1VWKB

Streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
pubmed doi rcsb
molecule tags Complex (biotin-binding protein/peptide)
total genus 26
structure length 123
sequence length 123
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vwkB00
1VWKB 3WZQA 4BX6B 4DNEA 2OFBA 1SRJA 1SWOA 1N9MA 1SLEB 1SWJA 2FHLA 3VGWA 3RDSA 2IZGB 1VWJB 1RSTB 1SWTA 1WBIA 1Y53X 1NQMA 2RTGB 4GGZA 1SWHA 1LCZA 1Y52X 2IZHB 1MEPA 2RTIB 1SLDB 3EW1A 1VWGB 1HXLA 1NQNA 1SRFA 1KFFA 1SWFA 2RTHB 2WPUA 4BX5B 2Y32A 2C1SA 4CPFA 4I60A 1STPA 2IZIA 1SREA 3SZJA 1VWQB 1RXHA 3T6LA 1SWDA 1DF8A 1SWUA 3RDUA 1I9HA 1SRIA 4Y5DA 1RAVA 4BX7A 2G5LA 3MG5A 3SZHA 1AVEA 4Y59A 3RY1A 1STRB 3SZIA 1HY2A 2RTBB 2C1QA 1HXZA 4BCSA 2RTCB 3RDQA 1SWKA 4Z27A 2IZCB 4CPHB 2IZAA 1SRGA 4Z2PA 1STSB 2ZSCA 1KL4A 2RTNB 3T6FA 2Y3FA 1VWMB 2A5CA 1VWRB 2F01A 2RTDB 1VWDB 2CAMA 5CHKA 3RDMA 4EKVA 1NBXA 1LCWA 3VHIA 1SWGA 5CSEA 4JO6A 4BBOA 2MF6A 1SWBA 3RDXA 1SWEA 2RTRB 1LUQA 2RTEB 2BC3A 4OKAA 2OF8A 4BX6A 2OF9A 1N43A 2UYWA 4GJSA 4Z6JA 1N7YA 1SLFB 2A8GA 4Z2VA 1IJ8A 2RTPB 4CPIA 3VHHA 2RTFB 2A5BA 5B5FA 1RXJA 2JGSA 3PK2A 4BJ8A 2RTMA 3X00A 2RTAA 1LDQA 1SWNA 5B5GA 5F2BA 1SWQA 3RE6A 4YVBA 2FHNX 5IRWA 4GJVA 1N4JA 2IZJA 2RTLA 3WYQA 4BX5A 4CPEA 1NC9A 1RSUB 1KL3A 1SWLA 1VWLB 1VWFB 4GGTA 1MOYA 1SRHA 4IRWA 5L3YA 2IZLB 4GDAA 4JHQA 4GGRA 4BX7B 1SLGB 4JNJA 1SWSA 3WZPA 1SWRA 2AVIA 3WYPA 3WZNA 3RDOA 1MM9A 1AVDA 1RXKA 1VWIB 5IRAA 2QCBA 5K68A 3VHMA 2IZFB 3RE5A 5JD2A 1LDOA 3WZOA 4CPHA 1VWOB 1MK5A 2RTOB 4Z2OA 3FDCA 2C4IA 1KL5A 1HQQA 2RTKA 3EW2A 5IRUA 1VWHB 2IZEB 2GH7A 2IZDB 3RY2A 3T2WA 1SWCA 2IZKA 1VWEB 1Y55X 2UZ2A 4U46A 1SWAA 1VWPB 3MM0A 2RTQB 3T2XA 2RTJA 1N9YA 1SWPA 1VWBB 1VWAB 4Z28A 1LELA 1NDJA 1PTSA 2OFAA 1VWCB 5K67A 2IZBA 1VWNB 2Y3EA 4GD9A 1LCVA 1VYOA
chains in the Genus database with same CATH superfamily
3WZQA 1ACDA 5H9AA 1BSYA 4BX6B 4DNEA 4XMDA 1SWOA 2QOMA 4GRJA 1S2PA 2ACPX 2OFMX 2QM9A 1GKAB 1JIWI 2IZGB 4I6SA 4O4XA 4ZGFA 2AT0X 5HZ6A 1KOIA 1ICMA 3B2JA 1NQMA 4GGZA 1KZWA 1SWHA 4I3BA 3WXQA 4QGWA 1GX3A 1O8VA 2IZHB 2MO5A 2AKQA 1HBQA 1EPBA 2X55A 3KFIA 1X8PA 3BLGA 1VWGB 4KIIA 5AJCA 1LPJA 2RTHB 3I17A 2WPUA 2KW1A 2OL6O 3P6GA 4YDAA 3VU1A 4AZPA 4BX5B 4MVEA 1KZXA 2X46A 2C1SA 3HOEA 5EDBA 1O1VA 1SREA 3SZJA 2X32A 3VG2A 2OZQA 3EYCA 1RXHA 4B55A 5F58A 2QO4A 3PPTA 1DFVA 1ERXA 4HPCA 3HPEA 3ZZVA 1OSPO 2HMBA 3HWEA 1RLBE 2GC9A 2W2FA 2A2UA 2AT8X 2CM9A 1ML7A 1AVEA 4MVIA 1TW4A 4XMEA 4CDCA 1EIOA 4FBVA 3D96A 1JJUA 2FLJA 2W2AA 4GUZA 1EXSA 2RTBB 3EC5A 4KT5A 4IB6A 1HXZA 4BCSA 2JMBA 1Z24A 5H8TA 3LV4A 4BGFA 3O22A 2L68A 1JYJA 2RQ0A 2OVDA 2DM5A 2ZSCA 3P6FA 5BYPA 5FFHA 2RTNB 1IFBA 4I3CA 3U0DA 3P24A 3LTWA 1VWRB 4KC7A 1DZJA 1B0OA 1UYNX 5D8JA 1FTPA 4IBAA 4OEMA 2A13A 1VWDB 4MIRA 1IKEA 1SXXA 5CE4A 3MBTA 3FMZA 1FENA 3F9DA 2X4MA 3HWDA 4ZHDA 4Y0SA 4NNSA 4ZH6A 5HAEA 1MUPA 3CKGA 5EZ2A 3ELXA 2R74A 1ZNGA 2GTLM 3AKMA 1I04A 1NP4A 4YCEA 3Q6LA 4KCAA 4AZQA 1BM5A 2UYWA 3BU1A 3GE2A 4XMHA 3UEXA 3F6ZB 3FA7A 5F1EA 1LIFA 1SLFB 2A8GA 3EM0A 4NW4A 4Z6JA 4GDZA 5B11O 3MX7A 1RBPA 2ZAGA 3FIQA 5B5FA 1RXJA 5K06A 1JZUA 1E02A 3JS1A 4ZHGA 4CV7A 3Q34A 1LDQA 3CBCA 2MHDA 2ALLX 1BEBA 5B5GA 3RE6A 3RWXA 2FHNX 2HZRA 2QO5A 3WBGA 3FIDA 4ES7A 4BQUA 1N4JA 2RTLA 3EMMA 4CPEA 1KT4A 2VFCA 4LQZA 4HFOA 1W6FA 3DTQA 1VWFB 1JV4A 2FRSA 1ALBA 3SAOA 4U3QA 4BOEA 1A57A 2FS7A 4GGRA 3KFGA 