1VXFA

Native sperm whale myoglobin
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
153
structure length
153
Chain Sequence
VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CO-, deoxy- and met-myoglobins at various pH values.
pubmed doi rcsb
molecule tags Oxygen storage
molecule keywords MYOGLOBIN
total genus 66
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1996-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1vxfA00
106MA 2MBWA 1THBB 3QMAA 1DLWA 1JP8A 4FWZA 1C7CB 1XY0A 1MOAA 1FCSA 5E83A 1NQPA 3D1AB 3FS4A 4G51A 1YEQA 5JDOD 3AQ7A 1BZPA 3HXNB 4U8UB 1O1OB 1XYEB 1Y83B 1HACA 1YEUB 3CIUB 5HY8B 4MXKA 2D2ND 1YMAA 1NXFA 5HAVA 1DKEB 1YGFA 1HGAB 3WHMB 1I3EA 1YH9A 1MWDA 1MODA 1UVYA 4NS2A 1XZ4B 2HHBB 1HBAA 1YDZB 1YOHA 1K1KA 2D2MA 2ZT2A 1COHA 4KMWA 4MQJB 1HRMA 3EU1A 4YU4A 3MYMA 1Y4QB 4M4AA 1S5YA 1G0BB 1O1IB 1MYFA 3AQ5A 3OZUA 1MLSA 1MLNA 2BKMA 2PEGB 1QXEB 1Y0TB 1CH9A 3A5GA 3OZVA 1V9QA 2MYCA 3WCVC 1YIHB 3RGKA 2O5LX 2ZSPA 1Y0CB 1HGBA 4ODCB 1J3FA 3WCUA 3UHQA 1A3NB 1M6CA 3HC9A 1F65A 1UFJA 4TYXA 3S66B 2LH7A 1J41A 2AUOA 2ZLUA 4MQGA 1NWIA 1LH7A 2W6VB 1VXHA 1B86A 1HBSA 1LFZA 2D2MD 3A0GB 2FRJX 2YRSA 4JACA 3R5IB 1MYTA 5KDQA 4MQHA 3VRGB 1C7DA 3ONZB 1A00B 1MLFA 1Y4BB 2QMBA 2D2NB 6HBWB 3IC2B 2ZS0A 2Z6SA 4N8TB 1R1YA 3M3AA 1DXDA 2O5MX 1Y0DB 1ABYA 1FAWB 1BUWA 2NSRA 2SPMA 2VM0A 3ODQA 1LFTA 3GOUA 2VEBA 2ZSZA 3GQGB 5CN4A 2MGBA 1CIKA 2MYAA 5C6EB 2ZSTA 3QJBB 5KERA 1Y4BA 2DN2A 3HRWB 3AT5B 5D1VA 2MYBA 3D1KB 2ZSSA 4FC3B 1U7RA 3E5OA 3UHTA 2GTLA 1YENB 1HGCB 1Y8HB 1OUTA 4X0LA 2MGIA 3HYUB 2LH1A 2QFNA 1MTIA 2AURA 2DN2B 3BJ1A 1A6KA 1QSHA 1Q1FA 1NZ3A 4PQ6A 1YVTA 1ECNA 3PI9B 3ZHWA 102MA 1Y22A 3D4XA 3D1KA 1J7YB 1MLMA 1G08A 4FH6A 1YEUA 2ZLXA 1CO8A 3QJDB 1F63A 2VLYA 3UH5A 1GBUA 3U3EA 4MQCB 4F6FA 4WCHD 2DN3A 3S1JA 2DXMB 4LPIA 1DXUA 5JOMA 1NS9A 1DWTA 1MLUA 1B86B 3E4NA 1COHB 4MQJA 2EB8A 2Z6NA 5CMVA 1LFZB 1YHUA 1S61A 4MQGB 1QSIA 1X9FD 3K3UA 2G0RA 1GVHA 4UURA 4FH7A 1CBLA 4ROMA 1Y7ZB 2HHEA 2O5SX 2BK9A 2DXMA 4O2GA 3MN0A 4XDIA 1QXDA 1XZ5A 1BINA 1YFFB 4BJAA 4M4BB 5HLQA 3GQPB 1CMYB 1X9FA 3DUTA 1YGDB 5E29B 2DN1B 2KSCA 1YE2B 1O1MA 4N7NB 1OFJA 2V1HA 2V1EA 3WTGA 1DO7A 1YG5A 2ZSRA 1Y35A 1YEVB 1SI4A 1Y2ZA 4HSXA 1WLAA 1XXTA 1HGCA 3HYUA 1O1NA 3LB3A 1SHRB 1V07A 1XZVB 2VHBA 2ZLVA 104MA 3WCTC 3UHIA 1EWAA 1A4FA 1HBIA 2HBEA 1XCHA 1HACB 4H0BA 1DM1A 1YZIA 1A01B 3BOMA 1QPWB 3WCTD 2R1HB 4B3WA 1YIEA 1KR7A 2ZS1C 3BOMB 3UH7A 1U7SA 2R1HA 2HBEB 1YEQB 4H2LB 1HABB 1QI8B 1MYZA 2ZS1A 1H1XA 3UH3A 4X0LB 1LH6A 1S0HA 2E2YA 1Y5JB 2GTLB 3AG0A 3LR9A 1RQ4A 5EETA 1O1KB 1MTKA 4HBIA 1YHUB 2O5OX 1O1PB 1J40B 2SPOA 5EYSA 108MA 3MYNA 4PQBA 2EF2A 5CN9A 1LFLA 3WCTA 5KKKA 2HBFA 2HCOA 1A6NA 3BA2A 3UHXA 1GBUB 4M4BA 4MQCA 3NL7B 1UX8A 4HHBB 5EUIA 1GDJA 3WCWC 1YHEB 2DN1A 1CLSB 1BVDA 2BWHA 1Y31B 4O1TA 2BLJM 3ARLA 109MA 1Y5KA 1J7WA 3OVUC 2HZ2A 3ZJOA 4N8TA 1TU9A 1NGKA 5CN5A 5CNFA 2VLZA 3S65B 3KUNA 5EU2A 4KN3A 1J41B 1URYA 5CHQA 5EQMA 1WVPA 3UHDA 1GBVA 1WMUA 3GQRB 1EW6A 1CQ2A 5B84A 3EDBA 3LQDA 2M6ZA 1IBEB 1PBXA 4U8UA 3HXNA 1JF3A 1RTEA 1JY7B 3IC0B 1O1OA 4G51B 3WCVB 3NMLA 4XS0A 1JEBA 1LFYA 3ORDA 3TM3A 2AUPA 1RPSA 4PQCA 4YU3B 1WMUB 3QM8A 1FSXA 1T1NB 4KMVA 1G08B 2D2MB 2M6ZB 1Y8IA 4AVDA 3O7NA 1RQ4B 1RSEA 3QJEA 4HRTB 3QM7A 1LJWB 3OK5A 1MLLA 3PT8A 2H8DA 1GZXB 1UIWB 3OO4A 3G4QA 1HBHB 3LB4A 3ZJSA 1A3OA 1A6MA 1RPSB 5ILPA 2OH8A 1JWNA 2HBCA 3HF4A 2BW9M 1CG5A 3B75A 3A2GA 3AT6B 3BCQB 2PGHB 2NSSA 1YIEB 1BZ6A 2O5BX 4JYQA 5EUIB 5CHRA 1HLBA 1YVTB 3PI9A 5HU6A 3VREB 1BABA 1V4WA 3WFUA 2ZT0A 1XZ7A 1C40B 2EVPA 2MYDA 1DO3A 2G12A 2VRYA 1QXDB 110MA 1NEJB 2B7HA 1SPEA 1J3ZB 1YEOB 5EE4C 1KFRA 1BZ1A 1Y45A 3PI1A 5D5RA 2IG3A 3A59A 2VYYA 1Y0WB 1VWTB 1X9FC 4HSWA 2W6XA 1DXUB 1M6MA 2AV3A 3WHMA 3D7OB 3NFEB 1Y46B 3ZJMA 4O4TA 1VXGA 107MA 3WCUC 3GQGA 1GDIA 3QJBA 2VLXA 3OO5A 3PIAB 2QFKA 1SDKA 1Y01B 1BBBA 1JZMA 1GDLA 3FH9B 1FN3B 4ZVAA 1Y0AA 1FLPA 3DHRB 2MGLA 