1VWJB

Streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 2.5, i222 complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
pubmed doi rcsb
molecule tags Complex (biotin-binding protein/peptide)
total genus 26
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vwjB00
1SWDA 4Y5DA 3VHMA 1KL5A 1SWKA 4BCSA 1N7YA 3WZPA 1VWDB 2A5BA 2RTOB 3T6LA 1SWSA 2RTCB 1VWOB 2CAMA 3WYQA 4Z28A 2UZ2A 1RSTB 2IZGB 2A5CA 1KL4A 2A8GA 1LDQA 1VWGB 2IZCB 3RDSA 5IRAA 1SRIA 1LELA 1STPA 3WZQA 2Y3FA 4JO6A 4YVBA 1LUQA 2IZIA 5IRUA 1AVDA 3VGWA 1LCZA 1SLDB 4BX6B 1NC9A 3T6FA 1VWFB 1SWFA 2UYWA 5CSEA 2F01A 1SWQA 3MM0A 1SRJA 1VWBB 1VWJB 1SWRA 2RTNB 1SLFB 1HQQA 1N4JA 1VWCB 2C1QA 2Y3EA 3RE5A 2RTLA 1AVEA 4Z2PA 1RXKA 4CPIA 3RY1A 1VWQB 1SWJA 2OF8A 1RXJA 4I60A 1VYOA 3WZNA 3T2XA 2IZDB 2RTIB 1NQNA 1SWCA 4Z27A 2C4IA 1LCVA 1SWTA 2G5LA 1STSB 3RE6A 4Z6JA 3RDMA 3PK2A 4JHQA 2FHNX 2RTBB 2IZJA 4Z2OA 5F2BA 1SRFA 2JGSA 1SRHA 2RTAA 4GGRA 4GJSA 5JD2A 5B5FA 1HXLA 3EW2A 1SWBA 1VWIB 3RY2A 3RDUA 1N9YA 4CPHA 1VWMB 1SWUA 1SREA 5CHKA 1IJ8A 1HY2A 1LCWA 1SWGA 1VWAB 4U46A 3RDXA 1SWPA 1KFFA 1LDOA 1Y52X 4BX5A 1VWNB 3WZOA 1VWRB 4BX7B 1N9MA 2RTKA 1NQMA 2IZEB 1SWEA 1SLEB 4GGZA 3VHIA 1I9HA 2RTDB 4IRWA 2MF6A 3EW1A 1KL3A 4EKVA 3WYPA 1VWKB 1MM9A 1MOYA 1SLGB 1SWHA 4Y59A 1RAVA 4GD9A 2RTGB 3SZJA 5B5GA 1PTSA 1Y53X 1SWLA 4CPFA 2RTJA 5L3YA 2RTMA 2ZSCA 1VWHB 2WPUA 4BX6A 3RDQA 2OFAA 5K67A 1SWAA 2IZBA 3SZIA 4OKAA 2IZKA 3MG5A 2QCBA 1VWEB 2IZLB 4BX7A 2BC3A 1MEPA 2RTEB 2GH7A 1WBIA 2IZAA 2RTRB 2AVIA 3RDOA 1Y55X 1DF8A 2OF9A 2RTQB 3FDCA 4GJVA 1SRGA 1NDJA 5IRWA 1MK5A 1RSUB 2IZFB 1STRB 2FHLA 1RXHA 2C1SA 1SWNA 3SZHA 4JNJA 2RTPB 4CPEA 2RTFB 1NBXA 1SWOA 3VHHA 5K68A 3T2WA 4BBOA 4BJ8A 4CPHB 4Z2VA 1N43A 1HXZA 2Y32A 4GGTA 1VWPB 2OFBA 1VWLB 4BX5B 4GDAA 2RTHB 3X00A 4DNEA 2IZHB
chains in the Genus database with same CATH superfamily
1E00A 1W4TA 4NLIA 4TJZA 4Y5DA 3LV4A 2OY5O 1YWCA 2IFBA 3OJYC 3Q34A 3ZW0A 1SMPI 1N7YA 1X8QA 2R73A 3WJCA 3WZPA 3T6LA 3AEHA 1DZMA 2L5PA 2WR6A 5HTDA 3VG2A 1E06A 4BQUA 1ADLA 2ACPX 4OELA 4QZTA 4LZVA 3RKGA 1GX9A 4CK4A 2BLGA 4YFQA 4ZR2A 2A5CA 3VE2A 3P24A 2POAA 4YGZA 1VWGB 3RDSA 3F6ZB 3ELXA 1QY0A 3WZQA 3TZSA 4GDZA 4JO6A 4CSBA 5IO7A 4YDBA 1FDQA 1AVDA 1LPJA 1LCZA 1PBYA 1OBPA 1SLDB 1UZ2X 4OS8A 2HMBA 3VGWA 1ICNA 1NC9A 2BS6A 3T6FA 1LFOA 2UYWA 4EEJA 2QOSC 1S2PA 3EM0A 2AKQA 2RTNB 3RE5A 1HQQA 4Z2PA 1QY1A 4Y0SA 1AVEA 1QWDA 2FWVA 3SAOA 1RXKA 2FR2A 3D9WA 2A2GA 1SWJA 3C77X 4M7MA 4I60A 3RY1A 4ARHA 1NP4A 5BYPA 2RA6A 3WZNA 3LHNA 4CV7A 4IAWA 4TNNA 2K23A 4WBKA 4MVEA 3HWGA 3CKFA 4AZOA 1E02A 2IZJA 2G7BA 5JD2A 1JMXA 3STNA 1PBOA 3BLGA 2AT3X 3VU1A 1HN2A 2F73A 1TOUA 3BSZE 3KVNA 1VWIB 4ID2A 2JW1A 3MBTA 4KH8A 4AYHA 1MX8A 1SREA 1IJ8A 5DPQA 1VWAB 4ORRA 3CBCA 2LA7A 1LDOA 3APVA 4O49A 3B2IA 5BVQA 2YG2A 2G8CO 2X45A 2KTDA 1GX8A 4BX7B 3O22A 3U9PC 1LIBA 1NQMA 4KC7A 1SWEA 1SLEB 1A57A 3NQKA 4O4UA 2G78A 3HTYA 2RTDB 5D4AA 2RN4A 4FQBB 5BVSA 1I4UA 5EEEA 2CZUA 2Q4NA 5IO6A 1MM9A 1DFVA 3CBSA 2DM5A 3D97A 3PP6A 4XMHA 1U18A 5H9AA 3VG5A 4TKBA 1BEBA 4BVMA 4DCBA 2RTGB 1TVQA 1YWBA 4ZFXA 4ZHDA 1JJJA 3ZUOA 3P02A 3I0AA 1CBIA 2JMBA 3NBXX 2CBRA 5L3YA 4GK9A 2OY1O 4GZVA 2YMSA 4O4SA 1KGLA 1VWHB 1NP1A 1D3SA 3BX8A 1JJXA 3RDQA 2OFAA 5K67A 1OEJA 3UEUA 3FMZA 3KFGA 2IZBA 4A1YA 1IFBA 4TKHA 2QCBA 1VWEB 1IW2A 3E3CA 1XCAA 1LIFA 1MEPA 1QFVA 2AT8X 