1BJ7A 1KT7A 1SMPI 1SWSA 3DSZA 3BS2A 3KFHA 2JN3A 1TOWA 1Y9LA 2G7BA 2OY1O 4ZR2A 3WZPA 5HZ8A 4ORUA 1B8EA 1OEKA 1YP6A 1AVGI 4O49A 4YDBA 5IO5A 4LKPA 1D3SA 1EIIA 4Y0RA 5K68A 1QY0A 4INNA 3VG3A 2IZFB 3RE5A 1QFVA 4QZTA 2NNEA 3CR6A 2M4LA 4CPHA 2FR2A 4GNWA 3RZYA 4AYHA 1KQXA 1EI5A 3FR5A 3GAQA 3EW2A 5IRUA 5AQ6A 2IZEB 2N93A 3T2WA 2IZDB 4O3XB 2Q4NA 5B3MO 1YWBA 2IZKA 2WWPA 5IO7A 4XMGA 5H9LA 3WJCA 3C78X 1PBOA 2MM3A 3BRNA 4IB8A 1N9YA 1SWPA 1VWBB 2HNXA 3L4RA 5KHPA 4DQ3A 3U03A 3HWGA 2FKJA 1PTSA 5K67A 1Y0GA 4NLIA 1DZMA 2IZBA 4IMOA 1P6PA 4I9SA 4O3ZA 1K3BA 4I3DA 4LKTA 1SRJA 3U9PC 1UZ2X 1Y9TA 4U8UO 1SWJA 2FHLA 5FQ8E 3VGWA 1OEJA 2PY1A 3UAQA 1SY2A 1KT3A 4GKCA 4ORYA 2WUTA 3FEPA 3FELA 1U17A 5HTEA 1Y53X 3V8UA 1QG5A 1ERBA 1MX7A 2K62A 2OYBO 1CJ5A 1FE3A 1MEPA 3FENA 4YKMA 5EEDA 3EW1A 1HXLA 1E06A 4IAWA 5LJGA 1G85A 2Y32A 3AEHA 3CKFA 3T1DA 4CPFA 1STPA 2IZIA 4FBRA 3ZW0B 4NP1A 1VWQB 1FEMA 5FAZA 4CSBA 2WEWA 2KTDA 1IW2A 3RDUA 2AMMX 3PQSA 4BX7A 4TKBA 1BLRA 3LHNA 4GE1A 2QOSC 3NQ3A 3UEUA 3SZHA 4ML7B 4L3RA 4A1HA 1I06A 3TGCA 4U8UN 4HPDA 1EALA 4Z27A 4Y0QA 3OBLA 2A2GA 4ZFXA 5C0NA 2X34A 4Z2PA 5DPQA 2L9CA 4TKJA 4O3WA 1T0VA 3WVMA 2OY8A 2RTDB 4RUUA 1A3YA 5CHKA 1JMXA 2FS6A 1TOUA 2JU3A 3APXA 5BVSA 1KXOA 1HQPA 4TKHA 3APUA 1LIBA 1GT5A 2PI3O 1NGLA 3AKNA 4AZMA 1KGLA 2RTRB 2AH7X 2RTEB 4M6SA 2BC3A 2HLVA 2OF8A 4BX6A 5HZ5A 2OF9A 1OBUA 2MWHA 3OD9A 1TXLA 3PH6A 5B10O 1GKAA 2RTPB 1D2UA 4MVKA 3P6DA 1ICNA 1GXAA 4ORRA 2AF5A 2RTFB 4CPIA 1BSOA 1I78A 1QABE 2I5ZO 3NPOA 3RKGA 4YMYA 5HTDA 1FJ1E 1EPAA 4YKOA 1CBQA 2RTAA 5FQ6E 5F2BA 3VG7A 2HZQA 4EQAC 2A3FX 5IRWA 1U0XA 3RBYA 3PDFA 2ASNX 1XKIA 2AT5X 2LA7A 2XKLA 4BX5A 3SLJA 5IXGA 3FR4A 2LFOA 3NQKA 5F7GA 1VWLB 4GGTA 4I95A 1MOYA 4IRWA 4UU3A 4A1YA 4ZJ0A 4YH0A 4ZGUA 4XMCA 4JHQA 4ZHCA 1A2DA 2LKKA 3MVFA 1QWDA 3FLLA 4AZOA 3WYPA 3CQRA 3P6HA 3RDOA 1PMPA 1MM9A 3ZW1B 2CM4A 2AT6X 2FWVA 4D6BA 2OL7A 4RUNA 5LKFA 4WFUA 3S5XA 1QY1A 2QO6A 4ODDA 3RSWA 4C5PA 4CDDA 3KFFA 3BDRA 1EUOA 1MK5A 2RTOB 4IABA 1A18A 5H9KA 4CDFA 1PEEA 2RTKA 3N91A 4IAXA 2DJFA 3VG5A 1SWCA 3FEKA 1CBRA 1FELA 1KT6A 4LZVA 4MISA 1LFOA 1SWAA 5CYBA 1GX8A 1VWPB 1OPBA 2RTQB 4M7MA 5KICA 1JJJA 3T2XA 5BVQA 4D6AA 2ACOA 2RTJA 2LB6A 1VWAB 4U9CA 4Z28A 2X8TA 1LELA 1NDJA 2A0AA 2OFAA 3PEDA 4ORSA 2KT4B 1VWNB 2Y3EA 4YFPA 3FA6A 3ZUOA 1VWKB 4YFRA 2OFBA 4HWMA 3UEWA 4DQ4A 4OMXA 1N9MA 3BX7A 4K19A 4BVMA 5JR8A 4YGHA 5L8IA 1RSTB 2RCQA 4ID2A 4EXZA 1GT3A 2HKDA 3OE3A 2X45A 1WBIA 4U8UM 3PH5A 3BSZE 1BSQA 2OVEA 2Q39A 1SLDB 2BT9A 4YBUA 1KFFA 1SY0A 2WEXA 5LJKA 2CZTA 1GGLA 2KTSA 3HK1A 2CZUA 2GJ5A 2P8GA 1X8UA 4I60A 5F6ZA 4HPBA 3FR2A 1HN2A 1VYFA 1XCAA 1S44A 4IB7A 1AELA 3T6LA 1E2TA 3P02A 3VE1A 1DF8A 4NYRA 5HZQA 1K24A 1GX9A 1S7DA 1SRIA 5HA1A 1IKJA 3MG5A 3ZQ3A 2L5PA 4Y59A 3RY1A 1UYOX 3SZIA 3CQNA 2F73A 3WJEA 2C1QA 2ZAIA 4CK4A 2RTCB 3RDQA 1SWKA 2OL8O 4A60A 3KQ0A 2IZCB 2DJGA 2Q9SA 2OY7A 2IZAA 3SLTA 2IFBA 1SRGA 3KZAA 1KL4A 1SXYA 3VE2A 5EDCA 1I05A 2I5VO 1VWMB 3S60A 3S26A 1OBPA 2ANSA 2MJIA 5LJHA 3APVA 4O4SA 2E4JA 2JW1A 5B2AO 3P6EA 1YWDA 2X8SA 2CAMA 5EPQA 3RDMA 4EKVA 1BWYA 1LCWA 1SA8A 5F6BA 5HA0A 4OMWA 3AUMO 4EEJA 2JU8A 1W4TA 1CBSA 1PM1X 4QNIA 5CSEA 4ORWA 3BY0A 1ZNEA 4BBOA 1JQPA 2MF6A 4N7CA 1SWBA 3B2LA 2POAA 1LUQA 5KIDA 2BHVA 5LJBA 4HPAA 4OKAA 1LKEA 2Q2PA 4QRLA 4QYPA 4OELA 4O4OA 1GT4A 2Q2MA 4KC8A 4Y0PA 3STKA 4Z2VA 1IJ8A 3NR3A 3VHHA 