1GLIB 6HBWA 3P5QB 1Y7DB 1HV4B 3G4WA 1C7DB 3ONZA 1YE0A 1Y8WA 1SWMA 3M39A 3QQRA 1MOHA 1DKEA 1YGFB 2HBGA 1SPGA 3AQ8A 4MBAA 4ESAB 1RVWA 2QRWA 2ZS0D 3H57A 3ZOMA 2MGGA 1HABA 1QI8A 4UIQA 4L7YB 2LHBA 1NPGA 1HDSA 2V1GA 3K8BB 1A9WE 1JEBB 5HBIA 3GYSA 2ZSNA 1MBNA 1G0BA 2HBDB 1S56A 1Y4PB 1Y4QA 4H07A 3E55A 4SDHA 2GTLC 3QZZA 4TWUA 1MBCA 1O1LA 1YHRA 1VXEA 3PI8B 3VAUA 2MGJA 2EKUA 2G14A 1LJWA 3ZOLA 2D6CA 3UH6A 1O1NB 1MLRA 1DXVB 1UMOA 1CG8A 4AVEA 1OJ6A 3LR7A 3OO4B 1HBAB 5E6EB 1XZ4A 1BZZB 1N9IA 3HHBB 1LFQB 3UHBA 1J3YB 1MOBA 1Y7GB 1MYMA 3D17A 2EB9A 3HEOA 2H35A 3QZXA 4NI1B 1X9FB 2MGFA 1GCWB 3VREA 1MLGA 3V2ZA 3BJ2B 1MYJA 3ZJPA 5CNDA 2QLSA 4G1BA 4PNJA 3ECLA 2GL3A 4NI0A 3QM5A 2AV0A 1G0AA 4ROMB 3EOKB 2BNLA 1YVQB 3UHNA 1DUOA 1VXFA 3G46A 4NK1A 3SDNA 4G1VA 5MBNA 3BJ3A 1GLIA 1RVWB 2ZFBB 5CNBA 3VHBA 4MQKB 1O1JA 5EV5A 2ZFOA 5HY8A 1UFPA 1Y83A 2BLHA 1AJ9B 1S5XA 2HBSB 4U8UC 2HHDB 1YE2A 1A6GA 1Y4FA 1KD2B 2G0VA 2HBDA 4FWYA 3UHKA 1Y22B 3D4XB 3WFTA 1BUWB 1M9PA 1F5OA 1ABWA 1IT3A 4U8UD 3IC0A 1JW8A 2Z8AA 4NXCA 1XQ5A 4NXAA 1ABYB 2NX0A 5EYJA 2OH9A 1S69A 4DWTA 1N9HA 1O1JB 3RJNB 3GDJA 3MJUB 4WJGA 1DXVA 1CO9A 4M4AB 5KDQB 2OHAA 4FWXA 4FC3A 1ABSA 1NZ4A 3KUOA 4HRTA 1MYGA 1T1NA 1BZ1B 1Y45B 2ZSXA 2D60A 3VRFA 1RQ3B 5JDOE 1MKOB 4NI1A 1RTXA 1A3NA 2QSSB 2ZS1B 3WCVA 1J7YA 4ODCA 3BJ2A 3UBVA 1YHEA 1V75A 5CNCA 3LB1A 5F2AA 3MBAA 3NMMA 1N9XA 4N7PB 1NQPB 3WCPA 2ZLTA 1S5YB 1LFVA 2YRSB 1K0YA 2H8FB 1Y8HA 3R5IA 3NG6A 1JZKA 1LFLB 1HDBA 4YU4B 1LHSA 3M38A 3WCWB 3ZJQA 1Y35B 1G9VA 1UIWA 1QSIB 5JGGA 3QQQA 1O1MB 1VXBA 2RI4A 2H8FA 3H58A 5CNGA 1NS6A 3OJ1A 2XKIA 1LFVB 1JP6A 1CH7A 1KD2A 2QLSB 3MJPB 1XZ5B 1SDLA 1BZ0B 3QM9A 1LFYB 5B85A 1Y7CA 4F6BA 1VXAA 1V4XB 1W92A 1ECOA 5E83B 3PT7A 1Y4GB 3UHYA 3MKBA 1CQXA 3VRGA 1NPFA 1EBTA 1B0BA 3LHBA 1G09B 1XZUB 1C7BA 1HDSB 1LH3A 1AJGA 4DWUA 1GZXA 1Y4RB 1HBHA 1J52A 1RQAB 2ZSQA 5MBAA 1MTJA 2D2MC 3P5QA 5AB8A 1XXTB 1Y85B 3G53A 1MCYA 1HBRB 1MOCA 4DC8A 3G4YA 2IN4A 1DTMA 4C0NA 1JP9A 2G0ZA 1BJEA 3UHZA 1FHJB 3PIAA 1Y8KA 3HHBA 2HCOB 1DXCA 1MBOA 5E6EA 4L7YA 1Y0TA 3IC2A 1YCAA 1Y4VA 1Y85A 4IT8A 3A59B 1YMBA 2Z6TA 3UHEA 3UGYA 3UHWA 1GCVA 2DHBB 3G4VA 1HV4A 2MHBA 3PELB 1LUEA 1MLHA 1NAZA 1Y4VB 3UBCA 3WCWD 5C6EA 1MWCA 1MDNA 1YVQA 2GDMA 3QM6A 2MGKA 1YENA 4N7OA 4ROLA 1NZ5A 4OF9A 2EVKA 2ZLWB 3MOUA 1BBBB 2WY4A 1ITHA 1CMYA 3GYSB 1C40A 1MLQA 1FAWA 3HENA 103MA 2PEGA 1BZ0A 3LQDB 3UHGA 1GBVB 3ODQB 2R4ZA 2R4WA 1LA6A 3BCQA 2D2NC 5EE4D 1YE0B 2AUQA 3UI0A 1Y7DA 111MA 1Y8WB 4IROA 3PI4A 1A9WA 1Y4RA 1K1KB 1CP5A 5JDOC 1CH4A 1A4FB 2GRZA 3UGZA 1SPGB 2D5ZA 1OUTB 1R1XA 5CN7A 1J3ZA 1TESA 2MGDA 1DXTB 2EKTA 5E29A 2LH5A 3ZJHA 3OO5B 1A0ZA 1HLMA 3CIUA 1YOGA 2G3HA 2QU0B 1SDLB 2LH3A 2GNWA 1Y5FA 3SZKB 3GQRA 2GKMA 5F0BA 2SPLA 4HRRA 1VXDA 2ZT3A 4ILZA 1R1XB 1YFFA 3AT6A 2V1FA 4NZIA 4MXLA 2O5TX 1YZIB 1O1PA 3TLDA 3ZJNA 2AA1A 2HBFB 1XZ2B 3WCTB 2DHBA 4NK2A 3S48C 2NRLA 1NIHB 1LTWA 2MHBB 1NEJA 1Y8IB 2RAOA 2ZLTB 1DO1A 3WR1B 3UHRA 1MZ0A 1XYEA 1MBIA 3ED9A 3UHSA 1J7SA 2G10A 1JPBA 1MNJA 2D5XB 2VYZA 1GCWA 1Y8KB 3S1IA 1HGAA 1MGNA 2H35B 5JDOF 4XS0B 1LFTB 2LH2A 2MGCA 1C7CA 3HF4B 1HCOA 4ZVBA 3GQPA 1CG5B 3B75B 3WFXA 2GTLD 3GLNA 1J7SB 3MVCA 1A0UB 5SW7B 2ZLXB 2RAOB 2ZFOD 1A01A 2W6WA 3ARKA 3IXFA 3A5AA 1OBMA 2WTHA 4C44A 2QSSA 1CP0A 5CNEA 1NS6B 4MQHB 1IRDA 1SI4B 1YG5B 3DHRA 3WTGB 1CH3A 1YEVA 1O1LB 4F6IA 1DUKA 3GK9A 1XZVA 1DO4A 2XKGA 1S6AA 1K0YB 3ZH0A 2G11A 3WCUD 2MGMA 2QU0A 1Y4FB 4OODA 4B4YA 3UHVA 2C0KA 1MYHA 1HBRA 1MNKA 1OR6A 1O1IA 1CBMA 2MGEA 1X3KA 1EMYA 1L2KA 2QSPB 3D1AA 3FS4B 3GKVA 1Y7GA 2CMMA 2OIFA 2GKNA 1H97A 1V4UB 1YCBA 1QSHB 3W4UB 1MWBA 1HSYA 2W72B 1UX9A 2H8DB 3IA3B 2ZLUB 3UHHA 1J7WB 1FDHG 1MNIA 1Y7ZA 2HHBA 2G0SA 3G52A 1YOIA 2ZS0C 2ZFOC 4NI0B 4F68A 1S0HB 2QSPA 3GKVB 4VHBA 1RQAA 2DN3B 4YU3A 5ILRA 2R80B 1Y5FB 3QJDA 2WTGA 1Y09A 4MQIB 5KERB 3PI2A 3A9MA 1NS9B 4N7NA 7HBIA 3UHCA 5EOHA 1OR4A 5HU6B 3ZJLA 1YMCA 1VXCA 1Y4GA 1BZZA 1HGBB 1YIHA 1R1YB 