2BC3A 3I17A 3O2YA 2WWPA 4ML7B 5DG4A 3UAQA 5LJEA 2HZQA 3RDOA 1KT3A 3PPTA 5FQ8E 4AZMA 1EALA 1GGLA 5D8JA 1E5PA 2IZFB 2ZAIA 5F7GA 4D6BA 1HMSA 1WUBA 1EI5A 4HPBA 2DJGA 3WJFA 4JNJA 3ZW1A 1YWAA 3FENA 5AJCA 3ZI8A 1NBXA 4QGXA 1D2UA 1IFCA 3T2WA 1Z24A 3IA8A 4Z2VA 1NGLA 1HQPA 5LJBA 2OFBA 4OS3A 2OVSA 3WJGA 4BX5B 4ODDA 3GE2A 3X00A 4DNEA 4I6SA 4ZHHA 3PECA 4GH7A 5LJCA 5H8TA 3PQSA 1SY3A 3B2LA 1SWKA 4OS0A 3FIDA 4B55A 3BS2A 3PH6A 5H9KA 1GKAB 1BRPA 2KTSA 1A3YA 1SWSA 2RTCB 2KT4B 3KFIA 4HPDA 2LB6A 3O19A 1VWOB 5FENA 4WFUA 2FKJA 3P6HA 3WBGA 2UZ2A 1RSTB 2WQAE 4FBRA 1DF3A 3K3LA 4EDEA 3FW5A 2IZCB 4I3DA 4QNIA 5IRAA 1GT5A 3NADA 2VFCA 4IBAA 1MVGA 3FLLA 2GJ5A 1LKEA 4N7CA 4MEEA 2I5ZO 3N91A 4L1NA 1VWFB 5LJGA 4DQ3A 2F01A 1CBQA 3MM0A 4ALOA 3BU9A 1VWBB 4XMGA 4I9SA 4ES7A 2C1QA 1VWCB 2Q9SA 3TF6A 4HWMA 3TGBA 1GT4A 1R0UA 4I3CA 1ZNLA 2ALLX 2XSTA 4LZUA 4MIRA 1VWQB 1GM6A 1ERXA 2NP1A 4JGLA 2OVAA 4MVIA 1QG5A 1JJUA 2ANSA 2BSZA 1NQNA 2BT9A 3P6GA 2PY1A 2C4IA 4NW4A 2JN3A 2L67A 4Z27A 4ZHCA 3U03A 1AB0A 2HLVA 4QRLA 1KT7A 1UYOX 1B0OA 1HMRA 3FELA 4UU3A 4GJSA 1SRHA 2P8GA 1CJ5A 2BHVA 3MX7A 3NQ9A 1TW4A 1SWBA 2X8FA 3HWDA 3EBWA 3S5VA 4IAXA 2CZTA 3HPEA 5F6BA 4U46A 4Y0RA 1SWPA 4IMNA 4CDDA 1OBUA 2CM4A 2HYSA 3FEPA 2X56A 2W2FA 4NNSA 2LBVA 1ZNDA 5LKEA 1SY0A 5AQ6A 1U0XA 4I9RA 4PJ2A 3WZOA 3C76X 1T68X 1QQSA 1VYFA 2FRSA 4IB7A 1MUPA 1I9HA 1OPAA 2K62A 2MF6A 2N93A 4IRWA 1OSPO 5L8OA 4YBUA 2AMMX 3P6DA 1MOYA 1SLGB 3APXA 4Y59A 1ZNGA 1ZNKA 4LKTA 5JR8A 4GD9A 3ZWEA 2Z4IA 1JBHA 1JZUA 4QGWA 1PTSA 3FA9A 3WJEA 4GETA 4CPFA 2QO4A 1Y9LA 2RTJA 2R56A 4CDCA 5HZQA 3EMMA 1JYJA 2MHDA 4BX6A 2NNEA 3KFFA 5H9LA 3SLTA 2IZKA 1RBPA 1UREA 1Y0GA 4BX7A 3P6CA 1LICA 1BJ7A 4XMDA 2WUTA 5HA0A 1OEKA 4N7DA 5FQ6E 1Y55X 1DF8A 2OF9A 5KIDA 1P6PA 3PEDA 2G79A 4YH0A 5IRWA 2FHLA 2M4LA 2X8TA 2C1SA 3AKNA 5H9NA 2AH7X 1BRQA 4OEMA 2FS6A 4ORWA 3SZHA 2O62A 3TGCA 5HTEA 1BSOA 2FKGA 3FEKA 4A60A 1L6MA 4BJ8A 1ALBA 4Y0QA 4BBOA 1QABE 2A2UA 2FTBA 4U9CA 1B8EA 5L8NA 4PSQA 4CDEA 5B11O 1BSYA 3FA7A 4ZHFA 3FIQA 4QQ1A 2OL6O 4QYNA 4GDAA 2RTHB 4YCHA 1JMZA 4O3YA 4YFRA 2IZHB 2Y3EA 3CQNA 4NV7A 4O9SA 1KZXA 3HWFA 2ACOA 3FR5A 1N0SA 1IIUA 4I95A 2RCTA 4GNYA 1XKIA 1LF7A 3T1DA 2X55A 4I3BA 5D47A 3PH5A 1VWDB 2RTOB 4YKMA 3G7XA 4YFPA 4NYRA 1X8OA 5HWZA 1OPBA 1KOIA 4U8UN 1X71A 4KIIA 4ZHGA 4M6SA 2XKLA 1I05A 4QAEA 5EEDA 4C5PA 1KL4A 2A8GA 3MVFA 4ZH6A 4LKPA 2OFRX 1SY1A 3WOVA 1YP6A 1O1UA 1SRIA 1LELA 1STPA 5KHPA 2Y3FA 3APWA 4NP1A 3OBLA 4D6AA 3FR2A 4YVBA 1RLBE 4YKOA 3F8AA 5IRUA 2AT0X 3STKA 2OVEA 4AZQA 3STMX 1ZNHA 2L9CA 2ZAGA 2AT5X 4MVLA 4O4OA 1EUOA 3BY0A 5CSEA 3NX1A 1SRJA 2OL8O 1B4MA 2X32A 3B2HA 1SWRA 1SLFB 4EQAC 4MISA 1LIEA 2JU8A 1EIOA 3ELZA 1X8PA 5LJDA 2JOZA 4YDAA 1CBSA 1GKAA 1A2DA 2OF8A 4HPCA 1VYOA 1YIVA 4K19A 3T2XA 3TGAA 5LJKA 2RTIB 5D48A 1SWCA 4YMYA 2G5LA 1SWTA 4INNA 1STSB 3EC5A 2OL7A 1KQWA 4YCEA 3RDMA 1ACDA 1PMPA 1E2TA 3AUMO 4Z2OA 2LBAA 2MWHA 2I5VO 5F2BA 5B5FA 4GGRA 2GTLN 1DZKA 3OE3A 3P6EA 1HXLA 4AZNA 4CPHA 4BGFA 4RUUA 3RDUA 2OZQA 3VG3A 1VWMB 1SWUA 2MM3A 1TXLA 3JQOA 3RDXA 1ICMA 1LCWA 2R74A 2GTFX 1BBPA 1U17A 4FBVA 4QYPA 3B2JA 1Y52X 1DV9A 1I06A 2RQ0A 1W6FA 1KQXA 1X8UA 5HCCC 4ZGUA 5HA1A 1AQBA 1SXWA 2WEWA 3S60A 1KT4A 2RTKA 3BDRA 4GGZA 3VHIA 4U8UM 4TLJA 1SXUA 4U3QA 3EW1A 4LQZA 1W5RA 3WYPA 4IABA 1S44A 4R0BA 5FFHA 2WQ9A 3HOEA 1O8VA 5IXGA 1SWHA 1HBQA 4FBOA 4YGHA 5EPQA 