4GZVA 3TGBA 2A5BA 3CWKA 5IO6A 1G74A 1E00A 1H91A 1OEEA 1WUBA 2JGSA 2R56A 2RTMA 3HWFA 3I0AA 4NYQA 2BS5A 4QYNA 4OS3A 4BJ8A 2RCTA 3FYFA 3G7XA 4A8ZA 4AZRA 2RA6A 1JMZA 3NX2A 1OPAA 2G78A 2OVAA 3QKGA 1QFTA 2IZJA 5H9NA 4IB9A 1RSUB 1IIUA 1KL3A 1SWLA 2LBAA 3ZW0A 1SRHA 4MVLA 4XMFA 5L3YA 2RD7C 1X89A 2XSTA 4GDAA 3O19A 4AZNA 2CBSA 1ADLA 4O9SA 5D48A 3C76X 1HMSA 4ALOA 1IFCA 2BLGA 2AVIA 4YGGA 5LKEA 3ELZA 1RXKA 1AVDA 2G8CO 1BRQA 2VDFA 1VWIB 5IRAA 4TLJA 4LZUA 5HWZA 3TF6A 5LJCA 3SOTA 1OBQA 4KH8A 4QQ1A 1VWOB 3PECA 4Z2OA 1YIVA 4GETA 1KL5A 1HQQA 2X8FA 4GU8A 2GH7A 4ZCBA 3D9WA 4NV7A 5BVTA 5HBSA 2UZ2A 4U46A 3NBXX 4WBKA 4ZHFA 5HCCC 2GTFX 2Z4HA 1HBPA 1DC9A 1N0SA 5HZ9A 4GNYA 1DV9A 1MX8A 3EBWA 3FA9A 3UEVA 3HTYA 1UREA 1VWCB 1ZNKA 4QGXA 1GT1A 4GD9A 3TZSA 1ZNDA 5LJEA 3WJBA 1VYOA 1GM6A 3OJYC 4JGLA 4O3YA 1LF7A 1AB0A 1ZRYA 3JSQA 3P6CA 4YFQA 3ZWEA 1SLEB 1LNMA 5FQ7E 2FKGA 1DF3A 3ZI8A 3RDSA 2KD2A 1LICA 4PSQA 1VWJB 3IFBA 4YGZA 4AW8A 5D45A 4DCBA 1B56A 1ZNHA 3WJFA 1SWTA 2RTGB 3EBKA 1CBIA 2AT3X 1X8NA 1LCZA 1Y52X 3S5VA 2FGSA 3SLOA 5B27A 1DZKA 2RTIB 1PBYA 3VG4A 1NQNA 1SRFA 1SWFA 2JOZA 1BRPA 2NNDA 3VG6A 5B29A 1CRBA 3E3CA 1U18A 4GH7A 2HYSA 2O62A 2OVSA 1TVQA 3F8AA 4O4UA 3STMX 1JBHA 2FT9A 2QMIA 3ZW2A 1HMTA 2BSZA 4QGVA 1EQDA 1SWDA 4NLJA 1SWUA 3TGAA 3WJDA 2EU7X 1I9HA 4Y5DA 1RAVA 1T8VA 2G5LA 3D95A 4FGIB 3ZUIA 2BS6A 1STRB 1SXUA 4FBOA 2NNQA 4WFVA 1LIEA 3ZW1A 1HY2A 1L6MA 1MDCA 3H3IA 3K3LA 3PP6A 2W2BA 4OS8A 4CPHB 1QY2A 2R73A 2FTBA 3NX1A 1STSB 4GK9A 1LIDA 4TJZA 4EFGA 3T6FA 1X8QA 3FW5A 3CMPA 2Y3FA 2A5CA 4TQ2A 4ORXA 4WHIA 4L1NA 1O1UA 1QQSA 4OS0A 5HCEC 2F09A 2F01A 1NBXA 1YUPA 4UU2A 3B2KA 1EW3A 5D47A 1R0UA 3NQ9A 3VHIA 3WJGA 4IMNA 1YWAA 1SWGA 2GTLO 1SXWA 2X56A 2YG2A 3BX8A 5LJDA 4COTA 4JO6A 5AJBA 1SY3A 2L67A 3CBSA 3FA8A 1SWEA 3RDXA 2AL0X 1B4MA 4MEEA 2K23A 4ALBA 1HMRA 4I9RA 1N43A 2YMSA 2WQ9A 2OY5O 2WSJA 3B2HA 3B2IA 4GJSA 1N7YA 4ARHA 1G7NA 4CDEA 1FDQA 4TNNA 1VPRA 3PK2A 3X00A 5FENA 1VYGA 3BU9A 2VFBA 1SWNA 4YVBA 1DZPA 1SWQA 3KVNA 4GJVA 3WYQA 5L8OA 2FR3A 1NC9A 5AEOA 3HOLA 1X71A 2IZLB 4BX7B 2GTLN 3JQOA 1SLGB 3NADA 4JNJA 3APWA 1JYDA 1NP1A 4PJ2A 5D4AA 1G5WA 1SWRA 4N7DA 4YCHA 3WZNA 5DG4A 4ON1A 1AQBA 4FQBB 4R0BA 3VHMA 2QCBA 1SY1A 4ZH9A 2RN4A 5EEEA 3QQ2A 5JD2A 4YBPA 1LDOA 4NV8A 3WZOA 3FW4A 3D4RA 1X8OA 2G79A 1JJXA 2WQAE 1E5PA 3FDCA 2NP1A 2OFRX 2C4IA 2WR6A 3C77X 1KQWA 5HCDC 3RY2A 1VWHB 1YP7A 2Z4IA 3STNA 3D97A 1VWEB 1Y55X 1ZNLA 3O2YA 4QZUA 3MM0A 3PQUA 3IA8A 1KT5A 4QAEA 1T68X 2LBVA 1I4UA 1W5RA 1MVGA 2JU7A 4NNTA 4EDEA 4ZHHA 3NP1A 1YWCA 5L8NA 2CBRA 1LCVA 3WOVA 1BBPA 3VPJE
chains in the Genus database with same CATH topology
1VWKB 3WZQA 4BX6B 4DNEA 2OFBA 1SRJA 1SWOA 1N9MA 1SLEB 1SWJA 2FHLA 3VGWA 3RDSA 2IZGB 1VWJB 1RSTB 1SWTA 1WBIA 1Y53X 1NQMA 2RTGB 4GGZA 1SWHA 1LCZA 1Y52X 2IZHB 1MEPA 2RTIB 1SLDB 3EW1A 1VWGB 1HXLA 1NQNA 1SRFA 1KFFA 1SWFA 2RTHB 2WPUA 4BX5B 2Y32A 2C1SA 4CPFA 4I60A 1STPA 2IZIA 1SREA 3SZJA 1VWQB 1RXHA 3T6LA 1SWDA 1DF8A 1SWUA 3RDUA 1I9HA 1SRIA 4Y5DA 1RAVA 4BX7A 2G5LA 3MG5A 3SZHA 1AVEA 4Y59A 3RY1A 1STRB 3SZIA 1HY2A 2RTBB 2C1QA 1HXZA 4BCSA 2RTCB 3RDQA 1SWKA 4Z27A 2IZCB 4CPHB 2IZAA 1SRGA 4Z2PA 1STSB 2ZSCA 1KL4A 2RTNB 3T6FA 2Y3FA 1VWMB 2A5CA 1VWRB 2F01A 2RTDB 1VWDB 2CAMA 5CHKA 3RDMA 4EKVA 1NBXA 1LCWA 3VHIA 1SWGA 5CSEA 4JO6A 4BBOA 2MF6A 1SWBA 3RDXA 1SWEA 2RTRB 1LUQA 2RTEB 2BC3A 