1Y09B 4MQIA 6HBIA 1DLYA 1VWTA 2NRMA 3DHTB 1IBEA 1PBXB 2V1JA 2R80A 1EBCA 4F69A 1V5HA 3G4RA 4MBNA 4F6JA 112MA 5AZQA 2RI4B 1Y46A 1IT2A 1D8UA 2HHEB 2BLIA 1NIHA 2JHOA 1YHUC 5JGGB 1YHRB 3O89A 1IWHB 2HZ3A 1HBSB 1MLKA 4QAUA 3PELA 3EOKA 1HBBA 1HJTA 4IROB 1GCVB 1MNOA 1HCOB 3E5IA 3PT7B 3WCPB 1SDKB 3GKTA 1V4XA 1FHJA 2B7HB 5SW7A 1Y7CB 2MGAA 1X46A 1BZRA 4N7PA 1Y0DA 3RJ6A 1HBBB 1AJ9A 2G0XA 2O58X 1A3OB 1DXTA 1A0ZB 4MQKA 1JDOA 4TWVA 4O4ZA 1SHRA 3G4UA 1HDAA 3UHUA 2PGHA 3KMFA 1QPWA 1MLOA 2SPNA 2W6VA 1BIJB 3AT5A 5ILMA 1JL6A 2Z6NB 1G0AB 2Z85A 1MBAA 1ASHA 3DR9A 3PT8B 1HDAB 2HZ1A 3QJEB 2AA1B 2W31A 1ECAA 2V1KA 2ZSYA 4H2LA 3R0GA 3GDJB 2MYEA 3HEPA 105MA 1DWRA 3ASEA 1FN3A 1Y4PA 1AJHA 3CY5A 3MKBB 1AZIA 3GOUB 1IRCA 3EU1B 1OUUB 2FRKX 1F5PA 3VRFB 3OGBA 2D60B 1MBDA 2HHDA 1RQ3A 2D2NA 1MNHA 1Z8UB 2V1IA 2ZS0B 2W72A 1CG8B 1IOPA 1GJNA 5ILEA 4MPMA 1IWHA 2VYWA 1GDKA 4WJG1 3K9ZA 3A5BA 1YEOA 1I3DA 3QJCA 2ZT1A 1HHOB 1N9FA 1XZ2A 3M3BA 1CLSA 1A0UA 2XYKA 2DC3A 1Y0CA 1NZ2A 1HDBB 1MYIA 1LHTA 1LH2A 3NG6B 1Y5KB 2GNVA 2R4XA 1Y31A 1M9PB 5M3SA 3SZKA 1YGDA 2R4YA 2GLNA 1MKOA 3MJPA 1V75B 3SDHA 2D5XA 1J40A 2R50A 3BJ1B 1A00A 1CH5A 4MAXA 2QMBB 3WFWA 2LH6A 3D17B 1NWNA 3ZJIA 3KMFC 2HBCB 1CH1A 2ZFBA 1IDRA 5HLUA 5HLXA 2BMMA 3PI8A 1UVXA 1Y2ZB 2OLPA 1C7BB 1Y0AB 1CIOA 2FAMA 1O1KA 1V4UA 1ABWB 1JZLA 4KJTA 4F4OB 3ARJA 4MU5A 3HRWA 4L2MA 1MBSA 1MLJA 1DTIA 3CY5B 2GRHA 1XY0B 1JL7A 1CPWA 1THBA 1V4WB 1VRFA 4F6GA 2GRFA 3ZJJA 2W6YA 5IKSA 1O16A 1QXEA 1BVCA 2MGHA 3AQ9A 4F4OA 2VEEA 2FRFA 3K8BA 5C6YA 2D5ZB 5AZRA 2ZFOB 2ZT4A 1UT0A 1BIJA 5CN8A 3S66A 3QJCB 3WR1A 1YDZA 4DC7A 1G09A 1XZUA 1Y5JA 3W4UA 4UZVA 2ZLVB 1CH2A 2ZWJA 4F6DA 3PI3A 1FSLA 3BJ3B 2OHBA 2ZS1D 3DHTA 2O5QX 3DUTB 1XZ7B 3ZJRA 2FALA 1BABB 1XQ5B 1JF4A 3FH9A 3EDAA 2MB5A 1OUUA 1OFKA 3NL7A 2W72C 4HRRB 3WCUB 2ZLWA 1J3YA 1LFQA 2ZSOA 4N7OB 3LB2A 4ROLB 1PMBA 5CN6A 1ECDA 1S5XB 4HHBA 3ECZA 2HBSA 1JY7A 101MA 1G9VB 3V2VA 1Y0WA 1LH5A 3OZWA 4ESAA 1IRDB 3WCWA 1HHOA 4O35A 3ECXA 1UC3A 3A0GA 1VREA 3D7OA 3NFEA 1DWSA 3S65A 3WCVD 1YHUD 3AQ6A 1HBGA 2FRIX 1LA6B 1FSXB 4GZGA 1URVA 1VHBA 3MJUA 2XKHA 1LH1A 3NMMB 1FDHA 3TM9A 3WI8A 1YH9B
chains in the Genus database with same CATH superfamily
106MA 2MBWA 4A8MP 1THBB 3QMAA 1DLWA 1JP8A 4FWZA 1C7CB 1XY0A 1MOAA 1FCSA 5E83A 1NQPA 3D1AB 3FS4A 4G51A 1YEQA 5JDOD 3AQ7A 1BZPA 3HXNB 4U8UB 1O1OB 1XYEB 1Y83B 1HACA 1YEUB 2JL9A 3CIUB 5HY8B 4MXKA 2D2ND 1YMAA 1NXFA 5HAVA 2BV8A 1DKEB 1YGFA 1HGAB 3WHMB 1I3EA 1YH9A 1MWDA 1MODA 1UVYA 4NS2A 1XZ4B 4A8YA 2HHBB 2UULC 1HBAA 1YDZB 1YOHA 1K1KA 2D2MA 2ZT2A 3O2CA 1COHA 4KMWA 4MQJB 1HRMA 3EU1A 4YU4A 3MYMA 4PO5B 1Y4QB 4M4AA 1S5YA 1G0BB 3GIOA 1O1IB 1MYFA 3AQ5A 1NY9A 3OZUA 1MLSA 1MLNA 3LQ9A 2BKMA 2PEGB 1QXEB 1Y0TB 1CH9A 3A5GA 3OZVA 1V9QA 2MYCA 3WCVC 1YIHB 3RGKA 2O5LX 2ZSPA 1Y0CB 1HGBA 2DKDA 4ODCB 1J3FA 2UULH 3WCUA 3UHQA 1A3NB 1M6CA 3HC9A 1F65A 1UFJA 4TYXA 3S66B 2LH7A 1J41A 2AUOA 2ZLUA 4MQGA 1NWIA 1LH7A 2W6VB 1VXHA 1B86A 1HBSA 1LFZA 2D2MD 3A0GB 2FRJX 2YRSA 4JACA 1B33A 3R5IB 1MYTA 5KDQA 4MQHA 3VRGB 4A8OA 1C7DA 3ONZB 4H0MA 1A00B 1MLFA 4ESUA 1XG0C 1Y4BB 2QMBA 2D2NB 6HBWB 3IC2B 2ZS0A 2Z6SA 4N8TB 1R1YA 3M3AA 1DXDA 2O5MX 1Y0DB 1ABYA 1FAWB 1BUWA 2NSRA 2SPMA 2VM0A 3ODQA 1LFTA 1LIAB 3GOUA 2VEBA 2ZSZA 3GQGB 5CN4A 2MGBA 1CIKA 2MYAA 5C6EB 2ZSTA 3QJBB 5KERA 1Y4BA 2DN2A 3HRWB 3AT5B 5D1VA 2MYBA 3D1KB 2ZSSA 4FC3B 1U7RA 3E5OA 2UULA 3UHTA 2GTLA 1YENB 1HGCB 4YJJA 1Y8HB 1OUTA 4X0LA 2MGIA 3HYUB 3O2CB 2LH1A 2QFNA 1MTIA 2AURA 2DN2B 3BJ1A 4B02A 1A6KA 1QSHA 1Q1FA 1NZ3A 4PQ6A 1YVTA 1ECNA 3PI9B 3ZHWA 102MA 2VMLB 1Y22A 3D4XA 3D1KA 1J7YB 1MLMA 1G08A 4FH6A 1YEUA 5AQDM 2ZLXA 1CO8A 3QJDB 1F63A 2VLYA 3UH5A 1GBUA 3U3EA 4MQCB 4F6FA 2UUMX 4WCHD 2DN3A 3S1JA 2DXMB 4LPIA 1DXUA 5JOMA 1NS9A 1DWTA 1MLUA 1B86B 3E4NA 1COHB 4MQJA 2EB8A 2Z6NA 5CMVA 1LFZB 1YHUA 1S61A 4MQGB 1QSIA 1X9FD 3K3UA 2G0RA 1GVHA 4UURA 4FH7A 3V57A 1CBLA 4ROMA 1Y7ZB 2HHEA 2O5SX 2BK9A 