5B27A 1RAVA 1DZPA 1EPAA 3SZJA 2CBSA 3BX7A 4NYQA 5B5GA 2KD2A 2MO5A 1SWLA 2FS7A 3PQUA 4XMEA 5F58A 4GU8A 2RTMA 1BSQA 3S26A 1SY2A 5K06A 3GAQA 3D95A 2CM9A 4WFVA 4AZRA 1BM5A 2HZRA 5BVTA 3RBYA 3ZW0B 4OMXA 1A18A 3JSQA 3ZQ3A 4YBPA 3RSWA 3KQ0A 3H3IA 3UEWA 2A0AA 2GH7A 1IKEA 2AVIA 2RTQB 3FDCA 4ALBA 5HZ6A 1NDJA 1MK5A 2WEXA 1EIIA 1STRB 1YWDA 4WHIA 1TOWA 1IKJA 1QY2A 1RXHA 2GTLM 1SWNA 1UYNX 4O3XB 2RTFB 2FT9A 3DSZA 1T0VA 2OY8A 5AJBA 3VHHA 5CE4A 2NNDA 1PEEA 3UEXA 3SLOA 1N43A 3UEVA 1HXZA 3VG7A 1JYDA 1KT5A 3CMPA 2FLJA 4GGTA 1VWPB 1AELA 3JS1A 2QMIA 1VPRA 2X4MA 1JV4A 5CYBA 1BLRA 3ZW2A 1SWDA 3VHMA 2FR3A 2GC9A 5LJHA 3WJBA 1KL5A 3PDFA 1HBPA 4BCSA 2OFMX 2A5BA 1GX3A 2W2BA 5L8IA 1CBRA 4GUZA 1DC9A 5HZ9A 4COTA 4Y0PA 4ORSA 4ORUA 2CAMA 1SA8A 2AT6X 3WYQA 1LIDA 3BRNA 4IMOA 5FAZA 1T8VA 4Z28A 2IZGB 3SOTA 3SLJA 3AKMA 5EDBA 1LDQA 5B10O 3NR3A 3FR4A 4KCAA 1O1VA 2X8SA 4L3RA 1BWYA 4IB6A 4ZCBA 1I78A 3V8UA 1MDCA 3WVMA 4FGIB 1G5WA 3F9DA 3D96A 4AZPA 3QKGA 4GRJA 1LUQA 2IZIA 1JIWI 4ZH9A 4EFGA 1EXSA 4NLJA 4BX6B 1ZRYA 3NQ3A 2AF5A 2WSJA 3B2KA 5HZ8A 1SWFA 2Q2PA 2RCQA 2QO5A 1SWQA 1G85A 3OD9A 1VWJB 1N4JA 3Q6LA 4HFOA 3NX2A 2RTLA 2FGSA 3CWKA 1X89A 4ORXA 4CPIA 3DTQA 4O3ZA 2JU3A 2E4JA 4OMWA 1RXJA 2EU7X 4GKCA 2OY7A 4ZGFA 2DJFA 2IZDB 3VG4A 4DQ4A 2BS5A 3BU1A 1LCVA 3IFBA 3RE6A 4TQ2A 4Z6JA 3P6FA 3PK2A 4JHQA 1YP7A 2Q39A 2FHNX 2A13A 1EQDA 2RTBB 5C0NA 3WJDA 1GXAA 1SRFA 2JGSA 2RTAA 3APUA 3HWEA 1EW3A 4GE1A 4HPAA 4NV8A 4XMFA 5HAEA 3NP1A 3EW2A 4UU2A 3KZAA 5EZ2A 3RY2A 1N9YA 2MJIA 5CHKA 5EDCA 4A1HA 1HY2A 1SWGA 3CR6A 1I04A 1KFFA 1JQPA 4IB8A 4ON1A 2X34A 1VWNB 5F1EA 2L68A 4BX5A 2LFOA 1FE3A 2OYBO 4EXZA 1KZWA 3NPOA 5HCDC 1S7DA 1YUPA 1VWRB 1N9MA 4XMCA 3ZUIA 1ERBA 4BOEA 2IZEB 4NNTA 3U0DA 1CRBA 3EBKA 2VFBA 1MX7A 1ZNEA 3CQRA 1GT1A 4GNWA 1KL3A 2AL0X 4U8UO 4EKVA 4ZJ0A 1FENA 4O4XA 1VWKB 4RUNA 3VE1A 4KC8A 4AW8A 3ZW1B 4QGVA 1B56A 1QFTA 1DZJA 2QOMA 1AVGI 2Z4HA 3CKGA 1OEEA 1GT3A 3FYFA 3ZZVA 1Y53X 1LNMA 2ASNX 1KT6A 5HZ5A 2OVDA 5D45A 1FJ1E 3EYCA 3FA6A 1X8NA 1KXOA 5HBSA 1G7NA 2ZSCA 4A8ZA 2PI3O 2W2AA 2HKDA 2WPUA 3KFHA 1HMTA 4YGGA 2F09A 1SWAA 2LKKA 3HOLA 4O3WA 3S5XA 3VG6A 5HCEC 3SZIA 3D4RA 4OKAA 1VYGA 3FA8A 3MG5A 2IZLB 5B29A 4QZUA 2HNXA 1G74A 2RTEB 1H91A 1WBIA 2IZAA 1FEMA 2NNQA 2RTRB 1SXYA 3HK1A 4KT5A 4MVKA 3RWXA 4GJVA 1SRGA 1FTPA 3C78X 1RSUB 1SXXA 5IO5A 3QQ2A 5KICA 1Y9TA 2X46A 3L4RA 3LTWA 3WXQA 5LKFA 2Q2MA 2RTPB 3RZYA 4CPEA 5F6ZA 1SWOA 2GTLO 4TKJA 5K68A 4CPHB 1K3BA 5FQ7E 5AEOA 1EPBA 1OBQA 4IB9A 2A3FX 1ML7A 3VPJE 2KW1A 2JU7A 2Y32A 5B2AO 3FW4A 1FELA 4CDFA 1K24A 4ORYA 1VWLB 2QO6A 2VDFA 2RD7C 1PM1X 2QM9A 5B3MO
chains in the Genus database with same CATH topology
1SWDA 4Y5DA 3VHMA 1KL5A 1SWKA 4BCSA 1N7YA 3WZPA 1VWDB 2A5BA 2RTOB 3T6LA 1SWSA 2RTCB 1VWOB 2CAMA 3WYQA 4Z28A 2UZ2A 1RSTB 2IZGB 2A5CA 1KL4A 2A8GA 1LDQA 1VWGB 2IZCB 3RDSA 5IRAA 1SRIA 1LELA 1STPA 3WZQA 2Y3FA 4JO6A 4YVBA 1LUQA 2IZIA 5IRUA 1AVDA 3VGWA 1LCZA 1SLDB 4BX6B 1NC9A 3T6FA 1VWFB 1SWFA 2UYWA 5CSEA 2F01A 1SWQA 3MM0A 1SRJA 1VWBB 1VWJB 1SWRA 2RTNB 1SLFB 1HQQA 1N4JA 1VWCB 2C1QA 2Y3EA 3RE5A 2RTLA 1AVEA 4Z2PA 1RXKA 4CPIA 3RY1A 1VWQB 1SWJA 2OF8A 1RXJA 4I60A 1VYOA 3WZNA 3T2XA 2IZDB 2RTIB 1NQNA 1SWCA 4Z27A 2C4IA 1LCVA 1SWTA 2G5LA 1STSB 3RE6A 4Z6JA 3RDMA 3PK2A 4JHQA 2FHNX 2RTBB 2IZJA 4Z2OA 5F2BA 1SRFA 2JGSA 1SRHA 2RTAA 4GGRA 4GJSA 5JD2A 5B5FA 1HXLA 3EW2A 