4OKAA 2OF8A 4BX6A 2OF9A 1N43A 2UYWA 4GJSA 4Z6JA 1N7YA 1SLFB 2A8GA 4Z2VA 1IJ8A 2RTPB 4CPIA 3VHHA 2RTFB 2A5BA 5B5FA 1RXJA 2JGSA 3PK2A 4BJ8A 2RTMA 3X00A 2RTAA 1LDQA 1SWNA 5B5GA 5F2BA 1SWQA 3RE6A 4YVBA 2FHNX 5IRWA 4GJVA 1N4JA 2IZJA 2RTLA 3WYQA 4BX5A 4CPEA 1NC9A 1RSUB 1KL3A 1SWLA 1VWLB 1VWFB 4GGTA 1MOYA 1SRHA 4IRWA 5L3YA 2IZLB 4GDAA 4JHQA 4GGRA 4BX7B 1SLGB 4JNJA 1SWSA 3WZPA 1SWRA 2AVIA 3WYPA 3WZNA 3RDOA 1MM9A 1AVDA 1RXKA 1VWIB 5IRAA 2QCBA 5K68A 3VHMA 2IZFB 3RE5A 5JD2A 1LDOA 3WZOA 4CPHA 1VWOB 1MK5A 2RTOB 4Z2OA 3FDCA 2C4IA 1KL5A 1HQQA 2RTKA 3EW2A 5IRUA 1VWHB 2IZEB 2GH7A 2IZDB 3RY2A 3T2WA 1SWCA 2IZKA 1VWEB 1Y55X 2UZ2A 4U46A 1SWAA 1VWPB 3MM0A 2RTQB 3T2XA 2RTJA 1N9YA 1SWPA 1VWBB 1VWAB 4Z28A 1LELA 1NDJA 1PTSA 2OFAA 1VWCB 5K67A 2IZBA 1VWNB 2Y3EA 4GD9A 1LCVA 1VYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VWK B;  3WZQ A;  4BX6 B;  4DNE A;  2OFB A;  1SRJ A;  1SWO A;  1N9M A;  1SLE B;  1SWJ A;  2FHL A;  3VGW A;  3RDS A;  2IZG B;  1VWJ B;  1RST B;  1SWT A;  1WBI A;  1Y53 X;  1NQM A;  2RTG B;  4GGZ A;  1SWH A;  1LCZ A;  1Y52 X;  2IZH B;  1MEP A;  2RTI B;  1SLD B;  3EW1 A;  1VWG B;  1HXL A;  1NQN A;  1SRF A;  1KFF A;  1SWF A;  2RTH B;  2WPU A;  4BX5 B;  2Y32 A;  2C1S A;  4CPF A;  4I60 A;  1STP A;  2IZI A;  1SRE A;  3SZJ A;  1VWQ B;  1RXH A;  3T6L A;  1SWD A;  1DF8 A;  1SWU A;  3RDU A;  1I9H A;  1SRI A;  4Y5D A;  1RAV A;  4BX7 A;  2G5L A;  3MG5 A;  3SZH A;  1AVE A;  4Y59 A;  3RY1 A;  1STR B;  3SZI A;  1HY2 A;  2RTB B;  2C1Q A;  1HXZ A;  4BCS A;  2RTC B;  3RDQ A;  1SWK A;  4Z27 A;  2IZC B;  4CPH B;  2IZA A;  1SRG A;  4Z2P A;  1STS B;  2ZSC A;  1KL4 A;  2RTN B;  3T6F A;  2Y3F A;  1VWM B;  2A5C A;  1VWR B;  2F01 A;  2RTD B;  1VWD B;  2CAM A;  5CHK A;  3RDM A;  4EKV A;  1NBX A;  1LCW A;  3VHI A;  1SWG A;  5CSE A;  4JO6 A;  4BBO A;  2MF6 A;  1SWB A;  3RDX A;  1SWE A;  2RTR B;  1LUQ A;  2RTE B;  2BC3 A;  4OKA A;  2OF8 A;  4BX6 A;  2OF9 A;  1N43 A;  2UYW A;  4GJS A;  4Z6J A;  1N7Y A;  1SLF B;  2A8G A;  4Z2V A;  1IJ8 A;  2RTP B;  4CPI A;  3VHH A;  2RTF B;  2A5B A;  5B5F A;  1RXJ A;  2JGS A;  3PK2 A;  4BJ8 A;  2RTM A;  3X00 A;  2RTA A;  1LDQ A;  1SWN A;  5B5G A;  5F2B A;  1SWQ A;  3RE6 A;  4YVB A;  2FHN X;  5IRW A;  4GJV A;  1N4J A;  2IZJ A;  2RTL A;  3WYQ A;  4BX5 A;  4CPE A;  1NC9 A;  1RSU B;  1KL3 A;  1SWL A;  1VWL B;  1VWF B;  4GGT A;  1MOY A;  1SRH A;  4IRW A;  5L3Y A;  2IZL B;  4GDA A;  4JHQ A;  4GGR A;  4BX7 B;  1SLG B;  4JNJ A;  1SWS A;  3WZP A;  1SWR A;  2AVI A;  3WYP A;  3WZN A;  3RDO A;  1MM9 A;  1AVD A;  1RXK A;  1VWI B;  5IRA A;  2QCB A;  5K68 A;  3VHM A;  2IZF B;  3RE5 A;  5JD2 A;  1LDO A;  3WZO A;  4CPH A;  1VWO B;  1MK5 A;  2RTO B;  4Z2O A;  3FDC A;  2C4I A;  1KL5 A;  1HQQ A;  2RTK A;  3EW2 A;  5IRU A;  1VWH B;  2IZE B;  2GH7 A;  2IZD B;  3RY2 A;  3T2W A;  1SWC A;  2IZK A;  1VWE B;  1Y55 X;  2UZ2 A;  4U46 A;  1SWA A;  1VWP B;  3MM0 A;  2RTQ B;  3T2X A;  2RTJ A;  1N9Y A;  1SWP A;  1VWB B;  1VWA B;  4Z28 A;  1LEL A;  1NDJ A;  1PTS A;  2OFA A;  1VWC B;  5K67 A;  2IZB A;  1VWN B;  2Y3E A;  4GD9 A;  1LCV A;  1VYO A; 
#chains in the Genus database with same CATH topology