2DXMA 4O2GA 3MN0A 4XDIA 1QXDA 1XZ5A 2V8AB 1BINA 1YFFB 4BJAA 4M4BB 5HLQA 3GQPB 1CMYB 1X9FA 4GY3B 3DUTA 1YGDB 5E29B 2DN1B 2KSCA 1YE2B 1O1MA 4N7NB 4F0UA 1OFJA 2V1HA 4ZIZA 2V1EA 3WTGA 1DO7A 1YG5A 2ZSRA 1Y35A 1YEVB 1PHNB 1SI4A 1Y2ZA 4HSXA 1WLAA 2YSKA 1XXTA 1HGCA 3HYUA 1O1NA 3LB3A 1ALLB 1SHRB 1V07A 3DBJA 2UUNA 1XZVB 2VHBA 3L0FB 2ZLVA 104MA 4N6SB 3WCTC 3UHIA 1EWAA 1A4FA 1HBIA 2HBEA 1XCHA 1HACB 4H0BA 1DM1A 1YZIA 1A01B 3BOMA 1QPWB 3WCTD 2R1HB 4B3WA 2C7LA 1YIEA 1KR7A 2ZS1C 3BOMB 3UH7A 1U7SA 2R1HA 2HBEB 1YEQB 4H2LB 1HABB 1QI8B 1MYZA 2ZS1A 1H1XA 1F99B 3UH3A 4X0LB 1LH6A 1S0HA 2E2YA 2C7LB 1Y5JB 2GTLB 3AG0A 3LR9A 1RQ4A 5EETA 1O1KB 1MTKA 4HBIA 4F0TA 1YHUB 2O5OX 1O1PB 4TMAB 3V58B 1J40B 2SPOA 5EYSA 108MA 3O18A 3MYNA 4PQBA 2EF2A 5CN9A 1LFLA 3WCTA 5KKKA 2HBFA 2HCOA 1A6NA 3BA2A 3UHXA 1GBUB 4M4BA 4MQCA 3NL7B 1UX8A 2UUND 4HHBB 5EUIA 1GDJA 3WCWC 1YHEB 2DN1A 1CLSB 1BVDA 4Q70B 2BWHA 1Y31B 4O1TA 2BLJM 3ARLA 109MA 1Y5KA 1J7WA 3OVUC 2HZ2A 1ON7A 3ZJOA 4AE1A 4N8TA 1TU9A 1NGKA 5CN5A 5AQDA 2VJHB 5CNFA 2VLZA 3S65B 3KUNA 5EU2A 4KN3A 1J41B 1URYA 5CHQA 2VJTB 5EQMA 1WVPA 1GH0B 3UHDA 4Q70A 1GBVA 1WMUA 3GQRB 1EW6A 1CQ2A 5B84A 3EDBA 3LQDA 2M6ZA 4GY3A 1IBEB 1PBXA 3KVSB 3HXNA 1JF3A 1RTEA 4U8UA 3PMCA 1HA7A 1JY7B 3IC0B 1O1OA 4G51B 3WCVB 3NMLA 4XS0A 1JEBA 1LFYA 3ORDA 3TM3A 2AUPA 1RPSA 3KVSA 4PQCA 4YU3B 1WMUB 3QM8A 1QGWC 1FSXA 1T1NB 4KMVA 1G08B 2D2MB 2M6ZB 1Y8IA 2I88A 4AVDA 3O7NA 1RQ4B 1RSEA 3QJEA 4HRTB 3QM7A 1LJWB 1ALLA 3OK5A 2UUNB 1MLLA 3PT8A 2H8DA 1GZXB 1UIWB 3OO4A 3G4QA 1HBHB 3LB4A 3ZJSA 1A3OA 1A6MA 1RPSB 5B13G 5ILPA 2OH8A 1JWNA 2HBCA 3HF4A 2BW9M 4A8KA 1CG5A 3B75A 3A2GA 3AT6B 4L1EB 3BCQB 2PGHB 2NSSA 1YIEB 1BZ6A 2O5BX 4JYQA 1COLA 5EUIB 5CHRA 1HLBA 1YVTB 3PI9A 5HU6A 3VREB 1BABA 1V4WA 3WFUA 4LMXB 2ZT0A 1XZ7A 1C40B 2EVPA 2MYDA 1DO3A 2G12A 2VRYA 2VJRB 1QXDB 110MA 1NEJB 2B7HA 1SPEA 1J3ZB 1YEOB 5EE4C 1KFRA 1BZ1A 1Y45A 3PI1A 5D5RA 2IG3A 3A59A 2VYYA 4ZIZB 1Y0WB 1VWTB 1X9FC 4HSWA 2W6XA 1DXUB 1M6MA 2AV3A 3WHMA 3D7OB 3NFEB 1Y46B 3ZJMA 4O4TA 1CIIA 1VXGA 1UVNA 107MA 3WCUC 3GQGA 1GDIA 3QJBA 2VLXA 3OO5A 1LIAA 3PIAB 2QFKA 1SDKA 1Y01B 1BBBA 1JZMA 1GDLA 4Z8KB 1XF6C 2C7KA 3FH9B 1FN3B 4ZVAA 1Y0AA 1WACA 1FLPA 3DHRB 2MGLA 1GLIB 6HBWA 3BRPB 4YJJB 3P5QB 1Y7DB 1HV4B 3G4WA 1C7DB 3ONZA 1YE0A 1Y8WA 1SWMA 3M39A 3QQRA 1MOHA 1DKEA 1YGFB 2HBGA 1SPGA 1F99A 3AQ8A 4MBAA 4ESAB 1RVWA 2QRWA 2ZS0D 5FVBM 3H57A 3ZOMA 2MGGA 1HABA 1QI8A 4UIQA 3NUHB 4L7YB 2LHBA 1NPGA 1HDSA 2V1GA 3K8BB 1A9WE 1JEBB 5HBIA 3GYSA 2ZSNA 1MBNA 1G0BA 2HBDB 1S56A 1Y4PB 1Y4QA 4H07A 3E55A 3VNCA 4SDHA 2GTLC 3QZZA 4TWUA 1MBCA 1O1LA 5FVBA 1YHRA 1VXEA 3PI8B 3VAUA 2MGJA 2EKUA 1UVJA 2G14A 1LJWA 3ZOLA 2D6CA 3UH6A 1O1NB 1MLRA 1DXVB 1UMOA 1CG8A 4AVEA 1HHTP 1OJ6A 3LR7A 3OO4B 1HBAB 5E6EB 1XZ4A 1BZZB 1N9IA 3HHBB 1LFQB 3UHBA 1J3YB 1MOBA 1Y7GB 1MYMA 3D17A 2EB9A 3HEOA 2H35A 3QZXA 4NI1B 1X9FB 2MGFA 1GCWB 3VREA 1MLGA 3V2ZA 3BJ2B 1MYJA 3ZJPA 5CNDA 2QLSA 4G1BA 2UUMB 4PNJA 3ECLA 2GL3A 4NI0A 3QM5A 2AV0A 1G0AA 4ROMB 3EOKB 2BNLA 1YVQB 3UHNA 1DUOA 1VXFA 3G46A 4NK1A 3SDNA 4G1VA 5MBNA 3BJ3A 1GLIA 2C7JA 1RVWB 2ZFBB 5CNBA 1EYXA 3VHBA 4MQKB 1O1JA 5EV5A 2ZFOA 5HY8A 1UFPA 1Y83A 2BLHA 1AJ9B 1S5XA 2HBSB 4U8UC 2HHDB 1YE2A 1A6GA 1Y4FA 1KD2B 2G0VA 2HBDA 4FWYA 3UHKA 1Y22B 3D4XB 3WFTA 1BUWB 1M9PA 1F5OA 1ABWA 1IT3A 3IC0A 4U8UD 1JW8A 2Z8AA 4NXCA 1XQ5A 4NXAA 1ABYB 2NX0A 5EYJA 2OH9A 1S69A 4DWTA 1N9HA 4F0TB 1O1JB 3RJNB 3GDJA 3MJUB 4WJGA 1DXVA 1CO9A 4M4AB 4N6SA 5KDQB 2OHAA 4FWXA 4FC3A 1ABSA 1NZ4A 3KUOA 4HRTA 1MYGA 1T1NA 1BZ1B 1Y45B 2ZSXA 2D60A 3VRFA 1RQ3B 1MKOB 5JDOE 4NI1A 1RTXA 1A3NA 2QSSB 2ZS1B 3WCVA 1J7YA 4ODCA 3BJ2A 3UBVA 1YHEA 1V75A 2V8AA 5CNCA 2J96A 3LB1A 5F2AA 3MBAA 3NMMA 1N9XA 4N7PB 1NQPB 3WCPA 2ZLTA 1S5YB 1LFVA 2YRSB 4H0MB 1K0YA 1F0LA 2H8FB 1Y8HA 2VJTA 3R5IA 4LM6B 3NG6A 1JZKA 1LFLB 1HDBA 4YU4B 1LHSA 3V58A 3M38A 3WCWB 3ZJQA 1Y35B 1G9VA 1UIWA 1KTPB 1QSIB 4GXEA 5JGGA 3QQQA 2UULD 