1SWBA 1VWIB 3RY2A 3RDUA 1N9YA 4CPHA 1VWMB 1SWUA 1SREA 5CHKA 1IJ8A 1HY2A 1LCWA 1SWGA 1VWAB 4U46A 3RDXA 1SWPA 1KFFA 1LDOA 1Y52X 4BX5A 1VWNB 3WZOA 1VWRB 4BX7B 1N9MA 2RTKA 1NQMA 2IZEB 1SWEA 1SLEB 4GGZA 3VHIA 1I9HA 2RTDB 4IRWA 2MF6A 3EW1A 1KL3A 4EKVA 3WYPA 1VWKB 1MM9A 1MOYA 1SLGB 1SWHA 4Y59A 1RAVA 4GD9A 2RTGB 3SZJA 5B5GA 1PTSA 1Y53X 1SWLA 4CPFA 2RTJA 5L3YA 2RTMA 2ZSCA 1VWHB 2WPUA 4BX6A 3RDQA 2OFAA 5K67A 1SWAA 2IZBA 3SZIA 4OKAA 2IZKA 3MG5A 2QCBA 1VWEB 2IZLB 4BX7A 2BC3A 1MEPA 2RTEB 2GH7A 1WBIA 2IZAA 2RTRB 2AVIA 3RDOA 1Y55X 1DF8A 2OF9A 2RTQB 3FDCA 4GJVA 1SRGA 1NDJA 5IRWA 1MK5A 1RSUB 2IZFB 1STRB 2FHLA 1RXHA 2C1SA 1SWNA 3SZHA 4JNJA 2RTPB 4CPEA 2RTFB 1NBXA 1SWOA 3VHHA 5K68A 3T2WA 4BBOA 4BJ8A 4CPHB 4Z2VA 1N43A 1HXZA 2Y32A 4GGTA 1VWPB 2OFBA 1VWLB 4BX5B 4GDAA 2RTHB 3X00A 4DNEA 2IZHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWD A;  4Y5D A;  3VHM A;  1KL5 A;  1SWK A;  4BCS A;  1N7Y A;  3WZP A;  1VWD B;  2A5B A;  2RTO B;  3T6L A;  1SWS A;  2RTC B;  1VWO B;  2CAM A;  3WYQ A;  4Z28 A;  2UZ2 A;  1RST B;  2IZG B;  2A5C A;  1KL4 A;  2A8G A;  1LDQ A;  1VWG B;  2IZC B;  3RDS A;  5IRA A;  1SRI A;  1LEL A;  1STP A;  3WZQ A;  2Y3F A;  4JO6 A;  4YVB A;  1LUQ A;  2IZI A;  5IRU A;  1AVD A;  3VGW A;  1LCZ A;  1SLD B;  4BX6 B;  1NC9 A;  3T6F A;  1VWF B;  1SWF A;  2UYW A;  5CSE A;  2F01 A;  1SWQ A;  3MM0 A;  1SRJ A;  1VWB B;  1VWJ B;  1SWR A;  2RTN B;  1SLF B;  1HQQ A;  1N4J A;  1VWC B;  2C1Q A;  2Y3E A;  3RE5 A;  2RTL A;  1AVE A;  4Z2P A;  1RXK A;  4CPI A;  3RY1 A;  1VWQ B;  1SWJ A;  2OF8 A;  1RXJ A;  4I60 A;  1VYO A;  3WZN A;  3T2X A;  2IZD B;  2RTI B;  1NQN A;  1SWC A;  4Z27 A;  2C4I A;  1LCV A;  1SWT A;  2G5L A;  1STS B;  3RE6 A;  4Z6J A;  3RDM A;  3PK2 A;  4JHQ A;  2FHN X;  2RTB B;  2IZJ A;  4Z2O A;  5F2B A;  1SRF A;  2JGS A;  1SRH A;  2RTA A;  4GGR A;  4GJS A;  5JD2 A;  5B5F A;  1HXL A;  3EW2 A;  1SWB A;  1VWI B;  3RY2 A;  3RDU A;  1N9Y A;  4CPH A;  1VWM B;  1SWU A;  1SRE A;  5CHK A;  1IJ8 A;  1HY2 A;  1LCW A;  1SWG A;  1VWA B;  4U46 A;  3RDX A;  1SWP A;  1KFF A;  1LDO A;  1Y52 X;  4BX5 A;  1VWN B;  3WZO A;  1VWR B;  4BX7 B;  1N9M A;  2RTK A;  1NQM A;  2IZE B;  1SWE A;  1SLE B;  4GGZ A;  3VHI A;  1I9H A;  2RTD B;  4IRW A;  2MF6 A;  3EW1 A;  1KL3 A;  4EKV A;  3WYP A;  1VWK B;  1MM9 A;  1MOY A;  1SLG B;  1SWH A;  4Y59 A;  1RAV A;  4GD9 A;  2RTG B;  3SZJ A;  5B5G A;  1PTS A;  1Y53 X;  1SWL A;  4CPF A;  2RTJ A;  5L3Y A;  2RTM A;  2ZSC A;  1VWH B;  2WPU A;  4BX6 A;  3RDQ A;  2OFA A;  5K67 A;  1SWA A;  2IZB A;  3SZI A;  4OKA A;  2IZK A;  3MG5 A;  2QCB A;  1VWE B;  2IZL B;  4BX7 A;  2BC3 A;  1MEP A;  2RTE B;  2GH7 A;  1WBI A;  2IZA A;  2RTR B;  2AVI A;  3RDO A;  1Y55 X;  1DF8 A;  2OF9 A;  2RTQ B;  3FDC A;  4GJV A;  1SRG A;  1NDJ A;  5IRW A;  1MK5 A;  1RSU B;  2IZF B;  1STR B;  2FHL A;  1RXH A;  2C1S A;  1SWN A;  3SZH A;  4JNJ A;  2RTP B;  4CPE A;  2RTF B;  1NBX A;  1SWO A;  3VHH A;  5K68 A;  3T2W A;  4BBO A;  4BJ8 A;  4CPH B;  4Z2V A;  1N43 A;  1HXZ A;  2Y32 A;  4GGT A;  1VWP B;  2OFB A;  1VWL B;  4BX5 B;  4GDA A;  2RTH B;  3X00 A;  4DNE A;  2IZH B; 
#chains in the Genus database with same CATH topology