 3WZQ A;  1ACD A;  5H9A A;  1BSY A;  4BX6 B;  4DNE A;  4XMD A;  1SWO A;  2QOM A;  4GRJ A;  1S2P A;  2ACP X;  2OFM X;  2QM9 A;  1GKA B;  1JIW I;  2IZG B;  4I6S A;  4O4X A;  4ZGF A;  2AT0 X;  5HZ6 A;  1KOI A;  1ICM A;  3B2J A;  1NQM A;  4GGZ A;  1KZW A;  1SWH A;  4I3B A;  3WXQ A;  4QGW A;  1GX3 A;  1O8V A;  2IZH B;  2MO5 A;  2AKQ A;  1HBQ A;  1EPB A;  2X55 A;  3KFI A;  1X8P A;  3BLG A;  1VWG B;  4KII A;  5AJC A;  1LPJ A;  2RTH B;  3I17 A;  2WPU A;  2KW1 A;  2OL6 O;  3P6G A;  4YDA A;  3VU1 A;  4AZP A;  4BX5 B;  4MVE A;  1KZX A;  2X46 A;  2C1S A;  3HOE A;  5EDB A;  1O1V A;  1SRE A;  3SZJ A;  2X32 A;  3VG2 A;  2OZQ A;  3EYC A;  1RXH A;  4B55 A;  5F58 A;  2QO4 A;  3PPT A;  1DFV A;  1ERX A;  4HPC A;  3HPE A;  3ZZV A;  1OSP O;  2HMB A;  3HWE A;  1RLB E;  2GC9 A;  2W2F A;  2A2U A;  2AT8 X;  2CM9 A;  1ML7 A;  1AVE A;  4MVI A;  1TW4 A;  4XME A;  4CDC A;  1EIO A;  4FBV A;  3D96 A;  1JJU A;  2FLJ A;  2W2A A;  4GUZ A;  1EXS A;  2RTB B;  3EC5 A;  4KT5 A;  4IB6 A;  1HXZ A;  4BCS A;  2JMB A;  1Z24 A;  5H8T A;  3LV4 A;  4BGF A;  3O22 A;  2L68 A;  1JYJ A;  2RQ0 A;  2OVD A;  2DM5 A;  2ZSC A;  3P6F A;  5BYP A;  5FFH A;  2RTN B;  1IFB A;  4I3C A;  3U0D A;  3P24 A;  3LTW A;  1VWR B;  4KC7 A;  1DZJ A;  1B0O A;  1UYN X;  5D8J A;  1FTP A;  4IBA A;  4OEM A;  2A13 A;  1VWD B;  4MIR A;  1IKE A;  1SXX A;  5CE4 A;  3MBT A;  3FMZ A;  1FEN A;  3F9D A;  2X4M A;  3HWD A;  4ZHD A;  4Y0S A;  4NNS A;  4ZH6 A;  5HAE A;  1MUP A;  3CKG A;  5EZ2 A;  3ELX A;  2R74 A;  1ZNG A;  2GTL M;  3AKM A;  1I04 A;  1NP4 A;  4YCE A;  3Q6L A;  4KCA A;  4AZQ A;  1BM5 A;  2UYW A;  3BU1 A;  3GE2 A;  4XMH A;  3UEX A;  3F6Z B;  3FA7 A;  5F1E A;  1LIF A;  1SLF B;  2A8G A;  3EM0 A;  4NW4 A;  4Z6J A;  4GDZ A;  5B11 O;  3MX7 A;  1RBP A;  2ZAG A;  3FIQ A;  5B5F A;  1RXJ A;  5K06 A;  1JZU A;  1E02 A;  3JS1 A;  4ZHG A;  4CV7 A;  3Q34 A;  1LDQ A;  3CBC A;  2MHD A;  2ALL X;  1BEB A;  5B5G A;  3RE6 A;  3RWX A;  2FHN X;  2HZR A;  2QO5 A;  3WBG A;  3FID A;  4ES7 A;  4BQU A;  1N4J A;  2RTL A;  3EMM A;  4CPE A;  1KT4 A;  2VFC A;  4LQZ A;  4HFO A;  1W6F A;  3DTQ A;  1VWF B;  1JV4 A;  2FRS A;  1ALB A;  3SAO A;  4U3Q A;  4BOE A;  1A57 A;  2FS7 A;  4GGR A;  3KFG A;  1BJ7 A;  1KT7 A;  1SMP I;  1SWS A;  3DSZ A;  3BS2 A;  3KFH A;  2JN3 A;  1TOW A;  1Y9L A;  2G7B A;  2OY1 O;  4ZR2 A;  3WZP A;  5HZ8 A;  4ORU A;  1B8E A;  1OEK A;  1YP6 A;  1AVG I;  4O49 A;  4YDB A;  5IO5 A;  4LKP A;  1D3S A;  1EII A;  4Y0R A;  5K68 A;  1QY0 A;  4INN A;  3VG3 A;  2IZF B;  3RE5 A;  1QFV A;  4QZT A;  2NNE A;  3CR6 A;  2M4L A;  4CPH A;  2FR2 A;  4GNW A;  3RZY A;  4AYH A;  1KQX A;  1EI5 A;  3FR5 A;  3GAQ A;  3EW2 A;  5IRU A;  5AQ6 A;  2IZE B;  2N93 A;  3T2W A;  2IZD B;  4O3X B;  2Q4N A;  5B3M O;  1YWB A;  2IZK A;  2WWP A;  5IO7 A;  4XMG A;  5H9L A;  3WJC A;  3C78 X;  1PBO A;  2MM3 A;  3BRN A;  4IB8 A;  1N9Y A;  1SWP A;  1VWB B;  2HNX A;  3L4R A;  5KHP A;  4DQ3 A;  3U03 A;  3HWG A;  2FKJ A;  1PTS A;  5K67 A;  1Y0G A;  4NLI A;  1DZM A;  2IZB A;  4IMO A;  1P6P A;  4I9S A;  4O3Z A;  1K3B A;  4I3D A;  4LKT A;  1SRJ A;  3U9P C;  1UZ2 X;  1Y9T A;  4U8U O;  1SWJ A;  2FHL A;  5FQ8 E;  3VGW A;  1OEJ A;  2PY1 A;  3UAQ A;  1SY2 A;  1KT3 A;  4GKC A;  4ORY A;  2WUT A;  3FEP A;  3FEL A;  1U17 A;  5HTE A;  1Y53 X;  3V8U A;  1QG5 A;  1ERB A;  1MX7 A;  2K62 A;  2OYB O;  1CJ5 A;  1FE3 A;  1MEP A;  3FEN A;  4YKM A;  5EED A;  3EW1 A;  1HXL A;  1E06 A;  4IAW A;  5LJG