1O1MB 1VXBA 2RI4A 2H8FA 3H58A 2BV8B 5CNGA 1A87A 1NS6A 3OJ1A 2XKIA 1LFVB 3PMDA 1JP6A 1CH7A 1KD2A 2QLSB 3MJPB 1XZ5B 1SDLA 1BZ0B 3QM9A 1LFYB 5B85A 1Y7CA 4F6BA 1VXAA 1V4XB 1W92A 1ECOA 5E83B 3PT7A 1Y4GB 3UHYA 3MKBA 1CQXA 3VRGA 1NPFA 4HH0A 1EBTA 1B0BA 3LHBA 1G09B 1XZUB 1CPCB 1C7BA 1HDSB 1LH3A 1AJGA 4DWUA 1GZXA 1Y4RB 1HBHA 1J52A 1RQAB 1UVLA 4RMPB 2ZSQA 5MBAA 4Z8KA 1MTJA 2D2MC 3P5QA 5AB8A 1XXTB 1Y85B 3G53A 1MCYA 1HBRB 1MOCA 4DC8A 3G4YA 2IN4A 1DTMA 4C0NA 1JP9A 2G0ZA 1BJEA 3UHZA 1FHJB 1HI8A 3PIAA 2VJRA 1Y8KA 3HHBA 2HCOB 1DXCA 1MBOA 5E6EA 4L7YA 1Y0TA 1JBOA 3IC2A 1YCAA 1Y4VA 1Y85A 4IT8A 3A59B 1YMBA 2Z6TA 3UHEA 1HI1A 2VMLA 3UGYA 3UHWA 1GCVA 2DHBB 3G4VA 1HV4A 2MHBA 3PELB 1LUEA 2JLGA 1MLHA 1NAZA 1Y4VB 3UBCA 4A8FA 3WCWD 5C6EA 1MWCA 1MDNA 1YVQA 2GDMA 3QM6A 1JBOB 1YENA 2MGKA 4N7OA 4ROLA 1NZ5A 4OF9A 2EVKA 2ZLWB 3MOUA 1BBBB 4BS9A 2WY4A 1ITHA 1CMYA 3GYSB 1C40A 1MLQA 1FAWA 3HENA 103MA 2PEGA 1BZ0A 3LQDB 3UHGA 1GBVB 3ODQB 1GH0A 2R4ZA 2R4WA 1LA6A 3BCQA 2D2NC 5EE4D 1YE0B 2AUQA 3UI0A 1Y7DA 111MA 3DBJB 1Y8WB 4IROA 3PI4A 1A9WA 1Y4RA 1K1KB 1CP5A 5JDOC 3RQRA 1CH4A 1A4FB 2GRZA 3UGZA 1SPGB 1ON7B 2D5ZA 1OUTB 1R1XA 5CN7A 1J3ZA 1TESA 4HH1A 2MGDA 1DXTB 2WCRA 2EKTA 5E29A 2LH5A 3ZJHA 3OO5B 1A0ZA 1B8DA 1HLMA 1PHNA 3CIUA 1YOGA 4F0UB 2G3HA 2QU0B 1SDLB 2LH3A 2GNWA 1Y5FA 3SZKB 3GQRA 2GKMA 4XXIA 5F0BA 2SPLA 4HRRA 1VXDA 2ZT3A 4ILZA 1R1XB 1YFFA 3AT6A 4L1EA 2V1FA 4NZIA 4MXLA 2O5TX 1YZIB 1O1PA 3TLDA 3ZJNA 2AA1A 2HBFB 1XZ2B 3WCTB 2DHBA 4NK2A 3S48C 2NRLA 1NIHB 1LTWA 2MHBB 1NEJA 1Y8IB 2RAOA 2ZLTB 1DO1A 3WR1B 3UHRA 1MZ0A 1XYEA 1UVIA 1MBIA 3ED9A 3UHSA 1J7SA 2G10A 1JPBA 1MNJA 2D5XB 2VYZA 1GCWA 1Y8KB 3S1IA 1HGAA 1MGNA 2H35B 5JDOF 4XS0B 1LFTB 2LH2A 2MGCA 1C7CA 3HF4B 4AE0A 1HCOA 4ZVBA 3GQPA 1CG5B 3B75B 3WFXA 2GTLD 3GLNA 1J7SB 3FEWX 3MVCA 1A0UB 5SW7B 2ZLXB 2RAOB 2ZFOD 1A01A 3MWNA 2W6WA 3ARKA 3IXFA 3A5AA 1OBMA 2WTHA 4C44A 2QSSA 1CP0A 5CNEA 1NS6B 4ETUA 4MQHB 2DKCA 1B33B 4A8WA 3O18B 1IRDA 1SI4B 1YG5B 3DHRA 3WTGB 1CH3A 1YEVA 1O1LB 4F6IA 1DUKA 3GK9A 1XZVA 3L0FA 1DO4A 2C7KB 2XKGA 1S6AA 2DKAA 1K0YB 3ZH0A 2G11A 3WCUD 2MGMA 2QU0A 1Y4FB 4OODA 1MDTA 4B4YA 3UHVA 2C0KA 1MYHA 1HBRA 1MNKA 1OR6A 1O1IA 1CBMA 2MGEA 1X3KA 1EMYA 1L2KA 2QSPB 3D1AA 3FS4B 3GKVA 4ERVA 1Y7GA 2CMMA 2OIFA 2GKNA 1H97A 1V4UB 3V57B 1YCBA 1RH1A 1QSHB 3W4UB 1MWBA 1HSYA 4ERTA 2W72B 1UX9A 2H8DB 3IA3B 2ZLUB 3UHHA 1J7WB 1FDHG 1MNIA 1Y7ZA 2HHBA 2G0SA 3G52A 3GUQA 1YOIA 2ZS0C 2ZFOC 4ETTA 4LMSB 4NI0B 4F68A 1S0HB 2QSPA 3GKVB 4VHBA 1RQAA 2DN3B 4YU3A 5ILRA 2R80B 1Y5FB 3QJDA 2WTGA 1Y09A 4MQIB 5KERB 3PI2A 3A9MA 1NS9B 4N7NA 7HBIA 3UHCA 5EOHA 1OR4A 5HU6B 3ZJLA 1YMCA 4BJUA 1VXCA 1Y4GA 1KN1B 1BZZA 1HGBB 1YIHA 1R1YB 1Y09B 4MQIA 6HBIA 1DLYA 1VWTA 2NRMA 3DHTB 1IBEA 1PBXB 1UVKA 2V1JA 2R80A 1EBCA 4F69A 1V5HA 3G4RA 4MBNA 4F6JA 112MA 5AZQA 2RI4B 1Y46A 1IT2A 1D8UA 2HHEB 2BLIA 1NIHA 2JHOA 1YHUC 4RMPA 4GXEB 5JGGB 2VJHA 1YHRB 3O89A 1IWHB 2HZ3A 1HBSB 1MLKA 4QAUA 3PELA 3EOKA 1HBBA 1HJTA 4IROB 2WCQA 1GCVB 1MNOA 1HCOB 3E5IA 3PT7B 3WCPB 1SDKB 3GKTA 1V4XA 1FHJA 2B7HB 5SW7A 1Y7CB 1HA7B 2MGAA 1X46A 1BZRA 4N7PA 1Y0DA 1HI0P 3RJ6A 1DDTA 1HBBB 1AJ9A 2G0XA 2O58X 2X49A 1A3OB 1DXTA 1A0ZB 1EYXB 4MQKA 1JDOA 4TWVA 4O4ZA 4PO5A 1SHRA 3G4UA 1HDAA 3UHUA 2PGHA 3KMFA 1HHSA 1QPWA 1KTPA 1MLOA 2SPNA 2W6VA 1BIJB 3AT5A 5ILMA 1JL6A 2Z6NB 1G0AB 2Z85A 1MBAA 1ASHA 3DR9A 3PT8B 2UULB 1HDAB 3ZTAA 2HZ1A 3QJEB 2AA1B 2W31A 1I7YB 1ECAA 2V1KA 2ZSYA 4H2LA 3R0GA 3GDJB 2MYEA 3HEPA 105MA 1DWRA 3ASEA 1FN3A 1Y4PA 1AJHA 3CY5A 3MKBB 1KN1A 1AZIA 2JLFA 3GOUB 1IRCA 1I7YA 3EU1B 1OUUB 2FRKX 1F5PA 4XXKA 3VRFB 3OGBA 2D60B 1MBDA 2HHDA 1RQ3A 2D2NA 1MNHA 1Z8UB 2V1IA 2ZS0B 2W72A 1CG8B 1IOPA 1GJNA 5ILEA 4MPMA 1IWHA 2VYWA 1GDKA 4WJG1 3K9ZA 3A5BA 1YEOA 1I3DA 3QJCA 2ZT1A 1HHOB 1N9FA 1XZ2A 3M3BA 1CLSA 1A0UA 2XYKA 2DC3A 1Y0CA 1NZ2A 1HDBB 1MYIA 1LHTA 1LH2A 3NG6B 1Y5KB 2GNVA 2R4XA 1Y31A 1M9PB 5M3SA 3SZKA 1SGKA 1YGDA 2R4YA 2GLNA 