2CBSA 3CBCA 1D3SA 2Z4IA 4IBAA 2Q39A 1ZNGA 1KZWA 4WHIA 1FENA 2A2GA 4ZR2A 1SWPA 2E4JA 4YCHA 1VYOA 1LUQA 1UYNX 2BSZA 3FIQA 2POAA 2NNDA 3F6ZB 2OYBO 2RTOB 3BDRA 4EXZA 3OE3A 1HMTA 1SLEB 2GTLM 4OMWA 5C0NA 1I06A 4YFRA 1OPAA 1RXKA 1GX9A 3SOTA 1ZNHA 5D45A 1BSOA 3QQ2A 1G5WA 5B5GA 4Y0PA 3KFGA 4QQ1A 3SZJA 4HPAA 3EM0A 1FJ1E 1HBQA 5B11O 1EIOA 4Z6JA 3T6FA 4OS8A 3FIDA 4GNYA 4XMCA 4YKMA 3P02A 1S2PA 5HZ8A 3GE2A 1NDJA 1DF8A 3HWGA 5DG4A 3S5XA 3WZOA 1UYOX 1ZRYA 1AQBA 4IB6A 1LCZA 3HWEA 4TKJA 1BBPA 2Q4NA 4D6AA 1YP6A 2G78A 1GT4A 1TXLA 3FA6A 1JJUA 5F6ZA 4ZGFA 1CBIA 5BYPA 5LKEA 1FEMA 2FWVA 3NQ3A 4QYPA 4UU2A 3PP6A 1SA8A 1EPAA 1QG5A 1Z24A 1VWBB 3APXA 3P6CA 4I6SA 3VE2A 4PJ2A 2CM9A 4I9SA 1PMPA 3SZIA 2L5PA 1FE3A 2AT8X 4TNNA 1VWKB 3E3CA 4U8UN 1VWMB 2RTIB 1IFBA 4QZTA 4TQ2A 1G74A 2AT0X 3C77X 2MF6A 4CV7A 3Q6LA 1LDQA 2FS7A 2X56A 3STMX 2YMSA 4TKHA 1ALBA 1LCWA 1KT4A 3NADA 5LJGA 4CDFA 2CAMA 1VWAB 4NV7A 4A1YA 1MX7A 1ZNEA 2A13A 2GC9A 2L9CA 3WZQA 1I9HA 4I60A 1U18A 1OPBA 4TKBA 4L1NA 5FAZA 1DF3A 4GK9A 3JQOA 1EALA 2AT5X 4JNJA 1PBYA 5H9LA 4MISA 2QOMA 4BX7A 1JV4A 1RSTB 1VWCB 4NNSA 4DCBA 5HTEA 3LTWA 1RXJA 4NLIA 4Z2VA 2ALLX 1SRHA 2G7BA 4GZVA 1DV9A 4NLJA 1SXUA 5HA0A 2ZAIA 2A8GA 2DM5A 4Z28A 2I5ZO 4O3WA 3VGWA 2KTDA 3STNA 5EDCA 3VHMA 3APVA 1IIUA 3WYPA 4YDBA 3F8AA 2RN4A 2HZRA 4GDAA 4IMNA 1VWOB 4XMFA 5JD2A 1JMZA 3S26A 3WJDA 1EQDA 1NP4A 1VYFA 1MDCA 1X89A 2WQ9A 4OEMA 4BX5A 3D95A 1N4JA 2RTLA 1YWAA 3NX2A 3EW2A 4IMOA 3DTQA 3X00A 2IZLB 4GDZA 5HZ6A 5F58A 1W4TA 5L8NA 3QKGA 1LKEA 2MJIA 3TF6A 1B56A 3KFFA 4N7CA 3Q34A 2X8TA 4I9RA 4HPCA 2RTNB 3VG7A 1MEPA 4A8ZA 1YWBA 1XCAA 1E5PA 2G8CO 4GD9A 4JHQA 2DJFA 1S7DA 1TOWA 1L6MA 1LPJA 1W5RA 5F2BA 1BSQA 5HBSA 1I04A 2MM3A 5IRAA 1RXHA 3UEUA 1I78A 3DSZA 4IAWA 4O3YA 2KTSA 1YIVA 2ACOA 2AH7X 4GGRA 4AW8A 2LA7A 3ZW0A 2X34A 4ON1A 2X55A 5H9KA 3NQ9A 2FR3A 2P8GA 1LFOA 2DJGA 1ERBA 3AKMA 2IZCB 4MVIA 4R0BA 1SWRA 3VG4A 4ORXA 4Z2OA 1ACDA 3UEVA 4IRWA 2WEWA 3FW5A 5FQ6E 3D96A 4LZUA 3TGAA 1DZMA 5HZ9A 1JJJA 4YBPA 2HKDA 1BM5A 2RTPB 5LJBA 4WBKA 1SRFA 1XKIA 2W2FA 3CMPA 1SLFB 3NX1A 1JIWI 4CSBA 2NP1A 2WQAE 5FFHA 5AQ6A 1O1UA 2LFOA 2YG2A 2XSTA 3VG2A 5EZ2A 2JGSA 2OVEA 5CHKA 3ZW1A 4C5PA 2X32A 2LBAA 3FA7A 2WPUA 1GX8A 4LKTA 2OY5O 1H91A 1Y0GA 3K3LA 3ZW1B 3KFHA 5EPQA 1Y52X 1Y9TA 3NP1A 1VWHB 4D6BA 2GJ5A 1OBQA 1MX8A 1YP7A 1VWEB 2X4MA 2K62A 4WFUA 1WBIA 3RDSA 1SY0A 4AZMA 2OL7A 1X8UA 4K19A 2C1SA 2F73A 2RTEB 3FMZA 2EU7X 4ML7B 2QO6A 3ZI8A 3CQRA 4NYQA 1KXOA 2FKGA 2G79A 1LELA 4QZUA 4BX6A 2QO5A 4OELA 2RTJA 1EI5A 1SRIA 2QO4A 1G7NA 5F6BA 3WBGA 2GH7A 4BX6B 1BRQA 5K68A 2BT9A 2F01A 3RBYA 4AZOA 1GKAA 4OMXA 1RLBE 4PSQA 4QNIA 5KIDA 3SLJA 1I05A 1CJ5A 2BS6A 1NP1A 4RUNA 3JS1A 1R0UA 5DPQA 1GKAB 1X71A 4ZHFA 4ZH6A 