 1E00 A;  1W4T A;  4NLI A;  4TJZ A;  4Y5D A;  3LV4 A;  2OY5 O;  1YWC A;  2IFB A;  3OJY C;  3Q34 A;  3ZW0 A;  1SMP I;  1N7Y A;  1X8Q A;  2R73 A;  3WJC A;  3WZP A;  3T6L A;  3AEH A;  1DZM A;  2L5P A;  2WR6 A;  5HTD A;  3VG2 A;  1E06 A;  4BQU A;  1ADL A;  2ACP X;  4OEL A;  4QZT A;  4LZV A;  3RKG A;  1GX9 A;  4CK4 A;  2BLG A;  4YFQ A;  4ZR2 A;  2A5C A;  3VE2 A;  3P24 A;  2POA A;  4YGZ A;  1VWG B;  3RDS A;  3F6Z B;  3ELX A;  1QY0 A;  3WZQ A;  3TZS A;  4GDZ A;  4JO6 A;  4CSB A;  5IO7 A;  4YDB A;  1FDQ A;  1AVD A;  1LPJ A;  1LCZ A;  1PBY A;  1OBP A;  1SLD B;  1UZ2 X;  4OS8 A;  2HMB A;  3VGW A;  1ICN A;  1NC9 A;  2BS6 A;  3T6F A;  1LFO A;  2UYW A;  4EEJ A;  2QOS C;  1S2P A;  3EM0 A;  2AKQ A;  2RTN B;  3RE5 A;  1HQQ A;  4Z2P A;  1QY1 A;  4Y0S A;  1AVE A;  1QWD A;  2FWV A;  3SAO A;  1RXK A;  2FR2 A;  3D9W A;  2A2G A;  1SWJ A;  3C77 X;  4M7M A;  4I60 A;  3RY1 A;  4ARH A;  1NP4 A;  5BYP A;  2RA6 A;  3WZN A;  3LHN A;  4CV7 A;  4IAW A;  4TNN A;  2K23 A;  4WBK A;  4MVE A;  3HWG A;  3CKF A;  4AZO A;  1E02 A;  2IZJ A;  2G7B A;  5JD2 A;  1JMX A;  3STN A;  1PBO A;  3BLG A;  2AT3 X;  3VU1 A;  1HN2 A;  2F73 A;  1TOU A;  3BSZ E;  3KVN A;  1VWI B;  4ID2 A;  2JW1 A;  3MBT A;  4KH8 A;  4AYH A;  1MX8 A;  1SRE A;  1IJ8 A;  5DPQ A;  1VWA B;  4ORR A;  3CBC A;  2LA7 A;  1LDO A;  3APV A;  4O49 A;  3B2I A;  5BVQ A;  2YG2 A;  2G8C O;  2X45 A;  2KTD A;  1GX8 A;  4BX7 B;  3O22 A;  3U9P C;  1LIB A;  1NQM A;  4KC7 A;  1SWE A;  1SLE B;  1A57 A;  3NQK A;  4O4U A;  2G78 A;  3HTY A;  2RTD B;  5D4A A;  2RN4 A;  4FQB B;  5BVS A;  1I4U A;  5EEE A;  2CZU A;  2Q4N A;  5IO6 A;  1MM9 A;  1DFV A;  3CBS A;  2DM5 A;  3D97 A;  3PP6 A;  4XMH A;  1U18 A;  5H9A A;  3VG5 A;  4TKB A;  1BEB A;  4BVM A;  4DCB A;  2RTG B;  1TVQ A;  1YWB A;  4ZFX A;  4ZHD A;  1JJJ A;  3ZUO A;  3P02 A;  3I0A A;  1CBI A;  2JMB A;  3NBX X;  2CBR A;  5L3Y A;  4GK9 A;  2OY1 O;  4GZV A;  2YMS A;  4O4S A;  1KGL A;  1VWH B;  1NP1 A;  1D3S A;  3BX8 A;  1JJX A;  3RDQ A;  2OFA A;  5K67 A;  1OEJ A;  3UEU A;  3FMZ A;  3KFG A;  2IZB A;  4A1Y A;  1IFB A;  4TKH A;  2QCB A;  1VWE B;  1IW2 A;  3E3C A;  1XCA A;  1LIF A;  1MEP A;  1QFV A;  2AT8 X;  2BC3 A;  3I17 A;  3O2Y A;  2WWP A;  4ML7 B;  5DG4 A;  3UAQ A;  5LJE A;  2HZQ A;  3RDO A;  1KT3 A;  3PPT A;  5FQ8 E;  4AZM A;  1EAL A;  1GGL A;  5D8J A;  1E5P A;  2IZF B;  2ZAI A;  5F7G A;  4D6B A;  1HMS A;  1WUB A;  1EI5 A;  4HPB A;  2DJG A;  3WJF A;  4JNJ A;  3ZW1 A;  1YWA A;  3FEN A;  5AJC A;  3ZI8 A;  1NBX A;  4QGX A;  1D2U A;  1IFC A;  3T2W A;  1Z24 A;  3IA8 A;  4Z2V A;  1NGL A;  1HQP A;  5LJB A;  2OFB A;  4OS3 A;  2OVS A;  3WJG A;  4BX5 B;  4ODD A;  3GE2 A;  3X00 A;  4DNE A;  4I6S A;  4ZHH A;  3PEC A;  4GH7 A;  5LJC A;  5H8T A;  3PQS A;  1SY3 A;  3B2L A;  1SWK A;  4OS0 A;  3FID A;  4B55 A;  3BS2 A;  3PH6 A;  5H9K A;  1GKA B;  1BRP A;  2KTS A;  1A3Y A;  1SWS A;  2RTC B;  2KT4 B;  3KFI A;  4HPD A;  2LB6 A;  3O19 A;  1VWO B;  5FEN A;  4WFU A;  2FKJ A;  3P6H A;  3WBG A;  2UZ2 A;  1RST B;  2WQA E;  4FBR A;  1DF3 A;  3K3L A;  4EDE A;  3FW5 A;  2IZC B;  4I3D A;  4QNI A;  5IRA A;  1GT5 A;  3NAD A;  2VFC A;  4IBA A;  1MVG A;  3FLL A;  2GJ5 A;  1LKE A;  4N7C A;  4MEE A;  2I5Z O;  3N91 A;  4L1N A;  1VWF B;  5LJG A;  4DQ3 A;  2F01 A;  1CBQ A;  3MM0 A;  4ALO A;  3BU9 A;  1VWB B;  4XMG A;  4I9S A;  4ES7 A;  2C1Q A;  1VWC B;  2Q9S A;  3TF6 A;  4HWM A;  3TGB A;  1GT4 A;  1R0U A;  4I3C A;  1ZNL