1MKOA 3MJPA 1V75B 3SDHA 2D5XA 1J40A 2R50A 3BJ1B 1A00A 1CH5A 4MAXA 2QMBB 3WFWA 5B13A 2LH6A 3D17B 1NWNA 3ZJIA 3KMFC 2HBCB 4ETVA 1CH1A 2ZFBA 1IDRA 5HLUA 5HLXA 2BMMA 3PI8A 1UVXA 3BRPA 1Y2ZB 2OLPA 1C7BB 4A8QA 1Y0AB 1CIOA 2FAMA 1O1KA 1V4UA 1CPCA 1ABWB 2UUMA 1JZLA 1UVMA 4KJTA 4F4OB 3ARJA 4MU5A 3HRWA 4L2MA 1MBSA 1XDTT 1MLJA 1DTIA 3CY5B 2GRHA 1XY0B 1JL7A 1CPWA 1THBA 1V4WB 1VRFA 4F6GA 2GRFA 3ZJJA 2W6YA 5IKSA 1O16A 1QXEA 1BVCA 2MGHA 3AQ9A 4F4OA 2VEEA 2FRFA 3K8BA 2X4AA 5C6YA 2D5ZB 4A8SA 5AZRA 2ZFOB 2ZT4A 1UT0A 1BIJA 5CN8A 3S66A 3QJCB 3WR1A 1YDZA 4DC7A 1G09A 1XZUA 1Y5JA 3W4UA 4UZVA 2ZLVB 1CH2A 2ZWJA 4F6DA 3PI3A 1FSLA 3BJ3B 2OHBA 2ZS1D 3DHTA 2O5QX 3DUTB 1XZ7B 3ZJRA 2FALA 1BABB 1XQ5B 1JF4A 3FH9A 3EDAA 2MB5A 1OUUA 1OFKA 3NL7A 2W72C 4HRRB 3WCUB 2ZLWA 1J3YA 1LFQA 2ZSOA 4N7OB 3LB2A 4ROLB 1PMBA 5CN6A 1ECDA 1S5XB 4HHBA 3ECZA 2HBSA 1JY7A 1B8DB 101MA 1G9VB 3V2VA 1Y0WA 1LH5A 3OZWA 4ESAA 1IRDB 3WCWA 1HHOA 4O35A 3ECXA 1UC3A 3A0GA 1VREA 3D7OA 3NFEA 1DWSA 1TOXA 3S65A 3WCVD 1YHUD 3AQ6A 1HBGA 2FRIX 1LA6B 1FSXB 4GZGA 2C7JB 1URVA 1VHBA 3MJUA 2XKHA 1LH1A 3NMMB 1FDHA 3TM9A 3WI8A 1YH9B
chains in the Genus database with same CATH topology
106MA 2MBWA 1THBB 3QMAA 1DLWA 1JP8A 4FWZA 1C7CB 1XY0A 1MOAA 1FCSA 5E83A 1NQPA 3D1AB 3FS4A 4G51A 1YEQA 5JDOD 3AQ7A 1BZPA 3HXNB 4U8UB 1O1OB 1XYEB 1Y83B 1HACA 1YEUB 3CIUB 5HY8B 4MXKA 2D2ND 1YMAA 1NXFA 5HAVA 1DKEB 1YGFA 1HGAB 3WHMB 1I3EA 1YH9A 1MWDA 1MODA 1UVYA 4NS2A 1XZ4B 2HHBB 1HBAA 1YDZB 1YOHA 1K1KA 2D2MA 2ZT2A 1COHA 4KMWA 4MQJB 1HRMA 3EU1A 4YU4A 3MYMA 1Y4QB 4M4AA 1S5YA 1G0BB 1O1IB 1MYFA 3AQ5A 3OZUA 1MLSA 1MLNA 2BKMA 2PEGB 1QXEB 1Y0TB 1CH9A 3A5GA 3OZVA 1V9QA 2MYCA 3WCVC 1YIHB 3RGKA 2O5LX 2ZSPA 1Y0CB 1HGBA 4ODCB 1J3FA 3WCUA 3UHQA 1A3NB 1M6CA 3HC9A 1F65A 1UFJA 4TYXA 3S66B 2LH7A 1J41A 2AUOA 2ZLUA 4MQGA 1NWIA 1LH7A 2W6VB 1VXHA 1B86A 1HBSA 1LFZA 2D2MD 3A0GB 2FRJX 2YRSA 4JACA 3R5IB 1MYTA 5KDQA 4MQHA 3VRGB 1C7DA 3ONZB 1A00B 1MLFA 1Y4BB 2QMBA 2D2NB 6HBWB 3IC2B 2ZS0A 2Z6SA 4N8TB 1R1YA 3M3AA 1DXDA 2O5MX 1Y0DB 1ABYA 1FAWB 1BUWA 2NSRA 2SPMA 2VM0A 3ODQA 1LFTA 3GOUA 2VEBA 2ZSZA 3GQGB 5CN4A 2MGBA 1CIKA 2MYAA 5C6EB 2ZSTA 3QJBB 5KERA 1Y4BA 2DN2A 3HRWB 3AT5B 5D1VA 2MYBA 3D1KB 2ZSSA 4FC3B 1U7RA 3E5OA 3UHTA 2GTLA 1YENB 1HGCB 1Y8HB 1OUTA 4X0LA 2MGIA 3HYUB 2LH1A 2QFNA 1MTIA 2AURA 2DN2B 3BJ1A 1A6KA 1QSHA 1Q1FA 1NZ3A 4PQ6A 1YVTA 1ECNA 3PI9B 3ZHWA 102MA 1Y22A 3D4XA 3D1KA 1J7YB 1MLMA 1G08A 4FH6A 1YEUA 2ZLXA 1CO8A 3QJDB 1F63A 2VLYA 3UH5A 1GBUA 3U3EA 4MQCB 4F6FA 4WCHD 2DN3A 3S1JA 2DXMB 4LPIA 1DXUA 5JOMA 1NS9A 1DWTA 1MLUA 1B86B 3E4NA 1COHB 4MQJA 2EB8A 2Z6NA 5CMVA 1LFZB 1YHUA 1S61A 4MQGB 1QSIA 1X9FD 3K3UA 2G0RA 1GVHA 4UURA 4FH7A 1CBLA 4ROMA 1Y7ZB 2HHEA 2O5SX 2BK9A 2DXMA 4O2GA 3MN0A 4XDIA 1QXDA 1XZ5A 1BINA 1YFFB 4BJAA 4M4BB 5HLQA 3GQPB 1CMYB 1X9FA 3DUTA 1YGDB 5E29B 2DN1B 2KSCA 1YE2B 1O1MA 4N7NB 1OFJA 2V1HA 2V1EA 3WTGA 1DO7A 1YG5A 2ZSRA 1Y35A 1YEVB 1SI4A 1Y2ZA 4HSXA 1WLAA 1XXTA 1HGCA 3HYUA 1O1NA 3LB3A 1SHRB 1V07A 1XZVB 2VHBA 2ZLVA 104MA 3WCTC 3UHIA 1EWAA 1A4FA 1HBIA 2HBEA 1XCHA 1HACB 4H0BA 1DM1A 1YZIA 1A01B 3BOMA 1QPWB 3WCTD 2R1HB 4B3WA 1YIEA 1KR7A 2ZS1C 3BOMB 3UH7A 1U7SA 2R1HA 2HBEB 1YEQB 4H2LB 1HABB 1QI8B 1MYZA 2ZS1A 1H1XA 3UH3A 4X0LB 1LH6A 1S0HA 2E2YA 1Y5JB 2GTLB 3AG0A 3LR9A 1RQ4A 5EETA 1O1KB 1MTKA 4HBIA 1YHUB 2O5OX 1O1PB 1J40B 2SPOA 5EYSA 108MA 3MYNA 4PQBA 2EF2A 5CN9A 1LFLA 3WCTA 5KKKA 2HBFA 2HCOA 1A6NA 3BA2A 3UHXA 1GBUB 4M4BA 4MQCA 3NL7B 1UX8A 4HHBB 5EUIA 1GDJA 3WCWC 1YHEB 2DN1A 1CLSB 1BVDA 2BWHA 1Y31B 4O1TA 2BLJM 3ARLA 109MA 1Y5KA 1J7WA 3OVUC 2HZ2A 3ZJOA 4N8TA 1TU9A 1NGKA 5CN5A 5CNFA 2VLZA 3S65B 3KUNA 5EU2A 4KN3A 1J41B 1URYA 5CHQA 5EQMA 1WVPA 3UHDA 1GBVA 1WMUA 3GQRB 1EW6A 1CQ2A 5B84A 3EDBA 3LQDA 2M6ZA 1IBEB 1PBXA 4U8UA 3HXNA 1JF3A 1RTEA 1JY7B 3IC0B 1O1OA 4G51B 3WCVB 3NMLA 4XS0A 1JEBA 1LFYA 3ORDA 3TM3A 2AUPA 1RPSA 4PQCA 4YU3B 1WMUB 3QM8A 1FSXA 1T1NB 