1VWMB

Streptavidin-cyclo-ac-[chpqfc]-nh2, ph 4.2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
121
Chain Sequence
b'AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTAVIDIN
publication title In crystals of complexes of streptavidin with peptide ligands containing the HPQ sequence the pKa of the peptide histidine is less than 3.0.
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Complex (biotin-binding protein/peptide)
total genus 24
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 1997-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vwmB00
1SLGB 1SWOA 1AVEA 1AVDA 1N4JA 3RDQA 3SZHA 4IRWA 1Y55X 1LDOA 1VWRB 2IZFB 2RTOB 5CHKA 2OF9A 1MM9A 1VWPB 1SRHA 3RY2A 3WZNA 1KL5A 1MK5A 2C1SA 1SWTA 5IRUA 1SWDA 3RDSA 1VWBB 1NQMA 3RDXA 4Y5DA 1SWRA 1VWHB 2GH7A 2IZAA 4BCSA 4GD9A 1SWGA 1NC9A 4GGZA 1VWQB 1SLDB 1LCWA 1SWEA 2UYWA 2RTCB 3RDMA 3WZQA 4Z27A 5K67A 4Z6JA 2Y3FA 1SRFA 1NBXA 1VWFB 2BC3A 2RTRB 1N7YA 4Z28A 2RTGB 4BJ8A 2IZKA 2RTEB 1VWMB 4CPHA 2A8GA 4JHQA 5F2BA 3SZJA 1NDJA 4YVBA 1SWBA 1PTSA 4GDAA 3T6FA 1LCVA 1SLFB 1STSB 2RTLA 3RE5A 4BX5B 2QCBA 1VWJB 5IRWA 1KL3A 4I60A 4CPFA 1SWPA 4EKVA 1SWNA 2WPUA 2AVIA 1SRGA 1RXJA 1Y52X 4Z2OA 4CPEA 1HY2A 5L3YA 3VHIA 2Y32A 1DF8A 1RXHA 4GJSA 2UZ2A 1LDQA 3VGWA 2IZCB 1RSUB 2IZGB 2RTKA 2IZDB 1SWUA 2F01A 4BX7A 5IRAA 1HXLA 2IZIA 2IZEB 1SRIA 1KFFA 2OFBA 1IJ8A 1N9YA 3MG5A 4GJVA 3RE6A 3MM0A 2OFAA 5B5GA 1SRJA 3T6LA 1KL4A 3RDOA 4Z2PA 1I9HA 2IZJA 2FHNX 1HQQA 3SZIA 2OF8A 1MEPA 4OKAA 2IZBA 1SWCA 3WZPA 3EW2A 1SWFA 1VWKB 1SWHA 3T2XA 2RTDB 2C4IA 2MF6A 2C1QA 3PK2A 2RTQB 4DNEA 1LCZA 2RTBB 1SWSA 3WZOA 1MOYA 1RSTB 1LELA 1VWNB 1VWIB 1VWOB 2RTFB 4CPHB 2FHLA 1VWAB 3X00A 1WBIA 1SWQA 4JNJA 2JGSA 5JD2A 1VWCB 4Y59A 3T2WA 5K68A 1VWGB 1VWDB 1STPA 3WYQA 1RAVA 2IZHB 2IZLB 2RTNB 4Z2VA 1SREA 4CPIA 1SWJA 2CAMA 1Y53X 3RY1A 4JO6A 4BX6A 1STRB 3EW1A 1N9MA 2RTJA 4BX7B 2ZSCA 5B5FA 2RTIB 2RTMA 3RDUA 4BX5A 2A5BA 4GGTA 2G5LA 1SWLA 1VWEB 1VWLB 4BBOA 2RTAA 1N43A 3FDCA 1HXZA 2Y3EA 1SLEB 3VHMA 1LUQA 2A5CA 1RXKA 3VHHA 1SWKA 3WYPA 2RTPB 4BX6B 4U46A 4GGRA 5CSEA 1NQNA 1VYOA 2RTHB 1SWAA
chains in the Genus database with same CATH superfamily
3PDFA 2AF5A 2FGSA 1HBPA 4AZPA 4IABA 5LJBA 4HPDA 1ERXA 1MDCA 1X8OA 3VG3A 1HBQA 4BGFA 3FR5A 2OVEA 5HWZA 1BRPA 1LDOA 1A2DA 1KXOA 1VWRB 1ZNLA 1JJUA 2BS6A 2ZAIA 4XMDA 4L3RA 5CHKA 1VWPB 2OY7A 5LKEA 2KTDA 3HPEA 4ALBA 5HCDC 1KL5A 1OBQA 3UEWA 3RDXA 4O4OA 3BDRA 1SXUA 1FELA 4BVMA 5LJEA 1SWRA 1YUPA 2IZAA 2Q4NA 1JQPA 2X55A 3KQ0A 3P6DA 4GD9A 1KGLA 1LKEA 4EFGA 3ELZA 1LCWA 1PBOA 3HWFA 1LF7A 5D47A 1NBXA 1OSPO 1BSYA 2BC3A 2RCTA 3F6ZB 1B4MA 3H3IA 2RTGB 3WJFA 4I3DA 1FTPA 1VWMB 3G7XA 2A8GA 1T8VA 2BSZA 1HMRA 5EZ2A 2OVDA 4GDAA 5HZ6A 5H9KA 2KD2A 4ZFXA 1STSB 2RTLA 1W4TA 4GDZA 2OVAA 2QCBA 2HMBA 2QOSC 2X34A 4I60A 5B2AO 1SWPA 1LPJA 2GTLO 4EKVA 2HZRA 2FKGA 4UU3A 1OPBA 4XMFA 3VE2A 1JJXA 4ALOA 2AVIA 4ON1A 1SRGA 1IW2A 4QZTA 4TKHA 5LJHA 1KOIA 2ZAGA 1LIDA 4KC7A 1CBQA 3BS2A 1A18A 2G8CO 2IZGB 1MX7A 4ORYA 4CDDA 2F01A 5IRAA 4ZHFA 1HXLA 1HQPA 2IZIA 1KQWA 5F58A 1SRIA 1KFFA 4WFUA 1VYFA 1Z24A 1Y9TA 1IJ8A 1KZXA 3CQNA 2M4LA 4IB6A 5FQ7E 3UEXA 3F9DA 4YFQA 1YWAA 1SRJA 1HMSA 1KL4A 2W2AA 3EBKA 4GZVA 3P02A 4QAEA 3RDOA 4AZQA 1KZWA 1GT4A 3HWDA 2OF8A 1QFTA 1TVQA 3LTWA 1SWCA 3WZPA 4MVEA 1SWFA 1BJ7A 1VWKB 1SWHA 1E2TA 3QQ2A 5FAZA 3SLOA 5HA0A 2NP1A 4CK4A 5CE4A 4GKCA 2YG2A 