A;  2ALL X;  2XST A;  4LZU A;  4MIR A;  1VWQ B;  1GM6 A;  1ERX A;  2NP1 A;  4JGL A;  2OVA A;  4MVI A;  1QG5 A;  1JJU A;  2ANS A;  2BSZ A;  1NQN A;  2BT9 A;  3P6G A;  2PY1 A;  2C4I A;  4NW4 A;  2JN3 A;  2L67 A;  4Z27 A;  4ZHC A;  3U03 A;  1AB0 A;  2HLV A;  4QRL A;  1KT7 A;  1UYO X;  1B0O A;  1HMR A;  3FEL A;  4UU3 A;  4GJS A;  1SRH A;  2P8G A;  1CJ5 A;  2BHV A;  3MX7 A;  3NQ9 A;  1TW4 A;  1SWB A;  2X8F A;  3HWD A;  3EBW A;  3S5V A;  4IAX A;  2CZT A;  3HPE A;  5F6B A;  4U46 A;  4Y0R A;  1SWP A;  4IMN A;  4CDD A;  1OBU A;  2CM4 A;  2HYS A;  3FEP A;  2X56 A;  2W2F A;  4NNS A;  2LBV A;  1ZND A;  5LKE A;  1SY0 A;  5AQ6 A;  1U0X A;  4I9R A;  4PJ2 A;  3WZO A;  3C76 X;  1T68 X;  1QQS A;  1VYF A;  2FRS A;  4IB7 A;  1MUP A;  1I9H A;  1OPA A;  2K62 A;  2MF6 A;  2N93 A;  4IRW A;  1OSP O;  5L8O A;  4YBU A;  2AMM X;  3P6D A;  1MOY A;  1SLG B;  3APX A;  4Y59 A;  1ZNG A;  1ZNK A;  4LKT A;  5JR8 A;  4GD9 A;  3ZWE A;  2Z4I A;  1JBH A;  1JZU A;  4QGW A;  1PTS A;  3FA9 A;  3WJE A;  4GET A;  4CPF A;  2QO4 A;  1Y9L A;  2RTJ A;  2R56 A;  4CDC A;  5HZQ A;  3EMM A;  1JYJ A;  2MHD A;  4BX6 A;  2NNE A;  3KFF A;  5H9L A;  3SLT A;  2IZK A;  1RBP A;  1URE A;  1Y0G A;  4BX7 A;  3P6C A;  1LIC A;  1BJ7 A;  4XMD A;  2WUT A;  5HA0 A;  1OEK A;  4N7D A;  5FQ6 E;  1Y55 X;  1DF8 A;  2OF9 A;  5KID A;  1P6P A;  3PED A;  2G79 A;  4YH0 A;  5IRW A;  2FHL A;  2M4L A;  2X8T A;  2C1S A;  3AKN A;  5H9N A;  2AH7 X;  1BRQ A;  4OEM A;  2FS6 A;  4ORW A;  3SZH A;  2O62 A;  3TGC A;  5HTE A;  1BSO A;  2FKG A;  3FEK A;  4A60 A;  1L6M A;  4BJ8 A;  1ALB A;  4Y0Q A;  4BBO A;  1QAB E;  2A2U A;  2FTB A;  4U9C A;  1B8E A;  5L8N A;  4PSQ A;  4CDE A;  5B11 O;  1BSY A;  3FA7 A;  4ZHF A;  3FIQ A;  4QQ1 A;  2OL6 O;  4QYN A;  4GDA A;  2RTH B;  4YCH A;  1JMZ A;  4O3Y A;  4YFR A;  2IZH B;  2Y3E A;  3CQN A;  4NV7 A;  4O9S A;  1KZX A;  3HWF A;  2ACO A;  3FR5 A;  1N0S A;  1IIU A;  4I95 A;  2RCT A;  4GNY A;  1XKI A;  1LF7 A;  3T1D A;  2X55 A;  4I3B A;  5D47 A;  3PH5 A;  1VWD B;  2RTO B;  4YKM A;  3G7X A;  4YFP A;  4NYR A;  1X8O A;  5HWZ A;  1OPB A;  1KOI A;  4U8U N;  1X71 A;  4KII A;  4ZHG A;  4M6S A;  2XKL A;  1I05 A;  4QAE A;  5EED A;  4C5P A;  1KL4 A;  2A8G A;  3MVF A;  4ZH6 A;  4LKP A;  2OFR X;  1SY1 A;  3WOV A;  1YP6 A;  1O1U A;  1SRI A;  1LEL A;  1STP A;  5KHP A;  2Y3F A;  3APW A;  4NP1 A;  3OBL A;  4D6A A;  3FR2 A;  4YVB A;  1RLB E;  4YKO A;  3F8A A;  5IRU A;  2AT0 X;  3STK A;  2OVE A;  4AZQ A;  3STM X;  1ZNH A;  2L9C A;  2ZAG A;  2AT5 X;  4MVL A;  4O4O A;  1EUO A;  3BY0 A;  5CSE A;  3NX1 A;  1SRJ A;  2OL8 O;  1B4M A;  2X32 A;  3B2H A;  1SWR A;  1SLF B;  4EQA C;  4MIS A;  1LIE A;  2JU8 A;  1EIO A;  3ELZ A;  1X8P A;  5LJD A;  2JOZ A;  4YDA A;  1CBS A;  1GKA A;  1A2D A;  2OF8 A;  4HPC A;  1VYO A;  1YIV A;  4K19 A;  3T2X A;  3TGA A;  5LJK A;  2RTI B;  5D48 A;  1SWC A;  4YMY A;  2G5L A;  1SWT A;  4INN A;  1STS B;  3EC5 A;  2OL7 A;  1KQW A;  4YCE A;  3RDM A;  1ACD A;  1PMP A;  1E2T A;  3AUM O;  4Z2O A;  2LBA A;  2MWH A;  2I5V O;  5F2B A;  5B5F A;  4GGR A;  2GTL N;  1DZK A;  3OE3 A;  3P6E A;  1HXL A;  4AZN A;  4CPH A;  4BGF A;  4RUU A;  3RDU A;  2OZQ A;  3VG3 A;  1VWM B;  1SWU A;  2MM3 A;  1TXL A;  3JQO A;  3RDX A;  1ICM A;  1LCW A;  2R74 A;  2GTF X;  1BBP A;  1U17 A;  4FBV A;  