A;  1G85 A;  2Y32 A;  3AEH A;  3CKF A;  3T1D A;  4CPF A;  1STP A;  2IZI A;  4FBR A;  3ZW0 B;  4NP1 A;  1VWQ B;  1FEM A;  5FAZ A;  4CSB A;  2WEW A;  2KTD A;  1IW2 A;  3RDU A;  2AMM X;  3PQS A;  4BX7 A;  4TKB A;  1BLR A;  3LHN A;  4GE1 A;  2QOS C;  3NQ3 A;  3UEU A;  3SZH A;  4ML7 B;  4L3R A;  4A1H A;  1I06 A;  3TGC A;  4U8U N;  4HPD A;  1EAL A;  4Z27 A;  4Y0Q A;  3OBL A;  2A2G A;  4ZFX A;  5C0N A;  2X34 A;  4Z2P A;  5DPQ A;  2L9C A;  4TKJ A;  4O3W A;  1T0V A;  3WVM A;  2OY8 A;  2RTD B;  4RUU A;  1A3Y A;  5CHK A;  1JMX A;  2FS6 A;  1TOU A;  2JU3 A;  3APX A;  5BVS A;  1KXO A;  1HQP A;  4TKH A;  3APU A;  1LIB A;  1GT5 A;  2PI3 O;  1NGL A;  3AKN A;  4AZM A;  1KGL A;  2RTR B;  2AH7 X;  2RTE B;  4M6S A;  2BC3 A;  2HLV A;  2OF8 A;  4BX6 A;  5HZ5 A;  2OF9 A;  1OBU A;  2MWH A;  3OD9 A;  1TXL A;  3PH6 A;  5B10 O;  1GKA A;  2RTP B;  1D2U A;  4MVK A;  3P6D A;  1ICN A;  1GXA A;  4ORR A;  2AF5 A;  2RTF B;  4CPI A;  1BSO A;  1I78 A;  1QAB E;  2I5Z O;  3NPO A;  3RKG A;  4YMY A;  5HTD A;  1FJ1 E;  1EPA A;  4YKO A;  1CBQ A;  2RTA A;  5FQ6 E;  5F2B A;  3VG7 A;  2HZQ A;  4EQA C;  2A3F X;  5IRW A;  1U0X A;  3RBY A;  3PDF A;  2ASN X;  1XKI A;  2AT5 X;  2LA7 A;  2XKL A;  4BX5 A;  3SLJ A;  5IXG A;  3FR4 A;  2LFO A;  3NQK A;  5F7G A;  1VWL B;  4GGT A;  4I95 A;  1MOY A;  4IRW A;  4UU3 A;  4A1Y A;  4ZJ0 A;  4YH0 A;  4ZGU A;  4XMC A;  4JHQ A;  4ZHC A;  1A2D A;  2LKK A;  3MVF A;  1QWD A;  3FLL A;  4AZO A;  3WYP A;  3CQR A;  3P6H A;  3RDO A;  1PMP A;  1MM9 A;  3ZW1 B;  2CM4 A;  2AT6 X;  2FWV A;  4D6B A;  2OL7 A;  4RUN A;  5LKF A;  4WFU A;  3S5X A;  1QY1 A;  2QO6 A;  4ODD A;  3RSW A;  4C5P A;  4CDD A;  3KFF A;  3BDR A;  1EUO A;  1MK5 A;  2RTO B;  4IAB A;  1A18 A;  5H9K A;  4CDF A;  1PEE A;  2RTK A;  3N91 A;  4IAX A;  2DJF A;  3VG5 A;  1SWC A;  3FEK A;  1CBR A;  1FEL A;  1KT6 A;  4LZV A;  4MIS A;  1LFO A;  1SWA A;  5CYB A;  1GX8 A;  1VWP B;  1OPB A;  2RTQ B;  4M7M A;  5KIC A;  1JJJ A;  3T2X A;  5BVQ A;  4D6A A;  2ACO A;  2RTJ A;  2LB6 A;  1VWA B;  4U9C A;  4Z28 A;  2X8T A;  1LEL A;  1NDJ A;  2A0A A;  2OFA A;  3PED A;  4ORS A;  2KT4 B;  1VWN B;  2Y3E A;  4YFP A;  3FA6 A;  3ZUO A;  1VWK B;  4YFR A;  2OFB A;  4HWM A;  3UEW A;  4DQ4 A;  4OMX A;  1N9M A;  3BX7 A;  4K19 A;  4BVM A;  5JR8 A;  4YGH A;  5L8I A;  1RST B;  2RCQ A;  4ID2 A;  4EXZ A;  1GT3 A;  2HKD A;  3OE3 A;  2X45 A;  1WBI A;  4U8U M;  3PH5 A;  3BSZ E;  1BSQ A;  2OVE A;  2Q39 A;  1SLD B;  2BT9 A;  4YBU A;  1KFF A;  1SY0 A;  2WEX A;  5LJK A;  2CZT A;  1GGL A;  2KTS A;  3HK1 A;  2CZU A;  2GJ5 A;  2P8G A;  1X8U A;  4I60 A;  5F6Z A;  4HPB A;  3FR2 A;  1HN2 A;  1VYF A;  1XCA A;  1S44 A;  4IB7 A;  1AEL A;  3T6L A;  1E2T A;  3P02 A;  3VE1 A;  1DF8 A;  4NYR A;  5HZQ A;  1K24 A;  1GX9 A;  1S7D A;  1SRI A;  5HA1 A;  1IKJ A;  3MG5 A;  3ZQ3 A;  2L5P A;  4Y59 A;  3RY1 A;  1UYO X;  3SZI A;  3CQN A;  2F73 A;  3WJE A;  2C1Q A;  2ZAI A;  4CK4 A;  2RTC B;  3RDQ A;  1SWK A;  2OL8 O;  4A60 A;  3KQ0 A;  2IZC B;  2DJG A;  2Q9S A;  2OY7 A;  2IZA A;  3SLT A;  2IFB A;  1SRG A;  3KZA A;  1KL4 A;  1SXY A;  3VE2 A;  5EDC A;  1I05 A;  2I5V O;  1VWM B;  3S60 A;  3S26 A;  1OBP A;  2ANS A;  2MJI A;  5LJH A;  3APV A;  4O4S A;  2E4J A;  2JW1 A;  5B2A O;  3P6E A;  1YWD A;  2X8S A;  2CAM A;  5EPQ A;  3RDM A;  4EKV