2CBRA 2IZGB 3O2YA 1DC9A 4YMYA 3HK1A 1ZNLA 4A60A 2AT6X 3EBKA 1MM9A 2FT9A 3WVMA 1LIFA 1PM1X 5CYBA 2WUTA 2R73A 1SXXA 4NYRA 3PH6A 4YGHA 5HWZA 3ZWEA 1LIDA 4BCSA 1QFVA 3S5VA 5H9AA 4IB8A 4EEJA 4Z2PA 1OBUA 4KT5A 4GJVA 4N7DA 4DQ3A 4XMDA 1ERXA 1KT7A 3APWA 3BU1A 3MBTA 4ZJ0A 5LJDA 1O1VA 2XKLA 2RA6A 1VWQB 3OBLA 2FS6A 1LIBA 5B27A 3VU1A 4I3BA 2JW1A 1OEJA 1AVGI 2IZDB 2KT4B 1YWDA 2R74A 1EXSA 1FTPA 1VWFB 1T0VA 4GNWA 3RDQA 1Y55X 2OF8A 3HPEA 3I17A 3FW4A 2Q9SA 3MVFA 4FQBB 4ID2A 3WYQA 3FA8A 3T6LA 1LCVA 3RY2A 4QGWA 4RUUA 2L68A 4ZFXA 4TJZA 1CBRA 1KT3A 1S44A 3F9DA 5B3MO 2LBVA 4U8UO 2AMMX 1VWIB 3U03A 5HZQA 1BJ7A 1FELA 1B8EA 1SY3A 4GUZA 1X8QA 5LKFA 4CK4A 3RE5A 3I0AA 3BLGA 4KIIA 2OY8A 4DNEA 3HWFA 3FENA 3RKGA 4IB7A 2C4IA 4UU3A 1QY2A 1QY0A 4Y0RA 2RTRB 3PH5A 3ELZA 3KFIA 1CBQA 1T8VA 4NP1A 1IFCA 2UZ2A 2OY7A 3PECA 4HWMA 4BGFA 3BSZE 1JQPA 2HYSA 4YBUA 3T1DA 2GTLN 3ZZVA 2JMBA 1DZJA 3FYFA 1QY1A 3OJYC 1SWNA 4QAEA 5D48A 2O62A 4CPFA 5L3YA 4ZHHA 4OS0A 4XMGA 5F7GA 2OVAA 1ZNKA 3NR3A 4XMHA 2NNEA 4KCAA 1KL5A 1SWBA 3TGCA 2A0AA 2RCQA 3VG3A 4GRJA 2BC3A 3CKGA 5FQ8E 3BX8A 2RTCB 2RTBB 1VWGB 1SLDB 1HN2A 2MHDA 3OD9A 2W2AA 1SWDA 3BY0A 2QCBA 4ORYA 4XMEA 3VHHA 3WZPA 1KOIA 4INNA 4GU8A 3EMMA 3O19A 4GETA 1IJ8A 3HWDA 5IXGA 3KZAA 3TZSA 4EQAC 4AYHA 1HY2A 1QWDA 4MVLA 1NQMA 3WJBA 2BS5A 5CE4A 4ZCBA 2OZQA 3RE6A 4BBOA 3T2WA 4ORWA 1U17A 4FGIB 2RTFB 2HNXA 1SWGA 1OEKA 1U0XA 2HMBA 2QM9A 4LKPA 1DZKA 1GT5A 2IZHB 3HOLA 3PDFA 4MVKA 5BVSA 1SWFA 2RTHB 4LQZA 1B4MA 1EIIA 1VWPB 4M6SA 1FDQA 5BVQA 4AZPA 2FTBA 2ZAGA 3MM0A 2ANSA 5EDBA 3AKNA 1LF7A 4YFPA 5HA1A 2Y3FA 1SREA 2IZFB
chains in the Genus database with same CATH topology
4BX6A 1LELA 3T2XA 2RTJA 1SRIA 1VWBB 2IZAA 2GH7A 1SWEA 2RTGB 5K68A 2IZIA 3RDUA 4BX6B 1Y53X 2F01A 3SZIA 4BX7B 5K67A 1VWRB 1VWKB 3RDOA 1SWCA 1VWMB 2RTIB 3RY1A 5IRWA 3EW1A 2MF6A 3PK2A 1LDQA 1RSUB 1RAVA 2IZGB 1LCWA 1SWLA 1PTSA 1N9YA 1VWAB 2CAMA 4GGTA 2IZBA 1STPA 1VWJB 1MM9A 4CPEA 2IZJA 3WZQA 1I9HA 4I60A 4BX5B 2A5CA 1HQQA 4Z2PA 4JNJA 4BCSA 1KL4A 3FDCA 4GJVA 2RTMA 4Z27A 2RTQB 4BX7A 1RSTB 1VWCB 2RTAA 3SZHA 1RXJA 1N7YA 1SWQA 2C1QA 2FHNX 1NC9A 1SRHA 4CPHA 4Z2VA 1VWQB 1AVDA 1STRB 2IZDB 4CPIA 2A8GA 1VWFB 4CPHB 2G5LA 4Z28A 3RDQA 1Y55X 2OF8A 3VGWA 3WYPA 3WYQA 3VHMA 4OKAA 4Y59A 1LDOA 3T6LA 1LCVA 4EKVA 4GDAA 3RY2A 1VWNB 4Y5DA 1MK5A 1VWOB 2IZEB 4GJSA 5JD2A 2OFAA 4BX5A 1VWLB 2A5BA 4JO6A 1N4JA 1SRJA 2RTLA 2Y3EA 4GGZA 1VWIB 3EW2A 3X00A 1N9MA 2IZLB 1SWHA 3RE5A 1SLGB 2Y32A 1HXZA 4DNEA 3RDXA 1SWKA 2C4IA 3MG5A 2RTRB 2RTKA 2RTNB 1MEPA 5CSEA 3VHIA 3WZNA 1SWSA 4GD9A 2UZ2A 4JHQA 5IRUA 1SRGA 1SWAA 1KL3A 1NQNA 5F2BA 2UYWA 1SWOA 1HXLA 1N43A 1SWTA 5IRAA 1RXHA 4CPFA 2AVIA 2IZKA 1SWNA 5L3YA 1STSB 4GGRA 1KFFA 4U46A 5B5FA 1SWUA 