3VG7A 1LFOA 3APUA 1OBUA 5F7GA 3D96A 4DNEA 1LCZA 4TQ2A 1SWSA 3WZOA 2FS7A 1MOYA 1RSTB 1LELA 1VWNB 2WUTA 3FA8A 3K3LA 1I78A 4ML7B 4QZUA 4B55A 4YGZA 2Q39A 4AZRA 1ML7A 3WOVA 2IFBA 4AYHA 2L67A 2MJIA 4JNJA 4EXZA 5BVTA 5JD2A 1VYGA 3AKNA 1HN2A 1VWCB 3OBLA 1YP7A 3PPTA 3S5VA 2JMBA 1U18A 1CBRA 3T1DA 3FIDA 1STPA 3WYQA 2IZHB 1QG5A 2RA6A 2RTNB 5DG4A 1JYJA 2MHDA 1DV9A 1GT1A 3NBXX 4GK9A 3RY1A 4BX6A 4O3WA 1I4UA 1STRB 5DPQA 3IA8A 3CKFA 3S5XA 2W2FA 5AJBA 1KT4A 2AKQA 4N7DA 4OS8A 1U0XA 3RDUA 5F6BA 2OYBO 3ZW1A 2G5LA 1SWLA 1CJ5A 2R74A 4ORSA 3U03A 1N43A 2AT6X 3CKGA 2WEWA 5LKFA 1SLEB 3F8AA 3TZSA 1ZRYA 5FENA 4CDCA 5EEEA 4QGXA 2HYSA 2FR2A 4U46A 2CZUA 5CSEA 4ORXA 1VYOA 4YH0A 3PQUA 3GE2A 3KZAA 4YCHA 2A2GA 5LJKA 1N0SA 1JBHA 1AVEA 4A1YA 1N4JA 3SZHA 4IRWA 2X56A 3AKMA 5FQ6E 2FR3A 2JN3A 3P24A 1GKAA 1X8PA 4ORWA 4YKMA 3WXQA 2OF9A 2L68A 1D2UA 3D95A 3WZNA 2ACOA 3WJEA 3B2KA 2R56A 2C1SA 2ASNX 4YFRA 2ACPX 1SWDA 3APVA 2ANSA 1NQMA 2FKJA 1EALA 2W2BA 2Z4IA 2FT9A 1SWGA 2CM9A 2OL8O 2OZQA 2LBAA 3EC5A 1VWQB 4GGZA 1SLDB 2UYWA 5K06A 3WJCA 4D6BA 1XKIA 5D48A 1IIUA 1GX8A 1N7YA 2G79A 1UREA 3AEHA 3HOEA 4DQ3A 4BJ8A 2IZKA 3WJBA 2RQ0A 1JIWI 4OEMA 5F2BA 3SZJA 2RD7C 4HPCA 1PMPA 2CBSA 1PTSA 4Y0PA 1RLBE 1SLFB 4UU2A 1A3YA 2QO5A 4IAXA 1OEJA 3D97A 4EQAC 4CPFA 1EQDA 3VHMA 1CBIA 1X8NA 2A2UA 1G7NA 2WPUA 4QRLA 1S7DA 2BT9A 3UEUA 1I04A 2K23A 3DTQA 4LKPA 3FW4A 1PEEA 4TKBA 5D45A 2Y32A 3VHIA 5HCCC 5HZ8A 1DF8A 1RXHA 1H91A 1VPRA 4GJSA 5IO5A 3TGCA 2G7BA 2POAA 3B2IA 3C77X 2FLJA 3NR3A 3D4RA 1YWBA 2IZDB 3B2JA 4IMNA 1SWUA 4MVLA 1Y9LA 1YWCA 3N91A 4GU8A 3RBYA 3LHNA 2KT4B 4ZHDA 1W6FA 1S44A 3FIQA 3RE6A 2WQAE 1ZNGA 3ZW2A 3EM0A 4A60A 3BU9A 5B11O 3T6LA 5CYBA 5KIDA 4Z2PA 2IZJA 3TGBA 2OFRX 3WBGA 1ZNEA 4U8UM 3SZIA 2Z4HA 3SLTA 1MEPA 4OKAA 3SOTA 1YWDA 5HAEA 3EW2A 3STKA 3T2XA 2C4IA 4LZVA 2EU7X 4MVIA 3D9WA 3RKGA 4O49A 1XCAA 4I6SA 4A8ZA 2FTBA 3ZUOA 3JS1A 3P6HA 4Y0SA 1TW4A 5EPQA 4HWMA 3PK2A 1UYOX 2HNXA 2RTQB 3RWXA 2VDFA 1X8UA 3IFBA 2FWVA 1SXYA 1B8EA 3B2LA 2CM4A 2QMIA 2X4MA 4BOEA 4CPHB 1I05A 1OBPA 4FQBB 2JGSA 2LA7A 4K19A 1B56A 4ZH6A 3T2WA 1ICNA 1K24A 1KT5A 2KW1A 1IFCA 2GTFX 1EW3A 1NGLA 1ADLA 2OY1O 1RAVA 1E00A 1W5RA 3FYFA 4Z2VA 1SREA 4CPIA 2JU3A 1LIFA 4L1NA 2QO6A 3HOLA 2P8GA 2YMSA 2R73A 3EW1A 4OS3A 1N9MA 4U8UO 3U0DA 2RTJA 4BX7B 5IXGA 3PP6A 1EXSA 2RTMA 1SY1A 3BSZE 1SA8A 2WR6A 2NNEA 3U9PC 4PJ2A 4O4XA 3ZWEA 2OY5O 1VWEB 1VWLB 4M7MA 1EI5A 2RTAA 3FDCA 3O2YA 4LZUA 3DSZA 4R0BA 5B10O 3QKGA 5LJCA 2CZTA 3VG6A 2HLVA 4QYPA 2A5CA 3WYPA 1DC9A 5BVQA 4BX6B 3FR4A 4Y0RA 4FBRA 4DQ4A 4MIRA 1NQNA 1K3BA 1B0OA 2DJFA 2OL6O 3RDSA 3FA6A 3S26A 4NV8A 3UAQA 1AVDA 2GJ5A 1E5PA 3RDQA 3KFHA 4GH7A 5IO6A 2VFBA 1JYDA 4QQ1A 4YDBA 2IZFB 2RTOB 2VFCA 4AW8A 5FQ8E 4KH8A 4ZHGA 1MM9A 1SRHA 4N7CA 1SWTA 3BLGA 4MISA 2N93A 4ZHHA 5HZ9A 2Q2MA 4I9RA 4PSQA 1VWHB 2GH7A 2OL7A 4HPBA 4D6AA 3SAOA 2F09A 3RDMA 3WZQA 3ELXA 2E4JA 5K67A 3FA9A 5D4AA 1GXAA 4YDAA 5BYPA 1VWFB 2AT8X 1JV4A 2RTRB 2QOMA 1SXXA 3KFGA 4FBVA 4Z28A 2OVSA 4Y0QA 5AQ6A 1DF3A 1U17A 4YVBA 2A3FX 1SWBA 3ZW0B 3FENA 3T6FA 4CDFA 2XSTA 4TJZA 3RE5A 2AT3X 4BX5B 1EIIA 4IB7A 4O3ZA 1EUOA 5EEDA 1OEKA 1Y0GA 1QY0A 1SWNA 1FDQA 4I3BA 3O22A 4O3YA 2KTSA 4C5PA 1RXJA 2AH7X 4NNTA 1HY2A 4GRJA 1O1VA 4LKTA 4OMXA 4RUUA 4O9SA 5H9NA 5B29A 4A1HA 3FA7A 5HA1A 1RSUB 1DZPA 2A13A 2GTLN 2PY1A 3P6CA 4NLIA 2I5VO 3VE1A 2Q9SA 2IZEB 1ACDA 2BS5A 3I0AA 5H9AA 4RUNA 3RZYA 1ICMA 1JMXA 