4KMVA 1G08B 2D2MB 2M6ZB 1Y8IA 4AVDA 3O7NA 1RQ4B 1RSEA 3QJEA 4HRTB 3QM7A 1LJWB 3OK5A 1MLLA 3PT8A 2H8DA 1GZXB 1UIWB 3OO4A 3G4QA 1HBHB 3LB4A 3ZJSA 1A3OA 1A6MA 1RPSB 5ILPA 2OH8A 1JWNA 2HBCA 3HF4A 2BW9M 1CG5A 3B75A 3A2GA 3AT6B 3BCQB 2PGHB 2NSSA 1YIEB 1BZ6A 2O5BX 4JYQA 5EUIB 5CHRA 1HLBA 1YVTB 3PI9A 5HU6A 3VREB 1BABA 1V4WA 3WFUA 2ZT0A 1XZ7A 1C40B 2EVPA 2MYDA 1DO3A 2G12A 2VRYA 1QXDB 110MA 1NEJB 2B7HA 1SPEA 1J3ZB 1YEOB 5EE4C 1KFRA 1BZ1A 1Y45A 3PI1A 5D5RA 2IG3A 3A59A 2VYYA 1Y0WB 1VWTB 1X9FC 4HSWA 2W6XA 1DXUB 1M6MA 2AV3A 3WHMA 3D7OB 3NFEB 1Y46B 3ZJMA 4O4TA 1VXGA 107MA 3WCUC 3GQGA 1GDIA 3QJBA 2VLXA 3OO5A 3PIAB 2QFKA 1SDKA 1Y01B 1BBBA 1JZMA 1GDLA 3FH9B 1FN3B 4ZVAA 1Y0AA 1FLPA 3DHRB 2MGLA 1GLIB 6HBWA 3P5QB 1Y7DB 1HV4B 3G4WA 1C7DB 3ONZA 1YE0A 1Y8WA 1SWMA 3M39A 3QQRA 1MOHA 1DKEA 1YGFB 2HBGA 1SPGA 3AQ8A 4MBAA 4ESAB 1RVWA 2QRWA 2ZS0D 3H57A 3ZOMA 2MGGA 1HABA 1QI8A 4UIQA 4L7YB 2LHBA 1NPGA 1HDSA 2V1GA 3K8BB 1A9WE 1JEBB 5HBIA 3GYSA 2ZSNA 1MBNA 1G0BA 2HBDB 1S56A 1Y4PB 1Y4QA 4H07A 3E55A 4SDHA 2GTLC 3QZZA 4TWUA 1MBCA 1O1LA 1YHRA 1VXEA 3PI8B 3VAUA 2MGJA 2EKUA 2G14A 1LJWA 3ZOLA 2D6CA 3UH6A 1O1NB 1MLRA 1DXVB 1UMOA 1CG8A 4AVEA 1OJ6A 3LR7A 3OO4B 1HBAB 5E6EB 1XZ4A 1BZZB 1N9IA 3HHBB 1LFQB 3UHBA 1J3YB 1MOBA 1Y7GB 1MYMA 3D17A 2EB9A 3HEOA 2H35A 3QZXA 4NI1B 1X9FB 2MGFA 1GCWB 3VREA 1MLGA 3V2ZA 3BJ2B 1MYJA 3ZJPA 5CNDA 2QLSA 4G1BA 4PNJA 3ECLA 2GL3A 4NI0A 3QM5A 2AV0A 1G0AA 4ROMB 3EOKB 2BNLA 1YVQB 3UHNA 1DUOA 1VXFA 3G46A 4NK1A 3SDNA 4G1VA 5MBNA 3BJ3A 1GLIA 1RVWB 2ZFBB 5CNBA 3VHBA 4MQKB 1O1JA 5EV5A 2ZFOA 5HY8A 1UFPA 1Y83A 2BLHA 1AJ9B 1S5XA 2HBSB 4U8UC 2HHDB 1YE2A 1A6GA 1Y4FA 1KD2B 2G0VA 2HBDA 4FWYA 3UHKA 1Y22B 3D4XB 3WFTA 1BUWB 1M9PA 1F5OA 1ABWA 1IT3A 4U8UD 3IC0A 1JW8A 2Z8AA 4NXCA 1XQ5A 4NXAA 1ABYB 2NX0A 5EYJA 2OH9A 1S69A 4DWTA 1N9HA 1O1JB 3RJNB 3GDJA 3MJUB 4WJGA 1DXVA 1CO9A 4M4AB 5KDQB 2OHAA 4FWXA 4FC3A 1ABSA 1NZ4A 3KUOA 4HRTA 1MYGA 1T1NA 1BZ1B 1Y45B 2ZSXA 2D60A 3VRFA 1RQ3B 5JDOE 1MKOB 4NI1A 1RTXA 1A3NA 2QSSB 2ZS1B 3WCVA 1J7YA 4ODCA 3BJ2A 3UBVA 1YHEA 1V75A 5CNCA 3LB1A 5F2AA 3MBAA 3NMMA 1N9XA 4N7PB 1NQPB 3WCPA 2ZLTA 1S5YB 1LFVA 2YRSB 1K0YA 2H8FB 1Y8HA 3R5IA 3NG6A 1JZKA 1LFLB 1HDBA 4YU4B 1LHSA 3M38A 3WCWB 3ZJQA 1Y35B 1G9VA 1UIWA 1QSIB 5JGGA 3QQQA 1O1MB 1VXBA 2RI4A 2H8FA 3H58A 5CNGA 1NS6A 3OJ1A 2XKIA 1LFVB 1JP6A 1CH7A 1KD2A 2QLSB 3MJPB 1XZ5B 1SDLA 1BZ0B 3QM9A 1LFYB 5B85A 1Y7CA 4F6BA 1VXAA 1V4XB 1W92A 1ECOA 5E83B 3PT7A 1Y4GB 3UHYA 3MKBA 1CQXA 3VRGA 1NPFA 1EBTA 1B0BA 3LHBA 1G09B 1XZUB 1C7BA 1HDSB 1LH3A 1AJGA 4DWUA 1GZXA 1Y4RB 1HBHA 1J52A 1RQAB 2ZSQA 5MBAA 1MTJA 2D2MC 3P5QA 5AB8A 1XXTB 1Y85B 3G53A 1MCYA 1HBRB 1MOCA 4DC8A 3G4YA 2IN4A 1DTMA 4C0NA 1JP9A 2G0ZA 1BJEA 3UHZA 1FHJB 3PIAA 1Y8KA 3HHBA 2HCOB 1DXCA 1MBOA 5E6EA 4L7YA 1Y0TA 3IC2A 1YCAA 1Y4VA 1Y85A 4IT8A 3A59B 1YMBA 2Z6TA 3UHEA 3UGYA 3UHWA 1GCVA 2DHBB 3G4VA 1HV4A 2MHBA 3PELB 1LUEA 1MLHA 1NAZA 1Y4VB 3UBCA 3WCWD 5C6EA 1MWCA 1MDNA 1YVQA 2GDMA 3QM6A 2MGKA 1YENA 4N7OA 4ROLA 1NZ5A 4OF9A 2EVKA 2ZLWB 3MOUA 1BBBB 2WY4A 1ITHA 1CMYA 3GYSB 1C40A 1MLQA 1FAWA 3HENA 103MA 2PEGA 1BZ0A 3LQDB 3UHGA 1GBVB 3ODQB 2R4ZA 2R4WA 1LA6A 3BCQA 2D2NC 5EE4D 1YE0B 2AUQA 3UI0A 1Y7DA 111MA 1Y8WB 4IROA 3PI4A 1A9WA 1Y4RA 1K1KB 1CP5A 5JDOC 1CH4A 1A4FB 2GRZA 3UGZA 1SPGB 2D5ZA 1OUTB 1R1XA 5CN7A 1J3ZA 1TESA 2MGDA 1DXTB 2EKTA 5E29A 2LH5A 3ZJHA 3OO5B 1A0ZA 1HLMA 3CIUA 1YOGA 2G3HA 2QU0B 1SDLB 2LH3A 2GNWA 1Y5FA 3SZKB 3GQRA 2GKMA 5F0BA 2SPLA 4HRRA 1VXDA 2ZT3A 4ILZA 1R1XB 1YFFA 3AT6A 2V1FA 4NZIA 4MXLA 2O5TX 1YZIB 1O1PA 3TLDA 3ZJNA 2AA1A 2HBFB 1XZ2B 3WCTB 2DHBA 4NK2A 3S48C 2NRLA 1NIHB 1LTWA 2MHBB 1NEJA 1Y8IB 2RAOA 2ZLTB 1DO1A 3WR1B 3UHRA 1MZ0A 1XYEA 1MBIA 3ED9A 3UHSA 1J7SA 2G10A 1JPBA 1MNJA 2D5XB 2VYZA 1GCWA 1Y8KB 3S1IA 1HGAA 1MGNA 2H35B 5JDOF 4XS0B 1LFTB 2LH2A 2MGCA 1C7CA 3HF4B 1HCOA 4ZVBA 3GQPA 1CG5B 3B75B 3WFXA 2GTLD 3GLNA 1J7SB 3MVCA 1A0UB 5SW7B 2ZLXB 2RAOB 2ZFOD 