4QYP A;  3B2J A;  1Y52 X;  1DV9 A;  1I06 A;  2RQ0 A;  1W6F A;  1KQX A;  1X8U A;  5HCC C;  4ZGU A;  5HA1 A;  1AQB A;  1SXW A;  2WEW A;  3S60 A;  1KT4 A;  2RTK A;  3BDR A;  4GGZ A;  3VHI A;  4U8U M;  4TLJ A;  1SXU A;  4U3Q A;  3EW1 A;  4LQZ A;  1W5R A;  3WYP A;  4IAB A;  1S44 A;  4R0B A;  5FFH A;  2WQ9 A;  3HOE A;  1O8V A;  5IXG A;  1SWH A;  1HBQ A;  4FBO A;  4YGH A;  5EPQ A;  5B27 A;  1RAV A;  1DZP A;  1EPA A;  3SZJ A;  2CBS A;  3BX7 A;  4NYQ A;  5B5G A;  2KD2 A;  2MO5 A;  1SWL A;  2FS7 A;  3PQU A;  4XME A;  5F58 A;  4GU8 A;  2RTM A;  1BSQ A;  3S26 A;  1SY2 A;  5K06 A;  3GAQ A;  3D95 A;  2CM9 A;  4WFV A;  4AZR A;  1BM5 A;  2HZR A;  5BVT A;  3RBY A;  3ZW0 B;  4OMX A;  1A18 A;  3JSQ A;  3ZQ3 A;  4YBP A;  3RSW A;  3KQ0 A;  3H3I A;  3UEW A;  2A0A A;  2GH7 A;  1IKE A;  2AVI A;  2RTQ B;  3FDC A;  4ALB A;  5HZ6 A;  1NDJ A;  1MK5 A;  2WEX A;  1EII A;  1STR B;  1YWD A;  4WHI A;  1TOW A;  1IKJ A;  1QY2 A;  1RXH A;  2GTL M;  1SWN A;  1UYN X;  4O3X B;  2RTF B;  2FT9 A;  3DSZ A;  1T0V A;  2OY8 A;  5AJB A;  3VHH A;  5CE4 A;  2NND A;  1PEE A;  3UEX A;  3SLO A;  1N43 A;  3UEV A;  1HXZ A;  3VG7 A;  1JYD A;  1KT5 A;  3CMP A;  2FLJ A;  4GGT A;  1VWP B;  1AEL A;  3JS1 A;  2QMI A;  1VPR A;  2X4M A;  1JV4 A;  5CYB A;  1BLR A;  3ZW2 A;  1SWD A;  3VHM A;  2FR3 A;  2GC9 A;  5LJH A;  3WJB A;  1KL5 A;  3PDF A;  1HBP A;  4BCS A;  2OFM X;  2A5B A;  1GX3 A;  2W2B A;  5L8I A;  1CBR A;  4GUZ A;  1DC9 A;  5HZ9 A;  4COT A;  4Y0P A;  4ORS A;  4ORU A;  2CAM A;  1SA8 A;  2AT6 X;  3WYQ A;  1LID A;  3BRN A;  4IMO A;  5FAZ A;  1T8V A;  4Z28 A;  2IZG B;  3SOT A;  3SLJ A;  3AKM A;  5EDB A;  1LDQ A;  5B10 O;  3NR3 A;  3FR4 A;  4KCA A;  1O1V A;  2X8S A;  4L3R A;  1BWY A;  4IB6 A;  4ZCB A;  1I78 A;  3V8U A;  1MDC A;  3WVM A;  4FGI B;  1G5W A;  3F9D A;  3D96 A;  4AZP A;  3QKG A;  4GRJ A;  1LUQ A;  2IZI A;  1JIW I;  4ZH9 A;  4EFG A;  1EXS A;  4NLJ A;  4BX6 B;  1ZRY A;  3NQ3 A;  2AF5 A;  2WSJ A;  3B2K A;  5HZ8 A;  1SWF A;  2Q2P A;  2RCQ A;  2QO5 A;  1SWQ A;  1G85 A;  3OD9 A;  1VWJ B;  1N4J A;  3Q6L A;  4HFO A;  3NX2 A;  2RTL A;  2FGS A;  3CWK A;  1X89 A;  4ORX A;  4CPI A;  3DTQ A;  4O3Z A;  2JU3 A;  2E4J A;  4OMW A;  1RXJ A;  2EU7 X;  4GKC A;  2OY7 A;  4ZGF A;  2DJF A;  2IZD B;  3VG4 A;  4DQ4 A;  2BS5 A;  3BU1 A;  1LCV A;  3IFB A;  3RE6 A;  4TQ2 A;  4Z6J A;  3P6F A;  3PK2 A;  4JHQ A;  1YP7 A;  2Q39 A;  2FHN X;  2A13 A;  1EQD A;  2RTB B;  5C0N A;  3WJD A;  1GXA A;  1SRF A;  2JGS A;  2RTA A;  3APU A;  3HWE A;  1EW3 A;  4GE1 A;  4HPA A;  4NV8 A;  4XMF A;  5HAE A;  3NP1 A;  3EW2 A;  4UU2 A;  3KZA A;  5EZ2 A;  3RY2 A;  1N9Y A;  2MJI A;  5CHK A;  5EDC A;  4A1H A;  1HY2 A;  1SWG A;  3CR6 A;  1I04 A;  1KFF A;  1JQP A;  4IB8 A;  4ON1 A;  2X34 A;  1VWN B;  5F1E A;  2L68 A;  4BX5 A;  2LFO A;  1FE3 A;  2OYB O;  4EXZ A;  1KZW A;  3NPO A;  5HCD C;  1S7D A;  1YUP A;  1VWR B;  1N9M A;  4XMC A;  3ZUI A;  1ERB A;  4BOE A;  2IZE B;  4NNT A;  3U0D A;  1CRB A;  3EBK A;  2VFB A;  1MX7 A;  1ZNE A;  3CQR A;  1GT1 A;  4GNW A;  1KL3 A;  2AL0 X;  4U8U O;  4EKV A;  4ZJ0 A;  1FEN A;  4O4X A;  1VWK B;  4RUN A;  3VE1 A;  4KC8 A;  4AW8 A;  3ZW1 B;  4QGV A;  1B56 A;  1QFT A;  1DZJ A;  2QOM A;  1AVG I;  2Z4H A;  3CKG A;  1OEE A;  1GT3 A;  3FYF A;  3ZZV A;  1Y53 X;  1LNM A;  2ASN X;  1KT6 