3BY0A 3MG5A 4GJVA 4OELA 1X8QA 2QM9A 3C76X 4WBKA 2OFAA 5B5GA 1ZNDA 5D8JA 1LIBA 2JU7A 2FHNX 2HZQA 3JQOA 5FFHA 5HTEA 4AZNA 5HZQA 3VPJE 1KT6A 1ZNKA 1MUPA 1QY1A 4MVKA 1NP4A 1WUBA 1MVGA 4I95A 4CV7A 3VU1A 3NP1A 2C1QA 1L6MA 3FR2A 4YBPA 1PM1X 2G78A 3OD9A 3EBWA 2RTBB 3FELA 4NYRA 4KCAA 1VWIB 2O62A 4WFVA 3CQRA 3Q6LA 1VWOB 2RTFB 1AELA 2NNDA 5IRWA 2FHLA 1VWAB 4YCEA 4GETA 3X00A 1QABE 1LNMA 1WBIA 5H8TA 1E06A 1SWQA 5B27A 1LICA 3MVFA 2WQ9A 2XKLA 1IFBA 1HMTA 5K68A 1SY3A 2X32A 2X8FA 5C0NA 4ZCBA 3PECA 4ORUA 2GTLM 1G5WA 2WSJA 2X45A 4NNSA 1ZNHA 3BU1A 4GE1A 3TGAA 1SXWA 3FW5A 4NYQA 2IZLB 5LJGA 1RBPA 2DM5A 2ALLX 1SMPI 3AUMO 2JW1A 3Q34A 4ZH9A 5L8IA 2CAMA 1FENA 2JU8A 1EPAA 1Y53X 4O4UA 4COTA 4IB8A 3NX2A 2X8SA 1JJJA 4XMCA 3TF6A 3GAQA 2AT5X 5B5FA 2RTIB 3VG2A 4YKOA 1P6PA 4AZMA 2A5BA 4GGTA 3CWKA 2MM3A 5HZ5A 2RN4A 3FMZA 4ZHCA 3CR6A 3STNA 4BBOA 3KVNA 1BSOA 1HXZA 2MWHA 2Y3EA 1FE3A 1KT7A 1FEMA 1QY2A 4YGHA 1BRQA 1RXKA 5JR8A 2LKKA 2HKDA 3FEKA 4GUZA 4I3CA 2AT0X 3CBSA 4YMYA 2FS6A 3KFFA 1SY0A 3NQ9A 1JMZA 1TOWA 1EIOA 1SLGB 4M6SA 4EEJA 1SWOA 1DFVA 5KICA 1GT3A 3HWGA 4HPAA 4IB9A 1ALBA 4KIIA 1UYNX 1EPBA 1CRBA 1Y55X 1G85A 2OY8A 3MX7A 1UZ2X 2A0AA 1E02A 3NADA 1NP1A 4ZGFA 3RSWA 4IAWA 3RY2A 3HWEA 3ZI8A 1MK5A 5IRUA 2CBRA 1VWBB 1QWDA 3NX1A 4Y5DA 3OE3A 4IBAA 4TNNA 4BCSA 4NP1A 4YGGA 1NC9A 2LFOA 3MBTA 4AZOA 1SWEA 2RTCB 3CBCA 3CMPA 3P6FA 1AB0A 4Z27A 4Z6JA 2Y3FA 1SRFA 4ZGUA 1R0UA 1YP6A 4QGWA 3WJGA 3VG5A 4ARHA 1SY2A 4LQZA 3ZUIA 2RTEB 2AL0X 4CPHA 5AEOA 4JHQA 1NDJA 1GX3A 5L8NA 1QFVA 3APXA 2BHVA 2F73A 3APWA 2RCQA 1LCVA 1OEEA 5HBSA 5EDCA 4KT5A 1VWJB 1KL3A 3ZW1B 2GC9A 4KC8A 1GX9A 3OJYC 1BM5A 1Y52X 1LIEA 3NQ3A 3PH5A 4NLJA 4NV7A 4IMOA 4CPEA 4Z2OA 5L3YA 2BLGA 2L9CA 1T0VA 2UZ2A 1LDQA 3SLJA 3VGWA 2IZCB 3EYCA 4CDEA 2RTKA 5BVSA 3WJDA 3P6EA 4BX7A 2K62A 4TLJA 1O1UA 4FBOA 2JOZA 2OFBA 3PEDA 1N9YA 3UEVA 1JZUA 4I9SA 1DZMA 2Q2PA 1OPAA 1X71A 2WEXA 1GKAB 3MM0A 3PH6A 1MX8A 1I9HA 4OMWA 1HQQA 3HK1A 4ZJ0A 3BX8A 4ES7A 1BLRA 1TXLA 3ZZVA 2IZBA 3B2HA 3LV4A 1AQBA 1BSQA 4O3XB 1G74A 2I5ZO 3NPOA 2DJGA 2RTDB 2RTHB 4U3QA 5AJCA 4QYNA 5LJDA 2MF6A 5IO7A 1A57A 1S2PA 4WHIA 3S60A 5F6ZA 3WVMA 2L5PA 3JSQA 4QGVA 5F1EA 5L8OA 3PQSA 5KHPA 3C78X 2X8TA 1BEBA 1GM6A 1T68X 2X46A 3STMX 4CSBA 2LB6A 2WWPA 1D3SA 1GT5A 1BBPA 1AVGI 1FJ1E 4ID2A 4INNA 4MEEA 4Y59A 4ORRA 5H9LA 3EMMA 2OFMX 5HTDA 4XMEA 3BX7A 4EDEA 1VWGB 4JGLA 1VWDB 3BRNA 1BWYA 3E3CA 4GNWA 2MO5A 4TKJA 3I17A 1SWJA 1I06A 4O4SA 1IKJA 4OS0A 4JO6A 1DZKA 3V8UA 1GGLA 1KT3A 1O8VA 1KQXA 3ZW0A 3FEPA 4XMGA 2ZSCA 4BX5A 5B3MO 4YFPA 3L4RA 4NW4A 4DCBA 3HTYA 1IKEA 4YBUA 4FGIB 1PBYA 1ERBA 1DZJA 2AMMX 1X89A 1TOUA 1YIVA 3NQKA 1LUQA 2NNQA 4GNYA 4ODDA 2QO4A 3O19A 4U8UN 5HCEC 2LBVA 3VG4A 1QQSA 1SWKA 4QNIA 3VHHA 3P6GA 1CBSA 2RTPB 4U9CA 4XMHA 3ZQ3A 4BQUA 3FLLA 3KFIA 2FRSA 4GGRA 5EDBA 4ZR2A 2PI3O 1SWAA 4HFOA
chains in the Genus database with same CATH topology