2FHLA 1KL5A 1SWBA 2IZCB 1SWRA 1SWPA 2BC3A 4Z2OA 1VYOA 1LUQA 2RTCB 1VWGB 2RTBB 1SLDB 4IRWA 1SWDA 2ZSCA 1SWJA 2RTOB 2QCBA 1SLEB 3VHHA 3WZPA 1RXKA 2RTPB 3RDMA 1IJ8A 1SRFA 1SLFB 1HY2A 4YVBA 1NQMA 1MOYA 5B5GA 3SZJA 2JGSA 1VWDB 1AVEA 5CHKA 1NBXA 3RE6A 3T2WA 4BBOA 2WPUA 2RTFB 4Z6JA 1SWGA 3T6FA 1Y52X 1VWHB 2RTDB 2Y3FA 2IZHB 1NDJA 1DF8A 1SWFA 1VWEB 2OFBA 2RTHB 3WZOA 1VWPB 4BJ8A 1LCZA 1WBIA 3RDSA 3MM0A 2OF9A 2C1SA 2RTEB 1SREA 2IZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BX6 A;  1LEL A;  3T2X A;  2RTJ A;  1SRI A;  1VWB B;  2IZA A;  2GH7 A;  1SWE A;  2RTG B;  5K68 A;  2IZI A;  3RDU A;  4BX6 B;  1Y53 X;  2F01 A;  3SZI A;  4BX7 B;  5K67 A;  1VWR B;  1VWK B;  3RDO A;  1SWC A;  1VWM B;  2RTI B;  3RY1 A;  5IRW A;  3EW1 A;  2MF6 A;  3PK2 A;  1LDQ A;  1RSU B;  1RAV A;  2IZG B;  1LCW A;  1SWL A;  1PTS A;  1N9Y A;  1VWA B;  2CAM A;  4GGT A;  2IZB A;  1STP A;  1VWJ B;  1MM9 A;  4CPE A;  2IZJ A;  3WZQ A;  1I9H A;  4I60 A;  4BX5 B;  2A5C A;  1HQQ A;  4Z2P A;  4JNJ A;  4BCS A;  1KL4 A;  3FDC A;  4GJV A;  2RTM A;  4Z27 A;  2RTQ B;  4BX7 A;  1RST B;  1VWC B;  2RTA A;  3SZH A;  1RXJ A;  1N7Y A;  1SWQ A;  2C1Q A;  2FHN X;  1NC9 A;  1SRH A;  4CPH A;  4Z2V A;  1VWQ B;  1AVD A;  1STR B;  2IZD B;  4CPI A;  2A8G A;  1VWF B;  4CPH B;  2G5L A;  4Z28 A;  3RDQ A;  1Y55 X;  2OF8 A;  3VGW A;  3WYP A;  3WYQ A;  3VHM A;  4OKA A;  4Y59 A;  1LDO A;  3T6L A;  1LCV A;  4EKV A;  4GDA A;  3RY2 A;  1VWN B;  4Y5D A;  1MK5 A;  1VWO B;  2IZE B;  4GJS A;  5JD2 A;  2OFA A;  4BX5 A;  1VWL B;  2A5B A;  4JO6 A;  1N4J A;  1SRJ A;  2RTL A;  2Y3E A;  4GGZ A;  1VWI B;  3EW2 A;  3X00 A;  1N9M A;  2IZL B;  1SWH A;  3RE5 A;  1SLG B;  2Y32 A;  1HXZ A;  4DNE A;  3RDX A;  1SWK A;  2C4I A;  3MG5 A;  2RTR B;  2RTK A;  2RTN B;  1MEP A;  5CSE A;  3VHI A;  3WZN A;  1SWS A;  4GD9 A;  2UZ2 A;  4JHQ A;  5IRU A;  1SRG A;  1SWA A;  1KL3 A;  1NQN A;  5F2B A;  2UYW A;  1SWO A;  1HXL A;  1N43 A;  1SWT A;  5IRA A;  1RXH A;  4CPF A;  2AVI A;  2IZK A;  1SWN A;  5L3Y A;  1STS B;  4GGR A;  1KFF A;  4U46 A;  5B5F A;  1SWU A;  2FHL A;  1KL5 A;  1SWB A;  2IZC B;  1SWR A;  1SWP A;  2BC3 A;  4Z2O A;  1VYO A;  1LUQ A;  2RTC B;  1VWG B;  2RTB B;  1SLD B;  4IRW A;  1SWD A;  2ZSC A;  1SWJ A;  2RTO B;  2QCB A;  1SLE B;  3VHH A;  3WZP A;  1RXK A;  2RTP B;  3RDM A;  1IJ8 A;  1SRF A;  1SLF B;  1HY2 A;  4YVB A;  1NQM A;  1MOY A;  5B5G A;  3SZJ A;  2JGS A;  1VWD B;  1AVE A;  5CHK A;  1NBX A;  3RE6 A;  3T2W A;  4BBO A;  2WPU A;  2RTF B;  4Z6J A;  1SWG A;  3T6F A;  1Y52 X;  1VWH B;  2RTD B;  2Y3F A;  2IZH B;  1NDJ A;  1DF8 A;  1SWF A;  1VWE B;  2OFB A;  2RTH B;  3WZO A;  1VWP B;  4BJ8 A;  1LCZ A;  1WBI A;  3RDS A;  3MM0 A;  2OF9 A;  2C1S A;  2RTE B;  1SRE A;  2IZF B; 