A;  1BWY A;  1LCW A;  1SA8 A;  5F6B A;  5HA0 A;  4OMW A;  3AUM O;  4EEJ A;  2JU8 A;  1W4T A;  1CBS A;  1PM1 X;  4QNI A;  5CSE A;  4ORW A;  3BY0 A;  1ZNE A;  4BBO A;  1JQP A;  2MF6 A;  4N7C A;  1SWB A;  3B2L A;  2POA A;  1LUQ A;  5KID A;  2BHV A;  5LJB A;  4HPA A;  4OKA A;  1LKE A;  2Q2P A;  4QRL A;  4QYP A;  4OEL A;  4O4O A;  1GT4 A;  2Q2M A;  4KC8 A;  4Y0P A;  3STK A;  4Z2V A;  1IJ8 A;  3NR3 A;  3VHH A;  4GZV A;  3TGB A;  2A5B A;  3CWK A;  5IO6 A;  1G74 A;  1E00 A;  1H91 A;  1OEE A;  1WUB A;  2JGS A;  2R56 A;  2RTM A;  3HWF A;  3I0A A;  4NYQ A;  2BS5 A;  4QYN A;  4OS3 A;  4BJ8 A;  2RCT A;  3FYF A;  3G7X A;  4A8Z A;  4AZR A;  2RA6 A;  1JMZ A;  3NX2 A;  1OPA A;  2G78 A;  2OVA A;  3QKG A;  1QFT A;  2IZJ A;  5H9N A;  4IB9 A;  1RSU B;  1IIU A;  1KL3 A;  1SWL A;  2LBA A;  3ZW0 A;  1SRH A;  4MVL A;  4XMF A;  5L3Y A;  2RD7 C;  1X89 A;  2XST A;  4GDA A;  3O19 A;  4AZN A;  2CBS A;  1ADL A;  4O9S A;  5D48 A;  3C76 X;  1HMS A;  4ALO A;  1IFC A;  2BLG A;  2AVI A;  4YGG A;  5LKE A;  3ELZ A;  1RXK A;  1AVD A;  2G8C O;  1BRQ A;  2VDF A;  1VWI B;  5IRA A;  4TLJ A;  4LZU A;  5HWZ A;  3TF6 A;  5LJC A;  3SOT A;  1OBQ A;  4KH8 A;  4QQ1 A;  1VWO B;  3PEC A;  4Z2O A;  1YIV A;  4GET A;  1KL5 A;  1HQQ A;  2X8F A;  4GU8 A;  2GH7 A;  4ZCB A;  3D9W A;  4NV7 A;  5BVT A;  5HBS A;  2UZ2 A;  4U46 A;  3NBX X;  4WBK A;  4ZHF A;  5HCC C;  2GTF X;  2Z4H A;  1HBP A;  1DC9 A;  1N0S A;  5HZ9 A;  4GNY A;  1DV9 A;  1MX8 A;  3EBW A;  3FA9 A;  3UEV A;  3HTY A;  1URE A;  1VWC B;  1ZNK A;  4QGX A;  1GT1 A;  4GD9 A;  3TZS A;  1ZND A;  5LJE A;  3WJB A;  1VYO A;  1GM6 A;  3OJY C;  4JGL A;  4O3Y A;  1LF7 A;  1AB0 A;  1ZRY A;  3JSQ A;  3P6C A;  4YFQ A;  3ZWE A;  1SLE B;  1LNM A;  5FQ7 E;  2FKG A;  1DF3 A;  3ZI8 A;  3RDS A;  2KD2 A;  1LIC A;  4PSQ A;  1VWJ B;  3IFB A;  4YGZ A;  4AW8 A;  5D45 A;  4DCB A;  1B56 A;  1ZNH A;  3WJF A;  1SWT A;  2RTG B;  3EBK A;  1CBI A;  2AT3 X;  1X8N A;  1LCZ A;  1Y52 X;  3S5V A;  2FGS A;  3SLO A;  5B27 A;  1DZK A;  2RTI B;  1PBY A;  3VG4 A;  1NQN A;  1SRF A;  1SWF A;  2JOZ A;  1BRP A;  2NND A;  3VG6 A;  5B29 A;  1CRB A;  3E3C A;  1U18 A;  4GH7 A;  2HYS A;  2O62 A;  2OVS A;  1TVQ A;  3F8A A;  4O4U A;  3STM X;  1JBH A;  2FT9 A;  2QMI A;  3ZW2 A;  1HMT A;  2BSZ A;  4QGV A;  1EQD A;  1SWD A;  4NLJ A;  1SWU A;  3TGA A;  3WJD A;  2EU7 X;  1I9H A;  4Y5D A;  1RAV A;  1T8V A;  2G5L A;  3D95 A;  4FGI B;  3ZUI A;  2BS6 A;  1STR B;  1SXU A;  4FBO A;  2NNQ A;  4WFV A;  1LIE A;  3ZW1 A;  1HY2 A;  1L6M A;  1MDC A;  3H3I A;  3K3L A;  3PP6 A;  2W2B A;  4OS8 A;  4CPH B;  1QY2 A;  2R73 A;  2FTB A;  3NX1 A;  1STS B;  4GK9 A;  1LID A;  4TJZ A;  4EFG A;  3T6F A;  1X8Q A;  3FW5 A;  3CMP A;  2Y3F A;  2A5C A;  4TQ2 A;  4ORX A;  4WHI A;  4L1N A;  1O1U A;  1QQS A;  4OS0 A;  5HCE C;  2F09 A;  2F01 A;  1NBX A;  1YUP A;  4UU2 A;  3B2K A;  1EW3 A;  5D47 A;  1R0U A;  3NQ9 A;  3VHI A;  3WJG A;  4IMN A;  1YWA A;  1SWG A;  2GTL O;  1SXW A;  2X56 A;  2YG2 A;  3BX8 A;  5LJD A;  4COT A;  4JO6 A;  5AJB A;  1SY3 A;  2L67 A;  3CBS A;  3FA8 A;  1SWE A;  3RDX A;  2AL0 X;  1B4M A;  4MEE A;  2K23 A;  4ALB A;  1HMR A;  4I9R A;  1N43 A;  2YMS A;  2WQ9 A;  2OY5 O;  2WSJ A;  3B2H A;  3B2I A;  4GJS A;  1N7Y A;  4ARH A;  1G7N A;  4CDE A;  1FDQ A;  4TNN A;  1VPR A;  3PK2 