1SLGB 1SWOA 1AVEA 1AVDA 1N4JA 3RDQA 3SZHA 4IRWA 1Y55X 1LDOA 1VWRB 2IZFB 2RTOB 5CHKA 2OF9A 1MM9A 1VWPB 1SRHA 3RY2A 3WZNA 1KL5A 1MK5A 2C1SA 1SWTA 5IRUA 1SWDA 3RDSA 1VWBB 1NQMA 3RDXA 4Y5DA 1SWRA 1VWHB 2GH7A 2IZAA 4BCSA 4GD9A 1SWGA 1NC9A 4GGZA 1VWQB 1SLDB 1LCWA 1SWEA 2UYWA 2RTCB 3RDMA 3WZQA 4Z27A 5K67A 4Z6JA 2Y3FA 1SRFA 1NBXA 1VWFB 2BC3A 2RTRB 1N7YA 4Z28A 2RTGB 4BJ8A 2IZKA 2RTEB 1VWMB 4CPHA 2A8GA 4JHQA 5F2BA 3SZJA 1NDJA 4YVBA 1SWBA 1PTSA 4GDAA 3T6FA 1LCVA 1SLFB 1STSB 2RTLA 3RE5A 4BX5B 2QCBA 1VWJB 5IRWA 1KL3A 4I60A 4CPFA 1SWPA 4EKVA 1SWNA 2WPUA 2AVIA 1SRGA 1RXJA 1Y52X 4Z2OA 4CPEA 1HY2A 5L3YA 3VHIA 2Y32A 1DF8A 1RXHA 4GJSA 2UZ2A 1LDQA 3VGWA 2IZCB 1RSUB 2IZGB 2RTKA 2IZDB 1SWUA 2F01A 4BX7A 5IRAA 1HXLA 2IZIA 2IZEB 1SRIA 1KFFA 2OFBA 1IJ8A 1N9YA 3MG5A 4GJVA 3RE6A 3MM0A 2OFAA 5B5GA 1SRJA 3T6LA 1KL4A 3RDOA 4Z2PA 1I9HA 2IZJA 2FHNX 1HQQA 3SZIA 2OF8A 1MEPA 4OKAA 2IZBA 1SWCA 3WZPA 3EW2A 1SWFA 1VWKB 1SWHA 3T2XA 2RTDB 2C4IA 2MF6A 2C1QA 3PK2A 2RTQB 4DNEA 1LCZA 2RTBB 1SWSA 3WZOA 1MOYA 1RSTB 1LELA 1VWNB 1VWIB 1VWOB 2RTFB 4CPHB 2FHLA 1VWAB 3X00A 1WBIA 1SWQA 4JNJA 2JGSA 5JD2A 1VWCB 4Y59A 3T2WA 5K68A 1VWGB 1VWDB 1STPA 3WYQA 1RAVA 2IZHB 2IZLB 2RTNB 4Z2VA 1SREA 4CPIA 1SWJA 2CAMA 1Y53X 3RY1A 4JO6A 4BX6A 1STRB 3EW1A 1N9MA 2RTJA 4BX7B 2ZSCA 5B5FA 2RTIB 2RTMA 3RDUA 4BX5A 2A5BA 4GGTA 2G5LA 1SWLA 1VWEB 1VWLB 4BBOA 2RTAA 1N43A 3FDCA 1HXZA 2Y3EA 1SLEB 3VHMA 1LUQA 2A5CA 1RXKA 3VHHA 1SWKA 3WYPA 2RTPB 4BX6B 4U46A 4GGRA 5CSEA 1NQNA 1VYOA 2RTHB 1SWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLG B;  1SWO A;  1AVE A;  1AVD A;  1N4J A;  3RDQ A;  3SZH A;  4IRW A;  1Y55 X;  1LDO A;  1VWR B;  2IZF B;  2RTO B;  5CHK A;  2OF9 A;  1MM9 A;  1VWP B;  1SRH A;  3RY2 A;  3WZN A;  1KL5 A;  1MK5 A;  2C1S A;  1SWT A;  5IRU A;  1SWD A;  3RDS A;  1VWB B;  1NQM A;  3RDX A;  4Y5D A;  1SWR A;  1VWH B;  2GH7 A;  2IZA A;  4BCS A;  4GD9 A;  1SWG A;  1NC9 A;  4GGZ A;  1VWQ B;  1SLD B;  1LCW A;  1SWE A;  2UYW A;  2RTC B;  3RDM A;  3WZQ A;  4Z27 A;  5K67 A;  4Z6J A;  2Y3F A;  1SRF A;  1NBX A;  1VWF B;  2BC3 A;  2RTR B;  1N7Y A;  4Z28 A;  2RTG B;  4BJ8 A;  2IZK A;  2RTE B;  1VWM B;  4CPH A;  2A8G A;  4JHQ A;  5F2B A;  3SZJ A;  1NDJ A;  4YVB A;  1SWB A;  1PTS A;  4GDA A;  3T6F A;  1LCV A;  1SLF B;  1STS B;  2RTL A;  3RE5 A;  4BX5 B;  2QCB A;  1VWJ B;  5IRW A;  1KL3 A;  4I60 A;  4CPF A;  1SWP A;  4EKV A;  1SWN A;  2WPU A;  2AVI A;  1SRG A;  1RXJ A;  1Y52 X;  4Z2O A;  4CPE A;  1HY2 A;  5L3Y A;  3VHI A;  2Y32 A;  1DF8 A;  1RXH A;  4GJS A;  2UZ2 A;  1LDQ A;  3VGW A;  2IZC B;  1RSU B;  2IZG B;  2RTK A;  2IZD B;  1SWU A;  2F01 A;  4BX7 A;  5IRA A;  1HXL A;  2IZI A;  2IZE B;  1SRI A;  1KFF A;  2OFB A;  1IJ8 A;  1N9Y A;  3MG5 A;  4GJV A;  3RE6 A;  3MM0 A;  2OFA A;  5B5G A;  1SRJ A;  3T6L A;  1KL4 A;  3RDO A;  4Z2P A;  1I9H A;  2IZJ A;  2FHN X;  1HQQ A;  3SZI A;  2OF8 A;  1MEP A;  4OKA A;  2IZB A;  1SWC A;  3WZP A;  3EW2 A;  1SWF A;  1VWK B;  1SWH A;  3T2X A;  2RTD B;  2C4I A;  2MF6 A;  2C1Q A;  3PK2 A;  2RTQ B;  4DNE A;  1LCZ A;  2RTB B;  1SWS A;  3WZO A;  1MOY A;  1RST B;  1LEL A;  1VWN B;  1VWI B;  1VWO B;  2RTF B;  4CPH B;  2FHL A;  1VWA B;  3X00 A;  1WBI A;  1SWQ A;  4JNJ A;  2JGS A;  5JD2 A;  1VWC B;  4Y59 A;  3T2W A;  5K68 A;  1VWG B;  1VWD B;  1STP A;  3WYQ A;  1RAV A;  2IZH B;  2IZL B;  2RTN B;  4Z2V A;  1SRE A;  4CPI A;  1SWJ A;  2CAM A;  1Y53 X;  3RY1 A;  4JO6 A;  4BX6 A;  1STR B;  3EW1 A;  1N9M A;  2RTJ A;  4BX7 B;  2ZSC A;  5B5F A;  2RTI B;  2RTM A;  3RDU A;  4BX5 A;  2A5B A;  4GGT A;  2G5L A;  1SWL A;  1VWE B;  1VWL B;  4BBO A;  2RTA A;  1N43 A;  3FDC A;  1HXZ A;  2Y3E A;  1SLE B;  3VHM A;  1LUQ A;  2A5C A;  1RXK A;  3VHH A;  1SWK A;  3WYP A;  2RTP B;  4BX6 B;  4U46 A;  4GGR A;  5CSE A;  1NQN A;  1VYO A;  2RTH B;  1SWA A; 
#chains in the Genus database with same CATH topology