#chains in the Genus database with same CATH topology
 1EW3 A;  1KT6 A;  3PPT A;  1O8V A;  1BSY A;  5IO5 A;  3T2X A;  3KQ0 A;  4ALO A;  4FBV A;  5H9N A;  1KGL A;  2N93 A;  4IAB A;  4ES7 A;  2WEX A;  2WSJ A;  1JYJ A;  2JU3 A;  2KD2 A;  1QAB E;  4GH7 A;  1SWE A;  4YKO A;  3RDU A;  4QGV A;  5IO6 A;  5L8O A;  5LJE A;  1Y53 X;  5FEN A;  4YDA A;  5KIC A;  2VFC A;  5K67 A;  1VWR B;  5AJB A;  3RDO A;  1SWC A;  1BEB A;  1BRP A;  4HPB A;  1E2T A;  1Y9L A;  2A3F X;  5FQ7 E;  1ZND A;  3LV4 A;  3PK2 A;  4CDD A;  2OY1 O;  3RWX A;  1ADL A;  4IAX A;  1RAV A;  3EC5 A;  3S60 A;  3ZUI A;  1SWL A;  1A3Y A;  2Q2M A;  1N9Y A;  2HZQ A;  3O22 A;  3WJF A;  4O3Z A;  2K23 A;  2IZB A;  1STP A;  1VWJ B;  4EDE A;  4CPE A;  1X8P A;  2IZJ A;  2AT3 X;  3HTY A;  4OS3 A;  1HBP A;  1SXW A;  4WFV A;  4Y0S A;  2VFB A;  2M4L A;  5HTD A;  5LJC A;  4ARH A;  3GAQ A;  2OVD A;  3WJC A;  4ZGU A;  1KL4 A;  3BS2 A;  3FDC A;  2RTM A;  4I3C A;  2RTQ B;  4O49 A;  5HCE C;  1BWY A;  1GXA A;  2RTA A;  3EBW A;  1MVG A;  1SXY A;  4GKC A;  3WJE A;  1N7Y A;  1SWQ A;  2C1Q A;  4COT A;  1NC9 A;  1YUP A;  1JZU A;  2A2U A;  4M7M A;  1T68 X;  1STR B;  2GTF X;  4CPI A;  1NGL A;  2KW1 A;  2G5L A;  3CR6 A;  3PQU A;  2X8F A;  1X8N A;  3D9W A;  4OKA A;  5H8T A;  3C78 X;  4EKV A;  1TW4 A;  3CWK A;  3LHN A;  1VWN B;  4ZH9 A;  1A57 A;  5KHP A;  3FEL A;  4GJS A;  3B2J A;  4YGZ A;  3D97 A;  1IKE A;  5L8I A;  1ICM A;  1MUP A;  1VWL B;  4JO6 A;  3NBX X;  1SRJ A;  4ZHD A;  3FLL A;  5F1E A;  3N91 A;  3D4R A;  1HQP A;  2BHV A;  3FEP A;  5B10 O;  3UAQ A;  4BOE A;  1EPB A;  2CM4 A;  4GE1 A;  2X8S A;  3RDX A;  4Y0Q A;  5AJC A;  3U9P C;  2IFB A;  4EFG A;  2FRS A;  4ORS A;  2PY1 A;  1GX3 A;  2RTK A;  1CBS A;  2LB6 A;  3APU A;  3FR4 A;  5EEE A;  4KC7 A;  4L3R A;  2R56 A;  3SAO A;  3VHI A;  4U3Q A;  5IRU A;  3WZN A;  1SWA A;  1WUB A;  2X45 A;  2FKJ A;  1KL3 A;  3VPJ E;  1W6F A;  4HFO A;  1HXL A;  2OL6 O;  2PI3 O;  1SY1 A;  2MWH A;  4NW4 A;  1E06 A;  3ZW2 A;  5IO7 A;  3FA9 A;  3NPO A;  1JBH A;  1KFF A;  1A2D A;  2Q2P A;  3P6H A;  4U46 A;  2VDF A;  1SWU A;  1PEE A;  2FHL A;  4CDC A;  1GGL A;  1BLR A;  1X8O A;  2AF5 A;  3P24 A;  3WJG A;  4YH0 A;  3IFB A;  4O4X A;  1N0S A;  1IKJ A;  3BU9 A;  4DQ4 A;  3P6E A;  3BX7 A;  3BRN A;  2ZSC A;  1SWJ A;  1ML7 A;  5HAE A;  1B0O A;  3MX7 A;  4O9S A;  2WR6 A;  3STK A;  3ZUO A;  1OEE A;  1P6P A;  3RDM A;  3PQS A;  1GT3 A;  3UEW A;  1K24 A;  4AZR A;  4IB9 A;  4O4O A;  4YVB A;  5LJK A;  5D4A A;  1MOY A;  3P6F A;  2MO5 A;  3P6G A;  1QQS A;  1AVE A;  1VWD B;  1NBX A;  3VG5 A;  3ZQ3 A;  5HCC C;  3NQK A;  3HOE A;  4I3D A;  4AZQ A;  1OSP