A;  3X00 A;  5FEN A;  1VYG A;  3BU9 A;  2VFB A;  1SWN A;  4YVB A;  1DZP A;  1SWQ A;  3KVN A;  4GJV A;  3WYQ A;  5L8O A;  2FR3 A;  1NC9 A;  5AEO A;  3HOL A;  1X71 A;  2IZL B;  4BX7 B;  2GTL N;  3JQO A;  1SLG B;  3NAD A;  4JNJ A;  3APW A;  1JYD A;  1NP1 A;  4PJ2 A;  5D4A A;  1G5W A;  1SWR A;  4N7D A;  4YCH A;  3WZN A;  5DG4 A;  4ON1 A;  1AQB A;  4FQB B;  4R0B A;  3VHM A;  2QCB A;  1SY1 A;  4ZH9 A;  2RN4 A;  5EEE A;  3QQ2 A;  5JD2 A;  4YBP A;  1LDO A;  4NV8 A;  3WZO A;  3FW4 A;  3D4R A;  1X8O A;  2G79 A;  1JJX A;  2WQA E;  1E5P A;  3FDC A;  2NP1 A;  2OFR X;  2C4I A;  2WR6 A;  3C77 X;  1KQW A;  5HCD C;  3RY2 A;  1VWH B;  1YP7 A;  2Z4I A;  3STN A;  3D97 A;  1VWE B;  1Y55 X;  1ZNL A;  3O2Y A;  4QZU A;  3MM0 A;  3PQU A;  3IA8 A;  1KT5 A;  4QAE A;  1T68 X;  2LBV A;  1I4U A;  1W5R A;  1MVG A;  2JU7 A;  4NNT A;  4EDE A;  4ZHH A;  3NP1 A;  1YWC A;  5L8N A;  2CBR A;  1LCV A;  3WOV A;  1BBP A;  3VPJ E; 
#chains in the Genus database with same CATH homology
 1VWK B;  3WZQ A;  4BX6 B;  4DNE A;  2OFB A;  1SRJ A;  1SWO A;  1N9M A;  1SLE B;  1SWJ A;  2FHL A;  3VGW A;  3RDS A;  2IZG B;  1VWJ B;  1RST B;  1SWT A;  1WBI A;  1Y53 X;  1NQM A;  2RTG B;  4GGZ A;  1SWH A;  1LCZ A;  1Y52 X;  2IZH B;  1MEP A;  2RTI B;  1SLD B;  3EW1 A;  1VWG B;  1HXL A;  1NQN A;  1SRF A;  1KFF A;  1SWF A;  2RTH B;  2WPU A;  4BX5 B;  2Y32 A;  2C1S A;  4CPF A;  4I60 A;  1STP A;  2IZI A;  1SRE A;  3SZJ A;  1VWQ B;  1RXH A;  3T6L A;  1SWD A;  1DF8 A;  1SWU A;  3RDU A;  1I9H A;  1SRI A;  4Y5D A;  1RAV A;  4BX7 A;  2G5L A;  3MG5 A;  3SZH A;  1AVE A;  4Y59 A;  3RY1 A;  1STR B;  3SZI A;  1HY2 A;  2RTB B;  2C1Q A;  1HXZ A;  4BCS A;  2RTC B;  3RDQ A;  1SWK A;  4Z27 A;  2IZC B;  4CPH B;  2IZA A;  1SRG A;  4Z2P A;  1STS B;  2ZSC A;  1KL4 A;  2RTN B;  3T6F A;  2Y3F A;  1VWM B;  2A5C A;  1VWR B;  2F01 A;  2RTD B;  1VWD B;  2CAM A;  5CHK A;  3RDM A;  4EKV A;  1NBX A;  1LCW A;  3VHI A;  1SWG A;  5CSE A;  4JO6 A;  4BBO A;  2MF6 A;  1SWB A;  3RDX A;  1SWE A;  2RTR B;  1LUQ A;  2RTE B;  2BC3 A;  4OKA A;  2OF8 A;  4BX6 A;  2OF9 A;  1N43 A;  2UYW A;  4GJS A;  4Z6J A;  1N7Y A;  1SLF B;  2A8G A;  4Z2V A;  1IJ8 A;  2RTP B;  4CPI A;  3VHH A;  2RTF B;  2A5B A;  5B5F A;  1RXJ A;  2JGS A;  3PK2 A;  4BJ8 A;  2RTM A;  3X00 A;  2RTA A;  1LDQ A;  1SWN A;  5B5G A;  5F2B A;  1SWQ A;  3RE6 A;  4YVB A;  2FHN X;  5IRW A;  4GJV A;  1N4J A;  2IZJ A;  2RTL A;  3WYQ A;  4BX5 A;  4CPE A;  1NC9 A;  1RSU B;  1KL3 A;  1SWL A;  1VWL B;  1VWF B;  4GGT A;  1MOY A;  1SRH A;  4IRW A;  5L3Y A;  2IZL B;  4GDA A;  4JHQ A;  4GGR A;  4BX7 B;  1SLG B;  4JNJ A;  1SWS A;  3WZP A;  1SWR A;  2AVI A;  3WYP A;  3WZN A;  3RDO A;  1MM9 A;  1AVD A;  1RXK A;  1VWI B;  5IRA A;  2QCB A;  5K68 A;  3VHM A;  2IZF B;  3RE5 A;  5JD2 A;  1LDO A;  3WZO A;  4CPH A;  1VWO B;  1MK5 A;  2RTO B;  4Z2O A;  3FDC A;  2C4I A;  1KL5 A;  1HQQ A;  2RTK A;  3EW2 A;  5IRU A;  1VWH B;  2IZE B;  2GH7 A;  2IZD B;  3RY2 A;  3T2W A;  1SWC A;  2IZK A;  1VWE B;  1Y55 X;  2UZ2 A;  4U46 A;  1SWA A;  1VWP B;  3MM0 A;  2RTQ B;  3T2X A;  2RTJ A;  1N9Y A;  1SWP A;  1VWB B;  1VWA B;  4Z28 A;  1LEL A;  1NDJ A;  1PTS A;  2OFA A;  1VWC B;  5K67 A;  2IZB A;  1VWN B;  2Y3E A;  4GD9 A;  1LCV A;  1VYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...