 3PDF A;  2AF5 A;  2FGS A;  1HBP A;  4AZP A;  4IAB A;  5LJB A;  4HPD A;  1ERX A;  1MDC A;  1X8O A;  3VG3 A;  1HBQ A;  4BGF A;  3FR5 A;  2OVE A;  5HWZ A;  1BRP A;  1LDO A;  1A2D A;  1KXO A;  1VWR B;  1ZNL A;  1JJU A;  2BS6 A;  2ZAI A;  4XMD A;  4L3R A;  5CHK A;  1VWP B;  2OY7 A;  5LKE A;  2KTD A;  3HPE A;  4ALB A;  5HCD C;  1KL5 A;  1OBQ A;  3UEW A;  3RDX A;  4O4O A;  3BDR A;  1SXU A;  1FEL A;  4BVM A;  5LJE A;  1SWR A;  1YUP A;  2IZA A;  2Q4N A;  1JQP A;  2X55 A;  3KQ0 A;  3P6D A;  4GD9 A;  1KGL A;  1LKE A;  4EFG A;  3ELZ A;  1LCW A;  1PBO A;  3HWF A;  1LF7 A;  5D47 A;  1NBX A;  1OSP O;  1BSY A;  2BC3 A;  2RCT A;  3F6Z B;  1B4M A;  3H3I A;  2RTG B;  3WJF A;  4I3D A;  1FTP A;  1VWM B;  3G7X A;  2A8G A;  1T8V A;  2BSZ A;  1HMR A;  5EZ2 A;  2OVD A;  4GDA A;  5HZ6 A;  5H9K A;  2KD2 A;  4ZFX A;  1STS B;  2RTL A;  1W4T A;  4GDZ A;  2OVA A;  2QCB A;  2HMB A;  2QOS C;  2X34 A;  4I60 A;  5B2A O;  1SWP A;  1LPJ A;  2GTL O;  4EKV A;  2HZR A;  2FKG A;  4UU3 A;  1OPB A;  4XMF A;  3VE2 A;  1JJX A;  4ALO A;  2AVI A;  4ON1 A;  1SRG A;  1IW2 A;  4QZT A;  4TKH A;  5LJH A;  1KOI A;  2ZAG A;  1LID A;  4KC7 A;  1CBQ A;  3BS2 A;  1A18 A;  2G8C O;  2IZG B;  1MX7 A;  4ORY A;  4CDD A;  2F01 A;  5IRA A;  4ZHF A;  1HXL A;  1HQP A;  2IZI A;  1KQW A;  5F58 A;  1SRI A;  1KFF A;  4WFU A;  1VYF A;  1Z24 A;  1Y9T A;  1IJ8 A;  1KZX A;  3CQN A;  2M4L A;  4IB6 A;  5FQ7 E;  3UEX A;  3F9D A;  4YFQ A;  1YWA A;  1SRJ A;  1HMS A;  1KL4 A;  2W2A A;  3EBK A;  4GZV A;  3P02 A;  4QAE A;  3RDO A;  4AZQ A;  1KZW A;  1GT4 A;  3HWD A;  2OF8 A;  1QFT A;  1TVQ A;  3LTW A;  1SWC A;  3WZP A;  4MVE A;  1SWF A;  1BJ7 A;  1VWK B;  1SWH A;  1E2T A;  3QQ2 A;  5FAZ A;  3SLO A;  5HA0 A;  2NP1 A;  4CK4 A;  5CE4 A;  4GKC A;  2YG2 A;  3VG7 A;  1LFO A;  3APU A;  1OBU A;  5F7G A;  3D96 A;  4DNE A;  1LCZ A;  4TQ2 A;  1SWS A;  3WZO A;  2FS7 A;  1MOY A;  1RST B;  1LEL A;  1VWN B;  2WUT A;  3FA8 A;  3K3L A;  1I78 A;  4ML7 B;  4QZU A;  4B55 A;  4YGZ A;  2Q39 A;  4AZR A;  1ML7 A;  3WOV A;  2IFB A;  4AYH A;  2L67 A;  2MJI A;  4JNJ A;  4EXZ A;  5BVT A;  5JD2 A;  1VYG A;  3AKN A;  1HN2 A;  1VWC B;  3OBL A;  1YP7 A;  3PPT A;  3S5V A;  2JMB A;  1U18 A;  1CBR A;  3T1D A;  3FID A;  1STP A;  3WYQ A;  2IZH B;  1QG5 A;  2RA6 A;  2RTN B;  5DG4 A;  1JYJ A;  2MHD A;  1DV9 A;  1GT1 A;  3NBX X;  4GK9 A;  3RY1 A;  4BX6 A;  4O3W A;  1I4U A;  1STR B;  5DPQ A;  3IA8 A;  3CKF A;  3S5X A;  2W2F A;  5AJB A;  1KT4 A;  2AKQ A;  4N7D A;  4OS8 A;  1U0X A;  3RDU A;  5F6B A;  2OYB O;  3ZW1 A;  2G5L A;  1SWL A;  1CJ5 A;  2R74 A;  4ORS A;  3U03 A;  1N43 A;  2AT6 X;  3CKG A;  2WEW A;  5LKF A;  1SLE B;  3F8A A;  3TZS A;  1ZRY A;  5FEN A;  4CDC A;  5EEE A;  4QGX A;  2HYS A;  2FR2 A;  4U46 A;  2CZU A;  5CSE A;  4ORX A;  1VYO A;  4YH0 A;  3PQU A;  3GE2 A;  3KZA A;  4YCH A;  2A2G A;  5LJK A;  1N0S A;  1JBH A;  1AVE A;  4A1Y A;  1N4J A;  3SZH A;  4IRW A;  2X56 A;  3AKM A;  5FQ6 E;  2FR3 A;  2JN3 A;  3P24 A;  1GKA A;  1X8P A;  4ORW A;  4YKM A;  3WXQ A;  2OF9 A;  2L68 A;  1D2U A;  3D95 A;  3WZN A;  2ACO A;  3WJE A;  3B2K A;  2R56 A;  2C1S A;  2ASN X;  4YFR A;  2ACP X;  1SWD A;  3APV A;  2ANS A;  1NQM A;  2FKJ A;  1EAL A;  2W2B A;  2Z4I A;  2FT9 A;  1SWG A;  2CM9 A;  2OL8 O;  2OZQ A;  2LBA A;  3EC5 A;  1VWQ B;  4GGZ A;  1SLD B;  