O;  4MIR A;  3EYC A;  1K3B A;  2RTD B;  4KC8 A;  4ORU A;  1LIC A;  2CZU A;  2OFB A;  2Z4H A;  4BJ8 A;  2I5V O;  4ODD A;  1KQX A;  4BVM A;  3WXQ A;  3CKF A;  3TGB A;  2OF9 A;  1G85 A;  4JGL A;  2CZT A;  5LJH A;  1AEL A;  2GTL O;  4B55 A;  4ZHG A;  1CRB A;  4NNT A;  4ORR A;  1E02 A;  2IZA A;  2RTG B;  3AEH A;  2JU8 A;  4MVE A;  2IZI A;  1A18 A;  4TLJ A;  3RSW A;  1RBP A;  3VG6 A;  1KT5 A;  2L67 A;  3IA8 A;  4BX7 B;  1KZX A;  1TOU A;  3C76 X;  4CDE A;  4KH8 A;  4BQU A;  3RY1 A;  4O4U A;  1SY2 A;  2LKK A;  5IRW A;  3EW1 A;  4ALB A;  1HMR A;  4A1H A;  5JR8 A;  1RSU B;  3CQN A;  3FR2 A;  2F09 A;  2OFM X;  1UZ2 X;  1LNM A;  1PTS A;  4QYN A;  4GGT A;  1VPR A;  1HMS A;  4O3X B;  1GT1 A;  3CBS A;  2FLJ A;  1QFT A;  1ICN A;  2OL8 O;  2WWP A;  1AB0 A;  2RQ0 A;  3B2I A;  4YCE A;  3B2K A;  5D8J A;  3WOV A;  4BX5 B;  2A5C A;  1E00 A;  1HQQ A;  1IW2 A;  2X46 A;  1DFV A;  1KQW A;  5HCD C;  3B2H A;  1OBP A;  2BLG A;  4Z27 A;  3U0D A;  1JJX A;  2QOS C;  3G7X A;  4QGX A;  1YWC A;  3FR5 A;  3SZH A;  2FHN X;  1PBO A;  4CPH A;  3V8U A;  5AEO A;  2AL0 X;  1AVD A;  4FBO A;  1D2U A;  2ASN X;  2JN3 A;  1SMP I;  3JSQ A;  4ZHC A;  4CPH B;  1LIE A;  2RCT A;  2OFR X;  2RD7 C;  2W2B A;  3AUM O;  4Y59 A;  1LDO A;  4Y5D A;  1MK5 A;  2IZE B;  3ELX A;  4QRL A;  4O4S A;  2NNQ A;  4FBR A;  3L4R A;  2OFA A;  3RZY A;  5B29 A;  5B2A O;  2JU7 A;  3ZW0 B;  2A5B A;  5BVT A;  2OVS A;  2Y3E A;  4GGZ A;  3SLT A;  1JMX A;  3KVN A;  1N9M A;  5EED A;  3UEX A;  1SWH A;  1SLG B;  2Y32 A;  1HXZ A;  4U8U M;  3PED A;  4YFQ A;  3H3I A;  1GM6 A;  1SWK A;  3P6D A;  3MG5 A;  3SLO A;  4YGG A;  5CSE A;  2AKQ A;  1SWS A;  4NV8 A;  1SRG A;  4MEE A;  2ACP X;  1I4U A;  1VYG A;  1URE A;  3B2L A;  4HPD A;  1NQN A;  2UYW A;  1SWO A;  1EUO A;  1N43 A;  1SWT A;  4AZN A;  2HLV A;  3FEK A;  3VE1 A;  2AVI A;  2FGS A;  2IZK A;  4I95 A;  2FR2 A;  1STS B;  1DZP A;  4LZV A;  5HZ5 A;  2QMI A;  1TVQ A;  1JYD A;  2JOZ A;  4U9C A;  5B5F A;  5D47 A;  5K06 A;  2CBS A;  3CBC A;  1D3S A;  2Z4I A;  4IBA A;  2Q39 A;  1ZNG A;  1KZW A;  4WHI A;  1FEN A;  2A2G A;  4ZR2 A;  1SWP A;  2E4J A;  4YCH A;  1VYO A;  1LUQ A;  1UYN X;  2BSZ A;  3FIQ A;  2POA A;  2NND A;  3F6Z B;  2OYB O;  2RTO B;  3BDR A;  4EXZ A;  3OE3 A;  1HMT A;  1SLE B;  2GTL M;  4OMW A;  5C0N A;  1I06 A;  4YFR A;  1OPA A;  1RXK A;  1GX9 A;  3SOT A;  1ZNH A;  5D45 A;  1BSO A;  3QQ2 A;  1G5W A;  5B5G A;  4Y0P A;  3KFG A;  4QQ1 A;  3SZJ A;  4HPA A;  3EM0 A;  1FJ1 E;  1HBQ A;  5B11 O;  1EIO A;  4Z6J A;  3T6F A;  4OS8 A;  3FID A;  4GNY A;  4XMC A;  4YKM A;  3P02 A;  1S2P A;  5HZ8 A;  3GE2 A;  1NDJ A;  1DF8 A;  3HWG A;  5DG4 A;  3S5X A;  3WZO A;  1UYO X;  1ZRY A;  