A;  5HZ5 A;  2OVD A;  5D45 A;  1FJ1 E;  3EYC A;  3FA6 A;  1X8N A;  1KXO A;  5HBS A;  1G7N A;  2ZSC A;  4A8Z A;  2PI3 O;  2W2A A;  2HKD A;  2WPU A;  3KFH A;  1HMT A;  4YGG A;  2F09 A;  1SWA A;  2LKK A;  3HOL A;  4O3W A;  3S5X A;  3VG6 A;  5HCE C;  3SZI A;  3D4R A;  4OKA A;  1VYG A;  3FA8 A;  3MG5 A;  2IZL B;  5B29 A;  4QZU A;  2HNX A;  1G74 A;  2RTE B;  1H91 A;  1WBI A;  2IZA A;  1FEM A;  2NNQ A;  2RTR B;  1SXY A;  3HK1 A;  4KT5 A;  4MVK A;  3RWX A;  4GJV A;  1SRG A;  1FTP A;  3C78 X;  1RSU B;  1SXX A;  5IO5 A;  3QQ2 A;  5KIC A;  1Y9T A;  2X46 A;  3L4R A;  3LTW A;  3WXQ A;  5LKF A;  2Q2M A;  2RTP B;  3RZY A;  4CPE A;  5F6Z A;  1SWO A;  2GTL O;  4TKJ A;  5K68 A;  4CPH B;  1K3B A;  5FQ7 E;  5AEO A;  1EPB A;  1OBQ A;  4IB9 A;  2A3F X;  1ML7 A;  3VPJ E;  2KW1 A;  2JU7 A;  2Y32 A;  5B2A O;  3FW4 A;  1FEL A;  4CDF A;  1K24 A;  4ORY A;  1VWL B;  2QO6 A;  2VDF A;  2RD7 C;  1PM1 X;  2QM9 A;  5B3M O; 
#chains in the Genus database with same CATH homology
 1SWD A;  4Y5D A;  3VHM A;  1KL5 A;  1SWK A;  4BCS A;  1N7Y A;  3WZP A;  1VWD B;  2A5B A;  2RTO B;  3T6L A;  1SWS A;  2RTC B;  1VWO B;  2CAM A;  3WYQ A;  4Z28 A;  2UZ2 A;  1RST B;  2IZG B;  2A5C A;  1KL4 A;  2A8G A;  1LDQ A;  1VWG B;  2IZC B;  3RDS A;  5IRA A;  1SRI A;  1LEL A;  1STP A;  3WZQ A;  2Y3F A;  4JO6 A;  4YVB A;  1LUQ A;  2IZI A;  5IRU A;  1AVD A;  3VGW A;  1LCZ A;  1SLD B;  4BX6 B;  1NC9 A;  3T6F A;  1VWF B;  1SWF A;  2UYW A;  5CSE A;  2F01 A;  1SWQ A;  3MM0 A;  1SRJ A;  1VWB B;  1VWJ B;  1SWR A;  2RTN B;  1SLF B;  1HQQ A;  1N4J A;  1VWC B;  2C1Q A;  2Y3E A;  3RE5 A;  2RTL A;  1AVE A;  4Z2P A;  1RXK A;  4CPI A;  3RY1 A;  1VWQ B;  1SWJ A;  2OF8 A;  1RXJ A;  4I60 A;  1VYO A;  3WZN A;  3T2X A;  2IZD B;  2RTI B;  1NQN A;  1SWC A;  4Z27 A;  2C4I A;  1LCV A;  1SWT A;  2G5L A;  1STS B;  3RE6 A;  4Z6J A;  3RDM A;  3PK2 A;  4JHQ A;  2FHN X;  2RTB B;  2IZJ A;  4Z2O A;  5F2B A;  1SRF A;  2JGS A;  1SRH A;  2RTA A;  4GGR A;  4GJS A;  5JD2 A;  5B5F A;  1HXL A;  3EW2 A;  1SWB A;  1VWI B;  3RY2 A;  3RDU A;  1N9Y A;  4CPH A;  1VWM B;  1SWU A;  1SRE A;  5CHK A;  1IJ8 A;  1HY2 A;  1LCW A;  1SWG A;  1VWA B;  4U46 A;  3RDX A;  1SWP A;  1KFF A;  1LDO A;  1Y52 X;  4BX5 A;  1VWN B;  3WZO A;  1VWR B;  4BX7 B;  1N9M A;  2RTK A;  1NQM A;  2IZE B;  1SWE A;  1SLE B;  4GGZ A;  3VHI A;  1I9H A;  2RTD B;  4IRW A;  2MF6 A;  3EW1 A;  1KL3 A;  4EKV A;  3WYP A;  1VWK B;  1MM9 A;  1MOY A;  1SLG B;  1SWH A;  4Y59 A;  1RAV A;  4GD9 A;  2RTG B;  3SZJ A;  5B5G A;  1PTS A;  1Y53 X;  1SWL A;  4CPF A;  2RTJ A;  5L3Y A;  2RTM A;  2ZSC A;  1VWH B;  2WPU A;  4BX6 A;  3RDQ A;  2OFA A;  5K67 A;  1SWA A;  2IZB A;  3SZI A;  4OKA A;  2IZK A;  3MG5 A;  2QCB A;  1VWE B;  2IZL B;  4BX7 A;  2BC3 A;  1MEP A;  2RTE B;  2GH7 A;  1WBI A;  2IZA A;  2RTR B;  2AVI A;  3RDO A;  1Y55 X;  1DF8 A;  2OF9 A;  2RTQ B;  3FDC A;  4GJV A;  1SRG A;  1NDJ A;  5IRW A;  1MK5 A;  1RSU B;  2IZF B;  1STR B;  2FHL A;  1RXH A;  2C1S A;  1SWN A;  3SZH A;  4JNJ A;  2RTP B;  4CPE A;  2RTF B;  1NBX A;  1SWO A;  3VHH A;  5K68 A;  3T2W A;  4BBO A;  4BJ8 A;  4CPH B;  4Z2V A;  1N43 A;  1HXZ A;  2Y32 A;  4GGT A;  1VWP B;  2OFB A;  1VWL B;  4BX5 B;  4GDA A;  2RTH B;  3X00 A;  4DNE A;  2IZH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...