2UYW A;  5K06 A;  3WJC A;  4D6B A;  1XKI A;  5D48 A;  1IIU A;  1GX8 A;  1N7Y A;  2G79 A;  1URE A;  3AEH A;  3HOE A;  4DQ3 A;  4BJ8 A;  2IZK A;  3WJB A;  2RQ0 A;  1JIW I;  4OEM A;  5F2B A;  3SZJ A;  2RD7 C;  4HPC A;  1PMP A;  2CBS A;  1PTS A;  4Y0P A;  1RLB E;  1SLF B;  4UU2 A;  1A3Y A;  2QO5 A;  4IAX A;  1OEJ A;  3D97 A;  4EQA C;  4CPF A;  1EQD A;  3VHM A;  1CBI A;  1X8N A;  2A2U A;  1G7N A;  2WPU A;  4QRL A;  1S7D A;  2BT9 A;  3UEU A;  1I04 A;  2K23 A;  3DTQ A;  4LKP A;  3FW4 A;  1PEE A;  4TKB A;  5D45 A;  2Y32 A;  3VHI A;  5HCC C;  5HZ8 A;  1DF8 A;  1RXH A;  1H91 A;  1VPR A;  4GJS A;  5IO5 A;  3TGC A;  2G7B A;  2POA A;  3B2I A;  3C77 X;  2FLJ A;  3NR3 A;  3D4R A;  1YWB A;  2IZD B;  3B2J A;  4IMN A;  1SWU A;  4MVL A;  1Y9L A;  1YWC A;  3N91 A;  4GU8 A;  3RBY A;  3LHN A;  2KT4 B;  4ZHD A;  1W6F A;  1S44 A;  3FIQ A;  3RE6 A;  2WQA E;  1ZNG A;  3ZW2 A;  3EM0 A;  4A60 A;  3BU9 A;  5B11 O;  3T6L A;  5CYB A;  5KID A;  4Z2P A;  2IZJ A;  3TGB A;  2OFR X;  3WBG A;  1ZNE A;  4U8U M;  3SZI A;  2Z4H A;  3SLT A;  1MEP A;  4OKA A;  3SOT A;  1YWD A;  5HAE A;  3EW2 A;  3STK A;  3T2X A;  2C4I A;  4LZV A;  2EU7 X;  4MVI A;  3D9W A;  3RKG A;  4O49 A;  1XCA A;  4I6S A;  4A8Z A;  2FTB A;  3ZUO A;  3JS1 A;  3P6H A;  4Y0S A;  1TW4 A;  5EPQ A;  4HWM A;  3PK2 A;  1UYO X;  2HNX A;  2RTQ B;  3RWX A;  2VDF A;  1X8U A;  3IFB A;  2FWV A;  1SXY A;  1B8E A;  3B2L A;  2CM4 A;  2QMI A;  2X4M A;  4BOE A;  4CPH B;  1I05 A;  1OBP A;  4FQB B;  2JGS A;  2LA7 A;  4K19 A;  1B56 A;  4ZH6 A;  3T2W A;  1ICN A;  1K24 A;  1KT5 A;  2KW1 A;  1IFC A;  2GTF X;  1EW3 A;  1NGL A;  1ADL A;  2OY1 O;  1RAV A;  1E00 A;  1W5R A;  3FYF A;  4Z2V A;  1SRE A;  4CPI A;  2JU3 A;  1LIF A;  4L1N A;  2QO6 A;  3HOL A;  2P8G A;  2YMS A;  2R73 A;  3EW1 A;  4OS3 A;  1N9M A;  4U8U O;  3U0D A;  2RTJ A;  4BX7 B;  5IXG A;  3PP6 A;  1EXS A;  2RTM A;  1SY1 A;  3BSZ E;  1SA8 A;  2WR6 A;  2NNE A;  3U9P C;  4PJ2 A;  4O4X A;  3ZWE A;  2OY5 O;  1VWE B;  1VWL B;  4M7M A;  1EI5 A;  2RTA A;  3FDC A;  3O2Y A;  4LZU A;  3DSZ A;  4R0B A;  5B10 O;  3QKG A;  5LJC A;  2CZT A;  3VG6 A;  2HLV A;  4QYP A;  2A5C A;  3WYP A;  1DC9 A;  5BVQ A;  4BX6 B;  3FR4 A;  4Y0R A;  4FBR A;  4DQ4 A;  4MIR A;  1NQN A;  1K3B A;  1B0O A;  2DJF A;  2OL6 O;  3RDS A;  3FA6 A;  3S26 A;  4NV8 A;  3UAQ A;  1AVD A;  2GJ5 A;  1E5P A;  3RDQ A;  3KFH A;  4GH7 A;  5IO6 A;  2VFB A;  1JYD A;  4QQ1 A;  4YDB A;  2IZF B;  2RTO B;  2VFC A;  4AW8 A;  5FQ8 E;  4KH8 A;  4ZHG A;  1MM9 A;  1SRH A;  4N7C A;  1SWT A;  3BLG A;  4MIS A;  2N93 A;  4ZHH A;  5HZ9 A;  2Q2M A;  4I9R A;  4PSQ A;  1VWH B;  2GH7 A;  2OL7 A;  4HPB A;  4D6A A;  3SAO A;  2F09 A;  3RDM A;  3WZQ A;  3ELX A;  2E4J A;  5K67 A;  3FA9 A;  5D4A A;  1GXA A;  4YDA A;  5BYP A;  1VWF B;  2AT8 X;  1JV4 A;  2RTR B;  2QOM A;  1SXX A;  3KFG A;  4FBV A;  4Z28 A;  2OVS A;  4Y0Q A;  5AQ6 A;  1DF3 A;  1U17 A;  4YVB A;  2A3F X;  1SWB A;  3ZW0 B;  3FEN A;  3T6F A;  4CDF A;  2XST A;  4TJZ A;  3RE5 A;  2AT3 X;  4BX5 B;  1EII A;  4IB7 A;  4O3Z A;  1EUO A;  5EED A;  1OEK A;  1Y0G A;  1QY0 A;  1SWN A;  1FDQ A;  4I3B A;  3O22 A;  4O3Y A;  2KTS A;  4C5P A;  1RXJ A;  2AH7 X;  4NNT A;  1HY2 A;  4GRJ A;  1O1V A;  4LKT A;  4OMX A;  4RUU A;  4O9S A;  5H9N A;  5B29 A;  4A1H A;  3FA7 A;  5HA1 A;  1RSU B;  1DZP A;  2A13 A;  2GTL N;  2PY1 