1AQB A;  4IB6 A;  1LCZ A;  3HWE A;  4TKJ A;  1BBP A;  2Q4N A;  4D6A A;  1YP6 A;  2G78 A;  1GT4 A;  1TXL A;  3FA6 A;  1JJU A;  5F6Z A;  4ZGF A;  1CBI A;  5BYP A;  5LKE A;  1FEM A;  2FWV A;  3NQ3 A;  4QYP A;  4UU2 A;  3PP6 A;  1SA8 A;  1EPA A;  1QG5 A;  1Z24 A;  1VWB B;  3APX A;  3P6C A;  4I6S A;  3VE2 A;  4PJ2 A;  2CM9 A;  4I9S A;  1PMP A;  3SZI A;  2L5P A;  1FE3 A;  2AT8 X;  4TNN A;  1VWK B;  3E3C A;  4U8U N;  1VWM B;  2RTI B;  1IFB A;  4QZT A;  4TQ2 A;  1G74 A;  2AT0 X;  3C77 X;  2MF6 A;  4CV7 A;  3Q6L A;  1LDQ A;  2FS7 A;  2X56 A;  3STM X;  2YMS A;  4TKH A;  1ALB A;  1LCW A;  1KT4 A;  3NAD A;  5LJG A;  4CDF A;  2CAM A;  1VWA B;  4NV7 A;  4A1Y A;  1MX7 A;  1ZNE A;  2A13 A;  2GC9 A;  2L9C A;  3WZQ A;  1I9H A;  4I60 A;  1U18 A;  1OPB A;  4TKB A;  4L1N A;  5FAZ A;  1DF3 A;  4GK9 A;  3JQO A;  1EAL A;  2AT5 X;  4JNJ A;  1PBY A;  5H9L A;  4MIS A;  2QOM A;  4BX7 A;  1JV4 A;  1RST B;  1VWC B;  4NNS A;  4DCB A;  5HTE A;  3LTW A;  1RXJ A;  4NLI A;  4Z2V A;  2ALL X;  1SRH A;  2G7B A;  4GZV A;  1DV9 A;  4NLJ A;  1SXU A;  5HA0 A;  2ZAI A;  2A8G A;  2DM5 A;  4Z28 A;  2I5Z O;  4O3W A;  3VGW A;  2KTD A;  3STN A;  5EDC A;  3VHM A;  3APV A;  1IIU A;  3WYP A;  4YDB A;  3F8A A;  2RN4 A;  2HZR A;  4GDA A;  4IMN A;  1VWO B;  4XMF A;  5JD2 A;  1JMZ A;  3S26 A;  3WJD A;  1EQD A;  1NP4 A;  1VYF A;  1MDC A;  1X89 A;  2WQ9 A;  4OEM A;  4BX5 A;  3D95 A;  1N4J A;  2RTL A;  1YWA A;  3NX2 A;  3EW2 A;  4IMO A;  3DTQ A;  3X00 A;  2IZL B;  4GDZ A;  5HZ6 A;  5F58 A;  1W4T A;  5L8N A;  3QKG A;  1LKE A;  2MJI A;  3TF6 A;  1B56 A;  3KFF A;  4N7C A;  3Q34 A;  2X8T A;  4I9R A;  4HPC A;  2RTN B;  3VG7 A;  1MEP A;  4A8Z A;  1YWB A;  1XCA A;  1E5P A;  2G8C O;  4GD9 A;  4JHQ A;  2DJF A;  1S7D A;  1TOW A;  1L6M A;  1LPJ A;  1W5R A;  5F2B A;  1BSQ A;  5HBS A;  1I04 A;  2MM3 A;  5IRA A;  1RXH A;  3UEU A;  1I78 A;  3DSZ A;  4IAW A;  4O3Y A;  2KTS A;  1YIV A;  2ACO A;  2AH7 X;  4GGR A;  4AW8 A;  2LA7 A;  3ZW0 A;  2X34 A;  4ON1 A;  2X55 A;  5H9K A;  3NQ9 A;  2FR3 A;  2P8G A;  1LFO A;  2DJG A;  1ERB A;  3AKM A;  2IZC B;  4MVI A;  4R0B A;  1SWR A;  3VG4 A;  4ORX A;  4Z2O A;  1ACD A;  3UEV A;  4IRW A;  2WEW A;  3FW5 A;  5FQ6 E;  3D96 A;  4LZU A;  3TGA A;  1DZM A;  5HZ9 A;  1JJJ A;  4YBP A;  2HKD A;  1BM5 A;  2RTP B;  5LJB A;  4WBK A;  1SRF A;  1XKI A;  2W2F A;  3CMP A;  1SLF B;  3NX1 A;  1JIW I;  4CSB A;  2NP1 A;  2WQA E;  5FFH A;  5AQ6 A;  1O1U A;  2LFO A;  2YG2 A;  2XST A;  3VG2 A;  5EZ2 A;  2JGS A;  2OVE A;  5CHK A;  3ZW1 A;  4C5P A;  2X32 A;  2LBA A;  3FA7 A;  2WPU A;  1GX8 A;  4LKT A;  2OY5 O;  1H91 A;  1Y0G A;  3K3L A;  3ZW1 B;  3KFH A;  5EPQ A;  1Y52 X;  1Y9T A;  3NP1 A;  