A;  3P6C A;  4NLI A;  2I5V O;  3VE1 A;  2Q9S A;  2IZE B;  1ACD A;  2BS5 A;  3I0A A;  5H9A A;  4RUN A;  3RZY A;  1ICM A;  1JMX A;  3BY0 A;  3MG5 A;  4GJV A;  4OEL A;  1X8Q A;  2QM9 A;  3C76 X;  4WBK A;  2OFA A;  5B5G A;  1ZND A;  5D8J A;  1LIB A;  2JU7 A;  2FHN X;  2HZQ A;  3JQO A;  5FFH A;  5HTE A;  4AZN A;  5HZQ A;  3VPJ E;  1KT6 A;  1ZNK A;  1MUP A;  1QY1 A;  4MVK A;  1NP4 A;  1WUB A;  1MVG A;  4I95 A;  4CV7 A;  3VU1 A;  3NP1 A;  2C1Q A;  1L6M A;  3FR2 A;  4YBP A;  1PM1 X;  2G78 A;  3OD9 A;  3EBW A;  2RTB B;  3FEL A;  4NYR A;  4KCA A;  1VWI B;  2O62 A;  4WFV A;  3CQR A;  3Q6L A;  1VWO B;  2RTF B;  1AEL A;  2NND A;  5IRW A;  2FHL A;  1VWA B;  4YCE A;  4GET A;  3X00 A;  1QAB E;  1LNM A;  1WBI A;  5H8T A;  1E06 A;  1SWQ A;  5B27 A;  1LIC A;  3MVF A;  2WQ9 A;  2XKL A;  1IFB A;  1HMT A;  5K68 A;  1SY3 A;  2X32 A;  2X8F A;  5C0N A;  4ZCB A;  3PEC A;  4ORU A;  2GTL M;  1G5W A;  2WSJ A;  2X45 A;  4NNS A;  1ZNH A;  3BU1 A;  4GE1 A;  3TGA A;  1SXW A;  3FW5 A;  4NYQ A;  2IZL B;  5LJG A;  1RBP A;  2DM5 A;  2ALL X;  1SMP I;  3AUM O;  2JW1 A;  3Q34 A;  4ZH9 A;  5L8I A;  2CAM A;  1FEN A;  2JU8 A;  1EPA A;  1Y53 X;  4O4U A;  4COT A;  4IB8 A;  3NX2 A;  2X8S A;  1JJJ A;  4XMC A;  3TF6 A;  3GAQ A;  2AT5 X;  5B5F A;  2RTI B;  3VG2 A;  4YKO A;  1P6P A;  4AZM A;  2A5B A;  4GGT A;  3CWK A;  2MM3 A;  5HZ5 A;  2RN4 A;  3FMZ A;  4ZHC A;  3CR6 A;  3STN A;  4BBO A;  3KVN A;  1BSO A;  1HXZ A;  2MWH A;  2Y3E A;  1FE3 A;  1KT7 A;  1FEM A;  1QY2 A;  4YGH A;  1BRQ A;  1RXK A;  5JR8 A;  2LKK A;  2HKD A;  3FEK A;  4GUZ A;  4I3C A;  2AT0 X;  3CBS A;  4YMY A;  2FS6 A;  3KFF A;  1SY0 A;  3NQ9 A;  1JMZ A;  1TOW A;  1EIO A;  1SLG B;  4M6S A;  4EEJ A;  1SWO A;  1DFV A;  5KIC A;  1GT3 A;  3HWG A;  4HPA A;  4IB9 A;  1ALB A;  4KII A;  1UYN X;  1EPB A;  1CRB A;  1Y55 X;  1G85 A;  2OY8 A;  3MX7 A;  1UZ2 X;  2A0A A;  1E02 A;  3NAD A;  1NP1 A;  4ZGF A;  3RSW A;  4IAW A;  3RY2 A;  3HWE A;  3ZI8 A;  1MK5 A;  5IRU A;  2CBR A;  1VWB B;  1QWD A;  3NX1 A;  4Y5D A;  3OE3 A;  4IBA A;  4TNN A;  4BCS A;  4NP1 A;  4YGG A;  1NC9 A;  2LFO A;  3MBT A;  4AZO A;  1SWE A;  2RTC B;  3CBC A;  3CMP A;  3P6F A;  1AB0 A;  4Z27 A;  4Z6J A;  2Y3F A;  1SRF A;  4ZGU A;  1R0U A;  1YP6 A;  4QGW A;  3WJG A;  3VG5 A;  4ARH A;  1SY2 A;  4LQZ A;  3ZUI A;  2RTE B;  2AL0 X;  4CPH A;  5AEO A;  4JHQ A;  1NDJ A;  1GX3 A;  5L8N A;  1QFV A;  3APX A;  2BHV A;  2F73 A;  3APW A;  2RCQ A;  1LCV A;  1OEE A;  5HBS A;  5EDC A;  4KT5 A;  1VWJ B;  1KL3 A;  3ZW1 B;  2GC9 A;  4KC8 A;  1GX9 A;  3OJY C;  1BM5 A;  1Y52 X;  1LIE A;  3NQ3 A;  3PH5 A;  4NLJ A;  4NV7 A;  4IMO A;  4CPE A;  4Z2O A;  5L3Y A;  2BLG A;  2L9C A;  1T0V A;  2UZ2 A;  1LDQ A;  3SLJ A;  3VGW A;  2IZC B;  3EYC A;  4CDE A;  2RTK A;  5BVS A;  3WJD A;  3P6E A;  4BX7 A;  2K62 A;  4TLJ A;  1O1U A;  4FBO A;  2JOZ A;  2OFB A;  3PED A;  1N9Y A;  3UEV A;  1JZU A;  4I9S A;  1DZM A;  2Q2P A;  1OPA A;  1X71 A;  2WEX A;  1GKA B;  3MM0 A;  3PH6 A;  1MX8 A;  1I9H A;  4OMW A;  1HQQ A;  3HK1 A;  4ZJ0 A;  3BX8 A;  4ES7 A;  1BLR A;  1TXL A;  3ZZV A;  2IZB A;  3B2H A;  3LV4 A;  1AQB A;  1BSQ A;  4O3X B;  1G74 A;  2I5Z O;  3NPO A;  2DJG A;  2RTD B;  2RTH B;  4U3Q A;  5AJC A;  4QYN A;  5LJD A;  2MF6 A;  5IO7 A;  1A57 A;  1S2P A;  4WHI A;  3S60 A;  5F6Z A;  3WVM A;  2L5P A;  3JSQ A;  4QGV A;  5F1E A;  5L8O A;  3PQS A;  5KHP A;  3C78 X;  2X8T A;  1BEB A;  1GM6 A;  1T68 X;  2X46 A;  3STM X;  4CSB A;  2LB6 A;  2WWP A;  1D3S A;  1GT5 A;  1BBP A;  1AVG I;  1FJ1 E;  4ID2 A;  4INN A;  4MEE A;  4Y59 A;  4ORR A;  5H9L A;  3EMM A;  2OFM X;  5HTD A;  4XME A;  3BX7 A;  4EDE A;  1VWG B;  4JGL A;  1VWD B;  3BRN A;  1BWY A;  3E3C A;  4GNW A;  2MO5 A;  4TKJ A;  3I17 A;  1SWJ A;  1I06 A;  4O4S A;  1IKJ A;  4OS0 A;  4JO6 A;  1DZK A;  3V8U A;  1GGL A;  1KT3 A;  1O8V A;  1KQX A;  3ZW0 A;  3FEP A;  4XMG A;  2ZSC A;  4BX5 A;  5B3M O;  4YFP A;  3L4R A;  4NW4 A;  4DCB A;  3HTY A;  1IKE A;  4YBU A;  4FGI B;  1PBY A;  1ERB A;  1DZJ A;  2AMM X;  1X89 A;  1TOU A;  1YIV A;  3NQK A;  1LUQ A;  2NNQ A;  4GNY A;  4ODD A;  2QO4 A;  3O19 A;  4U8U N;  5HCE C;  2LBV A;  3VG4 A;  1QQS A;  1SWK A;  4QNI A;  3VHH A;  3P6G A;  1CBS A;  2RTP B;  4U9C A;  4XMH A;  3ZQ3 A;  4BQU A;  3FLL A;  3KFI A;  2FRS A;  4GGR A;  5EDB A;  4ZR2 A;  2PI3 O;  1SWA A;  4HFO A; 
#chains in the Genus database with same CATH homology
 1SLG B;  1SWO A;  1AVE A;  1AVD A;  1N4J A;  3RDQ A;  3SZH A;  4IRW A;  1Y55 X;  1LDO A;  1VWR B;  2IZF B;  2RTO B;  5CHK A;  2OF9 A;  1MM9 A;  1VWP B;  1SRH A;  3RY2 A;  3WZN A;  1KL5 A;  1MK5 A;  2C1S A;  1SWT A;  5IRU A;  1SWD A;  3RDS A;  1VWB B;  1NQM A;  3RDX A;  4Y5D A;  1SWR A;  1VWH B;  2GH7 A;  2IZA A;  4BCS A;  4GD9 A;  1SWG A;  1NC9 A;  4GGZ A;  1VWQ B;  1SLD B;  1LCW A;  1SWE A;  2UYW A;  2RTC B;  3RDM A;  3WZQ A;  4Z27 A;  5K67 A;  4Z6J A;  2Y3F A;  1SRF A;  1NBX A;  1VWF B;  2BC3 A;  2RTR B;  1N7Y A;  4Z28 A;  2RTG B;  4BJ8 A;  2IZK A;  2RTE B;  1VWM B;  4CPH A;  2A8G A;  4JHQ A;  5F2B A;  3SZJ A;  1NDJ A;  4YVB A;  1SWB A;  1PTS A;  4GDA A;  3T6F A;  1LCV A;  1SLF B;  1STS B;  2RTL A;  3RE5 A;  4BX5 B;  2QCB A;  1VWJ B;  5IRW A;  1KL3 A;  4I60 A;  4CPF A;  1SWP A;  4EKV A;  1SWN A;  2WPU A;  2AVI A;  1SRG A;  1RXJ A;  1Y52 X;  4Z2O A;  4CPE A;  1HY2 A;  5L3Y A;  3VHI A;  2Y32 A;  1DF8 A;  1RXH A;  4GJS A;  2UZ2 A;  1LDQ A;  3VGW A;  2IZC B;  1RSU B;  2IZG B;  2RTK A;  2IZD B;  1SWU A;  2F01 A;  4BX7 A;  5IRA A;  1HXL A;  2IZI A;  2IZE B;  1SRI A;  1KFF A;  2OFB A;  1IJ8 A;  1N9Y A;  3MG5 A;  4GJV A;  3RE6 A;  3MM0 A;  2OFA A;  5B5G A;  1SRJ A;  3T6L A;  1KL4 A;  3RDO A;  4Z2P A;  1I9H A;  2IZJ A;  2FHN X;  1HQQ A;  3SZI A;  2OF8 A;  1MEP A;  4OKA A;  2IZB A;  1SWC A;  3WZP A;  3EW2 A;  1SWF A;  1VWK B;  1SWH A;  3T2X A;  2RTD B;  2C4I A;  2MF6 A;  2C1Q A;  3PK2 A;  2RTQ B;  4DNE A;  1LCZ A;  2RTB B;  1SWS A;  3WZO A;  1MOY A;  1RST B;  1LEL A;  1VWN B;  1VWI B;  1VWO B;  2RTF B;  4CPH B;  2FHL A;  1VWA B;  3X00 A;  1WBI A;  1SWQ A;  4JNJ A;  2JGS A;  5JD2 A;  1VWC B;  4Y59 A;  3T2W A;  5K68 A;  1VWG B;  1VWD B;  1STP A;  3WYQ A;  1RAV A;  2IZH B;  2IZL B;  2RTN B;  4Z2V A;  1SRE A;  4CPI A;  1SWJ A;  2CAM A;  1Y53 X;  3RY1 A;  4JO6 A;  4BX6 A;  1STR B;  3EW1 A;  1N9M A;  2RTJ A;  4BX7 B;  2ZSC A;  5B5F A;  2RTI B;  2RTM A;  3RDU A;  4BX5 A;  2A5B A;  4GGT A;  2G5L A;  1SWL A;  1VWE B;  1VWL B;  4BBO A;  2RTA A;  1N43 A;  3FDC A;  1HXZ A;  2Y3E A;  1SLE B;  3VHM A;  1LUQ A;  2A5C A;  1RXK A;  3VHH A;  1SWK A;  3WYP A;  2RTP B;  4BX6 B;  4U46 A;  4GGR A;  5CSE A;  1NQN A;  1VYO A;  2RTH B;  1SWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...