1VWH B;  4D6B A;  2GJ5 A;  1OBQ A;  1MX8 A;  1YP7 A;  1VWE B;  2X4M A;  2K62 A;  4WFU A;  1WBI A;  3RDS A;  1SY0 A;  4AZM A;  2OL7 A;  1X8U A;  4K19 A;  2C1S A;  2F73 A;  2RTE B;  3FMZ A;  2EU7 X;  4ML7 B;  2QO6 A;  3ZI8 A;  3CQR A;  4NYQ A;  1KXO A;  2FKG A;  2G79 A;  1LEL A;  4QZU A;  4BX6 A;  2QO5 A;  4OEL A;  2RTJ A;  1EI5 A;  1SRI A;  2QO4 A;  1G7N A;  5F6B A;  3WBG A;  2GH7 A;  4BX6 B;  1BRQ A;  5K68 A;  2BT9 A;  2F01 A;  3RBY A;  4AZO A;  1GKA A;  4OMX A;  1RLB E;  4PSQ A;  4QNI A;  5KID A;  3SLJ A;  1I05 A;  1CJ5 A;  2BS6 A;  1NP1 A;  4RUN A;  3JS1 A;  1R0U A;  5DPQ A;  1GKA B;  1X71 A;  4ZHF A;  4ZH6 A;  2CBR A;  2IZG B;  3O2Y A;  1DC9 A;  4YMY A;  3HK1 A;  1ZNL A;  4A60 A;  2AT6 X;  3EBK A;  1MM9 A;  2FT9 A;  3WVM A;  1LIF A;  1PM1 X;  5CYB A;  2WUT A;  2R73 A;  1SXX A;  4NYR A;  3PH6 A;  4YGH A;  5HWZ A;  3ZWE A;  1LID A;  4BCS A;  1QFV A;  3S5V A;  5H9A A;  4IB8 A;  4EEJ A;  4Z2P A;  1OBU A;  4KT5 A;  4GJV A;  4N7D A;  4DQ3 A;  4XMD A;  1ERX A;  1KT7 A;  3APW A;  3BU1 A;  3MBT A;  4ZJ0 A;  5LJD A;  1O1V A;  2XKL A;  2RA6 A;  1VWQ B;  3OBL A;  2FS6 A;  1LIB A;  5B27 A;  3VU1 A;  4I3B A;  2JW1 A;  1OEJ A;  1AVG I;  2IZD B;  2KT4 B;  1YWD A;  2R74 A;  1EXS A;  1FTP A;  1VWF B;  1T0V A;  4GNW A;  3RDQ A;  1Y55 X;  2OF8 A;  3HPE A;  3I17 A;  3FW4 A;  2Q9S A;  3MVF A;  4FQB B;  4ID2 A;  3WYQ A;  3FA8 A;  3T6L A;  1LCV A;  3RY2 A;  4QGW A;  4RUU A;  2L68 A;  4ZFX A;  4TJZ A;  1CBR A;  1KT3 A;  1S44 A;  3F9D A;  5B3M O;  2LBV A;  4U8U O;  2AMM X;  1VWI B;  3U03 A;  5HZQ A;  1BJ7 A;  1FEL A;  1B8E A;  1SY3 A;  4GUZ A;  1X8Q A;  5LKF A;  4CK4 A;  3RE5 A;  3I0A A;  3BLG A;  4KII A;  2OY8 A;  4DNE A;  3HWF A;  3FEN A;  3RKG A;  4IB7 A;  2C4I A;  4UU3 A;  1QY2 A;  1QY0 A;  4Y0R A;  2RTR B;  3PH5 A;  3ELZ A;  3KFI A;  1CBQ A;  1T8V A;  4NP1 A;  1IFC A;  2UZ2 A;  2OY7 A;  3PEC A;  4HWM A;  4BGF A;  3BSZ E;  1JQP A;  2HYS A;  4YBU A;  3T1D A;  2GTL N;  3ZZV A;  2JMB A;  1DZJ A;  3FYF A;  1QY1 A;  3OJY C;  1SWN A;  4QAE A;  5D48 A;  2O62 A;  4CPF A;  5L3Y A;  4ZHH A;  4OS0 A;  4XMG A;  5F7G A;  2OVA A;  1ZNK A;  3NR3 A;  4XMH A;  2NNE A;  4KCA A;  1KL5 A;  1SWB A;  3TGC A;  2A0A A;  2RCQ A;  3VG3 A;  4GRJ A;  2BC3 A;  3CKG A;  5FQ8 E;  3BX8 A;  2RTC B;  2RTB B;  1VWG B;  1SLD B;  1HN2 A;  2MHD A;  3OD9 A;  2W2A A;  1SWD A;  3BY0 A;  2QCB A;  4ORY A;  4XME A;  3VHH A;  3WZP A;  1KOI A;  4INN A;  4GU8 A;  3EMM A;  3O19 A;  4GET A;  1IJ8 A;  3HWD A;  5IXG A;  3KZA A;  3TZS A;  4EQA C;  4AYH A;  1HY2 A;  1QWD A;  4MVL A;  1NQM A;  3WJB A;  2BS5 A;  5CE4 A;  4ZCB A;  2OZQ A;  3RE6 A;  4BBO A;  3T2W A;  4ORW A;  1U17 A;  4FGI B;  2RTF B;  2HNX A;  1SWG A;  1OEK A;  1U0X A;  2HMB A;  2QM9 A;  4LKP A;  1DZK A;  1GT5 A;  2IZH B;  3HOL A;  3PDF A;  4MVK A;  5BVS A;  1SWF A;  2RTH B;  4LQZ A;  1B4M A;  1EII A;  1VWP B;  4M6S A;  1FDQ A;  5BVQ A;  4AZP A;  2FTB A;  2ZAG A;  3MM0 A;  2ANS A;  5EDB A;  3AKN A;  1LF7 A;  4YFP A;  5HA1 A;  2Y3F A;  1SRE A;  2IZF B; 
#chains in the Genus database with same CATH homology
 4BX6 A;  1LEL A;  3T2X A;  2RTJ A;  1SRI A;  1VWB B;  2IZA A;  2GH7 A;  1SWE A;  2RTG B;  5K68 A;  2IZI A;  3RDU A;  4BX6 B;  1Y53 X;  2F01 A;  3SZI A;  4BX7 B;  5K67 A;  1VWR B;  1VWK B;  3RDO A;  1SWC A;  1VWM B;  2RTI B;  3RY1 A;  5IRW A;  3EW1 A;  2MF6 A;  3PK2 A;  1LDQ A;  1RSU B;  1RAV A;  2IZG B;  1LCW A;  1SWL A;  1PTS A;  1N9Y A;  1VWA B;  2CAM A;  4GGT A;  2IZB A;  1STP A;  1VWJ B;  1MM9 A;  4CPE A;  2IZJ A;  3WZQ A;  1I9H A;  4I60 A;  4BX5 B;  2A5C A;  1HQQ A;  4Z2P A;  4JNJ A;  4BCS A;  1KL4 A;  3FDC A;  4GJV A;  2RTM A;  4Z27 A;  2RTQ B;  4BX7 A;  1RST B;  1VWC B;  2RTA A;  3SZH A;  1RXJ A;  1N7Y A;  1SWQ A;  2C1Q A;  2FHN X;  1NC9 A;  1SRH A;  4CPH A;  4Z2V A;  1VWQ B;  1AVD A;  1STR B;  2IZD B;  4CPI A;  2A8G A;  1VWF B;  4CPH B;  2G5L A;  4Z28 A;  3RDQ A;  1Y55 X;  2OF8 A;  3VGW A;  3WYP A;  3WYQ A;  3VHM A;  4OKA A;  4Y59 A;  1LDO A;  3T6L A;  1LCV A;  4EKV A;  4GDA A;  3RY2 A;  1VWN B;  4Y5D A;  1MK5 A;  1VWO B;  2IZE B;  4GJS A;  5JD2 A;  2OFA A;  4BX5 A;  1VWL B;  2A5B A;  4JO6 A;  1N4J A;  1SRJ A;  2RTL A;  2Y3E A;  4GGZ A;  1VWI B;  3EW2 A;  3X00 A;  1N9M A;  2IZL B;  1SWH A;  3RE5 A;  1SLG B;  2Y32 A;  1HXZ A;  4DNE A;  3RDX A;  1SWK A;  2C4I A;  3MG5 A;  2RTR B;  2RTK A;  2RTN B;  1MEP A;  5CSE A;  3VHI A;  3WZN A;  1SWS A;  4GD9 A;  2UZ2 A;  4JHQ A;  5IRU A;  1SRG A;  1SWA A;  1KL3 A;  1NQN A;  5F2B A;  2UYW A;  1SWO A;  1HXL A;  1N43 A;  1SWT A;  5IRA A;  1RXH A;  4CPF A;  2AVI A;  2IZK A;  1SWN A;  5L3Y A;  1STS B;  4GGR A;  1KFF A;  4U46 A;  5B5F A;  1SWU A;  2FHL A;  1KL5 A;  1SWB A;  2IZC B;  1SWR A;  1SWP A;  2BC3 A;  4Z2O A;  1VYO A;  1LUQ A;  2RTC B;  1VWG B;  2RTB B;  1SLD B;  4IRW A;  1SWD A;  2ZSC A;  1SWJ A;  2RTO B;  2QCB A;  1SLE B;  3VHH A;  3WZP A;  1RXK A;  2RTP B;  3RDM A;  1IJ8 A;  1SRF A;  1SLF B;  1HY2 A;  4YVB A;  1NQM A;  1MOY A;  5B5G A;  3SZJ A;  2JGS A;  1VWD B;  1AVE A;  5CHK A;  1NBX A;  3RE6 A;  3T2W A;  4BBO A;  2WPU A;  2RTF B;  4Z6J A;  1SWG A;  3T6F A;  1Y52 X;  1VWH B;  2RTD B;  2Y3F A;  2IZH B;  1NDJ A;  1DF8 A;  1SWF A;  1VWE B;  2OFB A;  2RTH B;  3WZO A;  1VWP B;  4BJ8 A;  1LCZ A;  1WBI A;  3RDS A;  3MM0 A;  2OF9 A;  2C1S A;  2RTE B;  1SRE A;  2IZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...