1A01A 2W6WA 3ARKA 3IXFA 3A5AA 1OBMA 2WTHA 4C44A 2QSSA 1CP0A 5CNEA 1NS6B 4MQHB 1IRDA 1SI4B 1YG5B 3DHRA 3WTGB 1CH3A 1YEVA 1O1LB 4F6IA 1DUKA 3GK9A 1XZVA 1DO4A 2XKGA 1S6AA 1K0YB 3ZH0A 2G11A 3WCUD 2MGMA 2QU0A 1Y4FB 4OODA 4B4YA 3UHVA 2C0KA 1MYHA 1HBRA 1MNKA 1OR6A 1O1IA 1CBMA 2MGEA 1X3KA 1EMYA 1L2KA 2QSPB 3D1AA 3FS4B 3GKVA 1Y7GA 2CMMA 2OIFA 2GKNA 1H97A 1V4UB 1YCBA 1QSHB 3W4UB 1MWBA 1HSYA 2W72B 1UX9A 2H8DB 3IA3B 2ZLUB 3UHHA 1J7WB 1FDHG 1MNIA 1Y7ZA 2HHBA 2G0SA 3G52A 1YOIA 2ZS0C 2ZFOC 4NI0B 4F68A 1S0HB 2QSPA 3GKVB 4VHBA 1RQAA 2DN3B 4YU3A 5ILRA 2R80B 1Y5FB 3QJDA 2WTGA 1Y09A 4MQIB 5KERB 3PI2A 3A9MA 1NS9B 4N7NA 7HBIA 3UHCA 5EOHA 1OR4A 5HU6B 3ZJLA 1YMCA 1VXCA 1Y4GA 1BZZA 1HGBB 1YIHA 1R1YB 1Y09B 4MQIA 6HBIA 1DLYA 1VWTA 2NRMA 3DHTB 1IBEA 1PBXB 2V1JA 2R80A 1EBCA 4F69A 1V5HA 3G4RA 4MBNA 4F6JA 112MA 5AZQA 2RI4B 1Y46A 1IT2A 1D8UA 2HHEB 2BLIA 1NIHA 2JHOA 1YHUC 5JGGB 1YHRB 3O89A 1IWHB 2HZ3A 1HBSB 1MLKA 4QAUA 3PELA 3EOKA 1HBBA 1HJTA 4IROB 1GCVB 1MNOA 1HCOB 3E5IA 3PT7B 3WCPB 1SDKB 3GKTA 1V4XA 1FHJA 2B7HB 5SW7A 1Y7CB 2MGAA 1X46A 1BZRA 4N7PA 1Y0DA 3RJ6A 1HBBB 1AJ9A 2G0XA 2O58X 1A3OB 1DXTA 1A0ZB 4MQKA 1JDOA 4TWVA 4O4ZA 1SHRA 3G4UA 1HDAA 3UHUA 2PGHA 3KMFA 1QPWA 1MLOA 2SPNA 2W6VA 1BIJB 3AT5A 5ILMA 1JL6A 2Z6NB 1G0AB 2Z85A 1MBAA 1ASHA 3DR9A 3PT8B 1HDAB 2HZ1A 3QJEB 2AA1B 2W31A 1ECAA 2V1KA 2ZSYA 4H2LA 3R0GA 3GDJB 2MYEA 3HEPA 105MA 1DWRA 3ASEA 1FN3A 1Y4PA 1AJHA 3CY5A 3MKBB 1AZIA 3GOUB 1IRCA 3EU1B 1OUUB 2FRKX 1F5PA 3VRFB 3OGBA 2D60B 1MBDA 2HHDA 1RQ3A 2D2NA 1MNHA 1Z8UB 2V1IA 2ZS0B 2W72A 1CG8B 1IOPA 1GJNA 5ILEA 4MPMA 1IWHA 2VYWA 1GDKA 4WJG1 3K9ZA 3A5BA 1YEOA 1I3DA 3QJCA 2ZT1A 1HHOB 1N9FA 1XZ2A 3M3BA 1CLSA 1A0UA 2XYKA 2DC3A 1Y0CA 1NZ2A 1HDBB 1MYIA 1LHTA 1LH2A 3NG6B 1Y5KB 2GNVA 2R4XA 1Y31A 1M9PB 5M3SA 3SZKA 1YGDA 2R4YA 2GLNA 1MKOA 3MJPA 1V75B 3SDHA 2D5XA 1J40A 2R50A 3BJ1B 1A00A 1CH5A 4MAXA 2QMBB 3WFWA 2LH6A 3D17B 1NWNA 3ZJIA 3KMFC 2HBCB 1CH1A 2ZFBA 1IDRA 5HLUA 5HLXA 2BMMA 3PI8A 1UVXA 1Y2ZB 2OLPA 1C7BB 1Y0AB 1CIOA 2FAMA 1O1KA 1V4UA 1ABWB 1JZLA 4KJTA 4F4OB 3ARJA 4MU5A 3HRWA 4L2MA 1MBSA 1MLJA 1DTIA 3CY5B 2GRHA 1XY0B 1JL7A 1CPWA 1THBA 1V4WB 1VRFA 4F6GA 2GRFA 3ZJJA 2W6YA 5IKSA 1O16A 1QXEA 1BVCA 2MGHA 3AQ9A 4F4OA 2VEEA 2FRFA 3K8BA 5C6YA 2D5ZB 5AZRA 2ZFOB 2ZT4A 1UT0A 1BIJA 5CN8A 3S66A 3QJCB 3WR1A 1YDZA 4DC7A 1G09A 1XZUA 1Y5JA 3W4UA 4UZVA 2ZLVB 1CH2A 2ZWJA 4F6DA 3PI3A 1FSLA 3BJ3B 2OHBA 2ZS1D 3DHTA 2O5QX 3DUTB 1XZ7B 3ZJRA 2FALA 1BABB 1XQ5B 1JF4A 3FH9A 3EDAA 2MB5A 1OUUA 1OFKA 3NL7A 2W72C 4HRRB 3WCUB 2ZLWA 1J3YA 1LFQA 2ZSOA 4N7OB 3LB2A 4ROLB 1PMBA 5CN6A 1ECDA 1S5XB 4HHBA 3ECZA 2HBSA 1JY7A 101MA 1G9VB 3V2VA 1Y0WA 1LH5A 3OZWA 4ESAA 1IRDB 3WCWA 1HHOA 4O35A 3ECXA 1UC3A 3A0GA 1VREA 3D7OA 3NFEA 1DWSA 3S65A 3WCVD 1YHUD 3AQ6A 1HBGA 2FRIX 1LA6B 1FSXB 4GZGA 1URVA 1VHBA 3MJUA 2XKHA 1LH1A 3NMMB 1FDHA 3TM9A 3WI8A 1YH9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 106M A;  2MBW A;  1THB B;  3QMA A;  1DLW A;  1JP8 A;  4FWZ A;  1C7C B;  1XY0 A;  1MOA A;  1FCS A;  5E83 A;  1NQP A;  3D1A B;  3FS4 A;  4G51 A;  1YEQ A;  5JDO D;  3AQ7 A;  1BZP A;  3HXN B;  4U8U B;  1O1O B;  1XYE B;  1Y83 B;  1HAC A;  1YEU B;  3CIU B;  5HY8 B;  4MXK A;  2D2N D;  1YMA A;  1NXF A;  5HAV A;  1DKE B;  1YGF A;  1HGA B;  3WHM B;  1I3E A;  1YH9 A;  1MWD A;  1MOD A;  1UVY A;  4NS2 A;  1XZ4 B;  2HHB B;  1HBA A;  1YDZ B;  1YOH A;  1K1K A;  2D2M A;  2ZT2 A;  1COH A;  4KMW A;  4MQJ B;  1HRM A;  3EU1 A;  4YU4 A;  3MYM A;  1Y4Q B;  4M4A A;  1S5Y A;  1G0B B;  1O1I B;  1MYF A;  3AQ5 A;  3OZU A;  1MLS A;  1MLN A;  2BKM A;  2PEG B;  1QXE B;  1Y0T B;  1CH9 A;  3A5G A;  3OZV A;  1V9Q A;  2MYC A;  3WCV C;  1YIH B;  3RGK A;  2O5L X;  2ZSP A;  1Y0C B;  1HGB A;  4ODC B;  1J3F A;  3WCU A;  3UHQ A;  1A3N B;  1M6C A;  3HC9 A;  1F65 A;  1UFJ A;  4TYX A;  3S66 B;  2LH7 A;  1J41 A;  2AUO A;  2ZLU A;  4MQG A;  1NWI A;  1LH7 A;  2W6V B;  1VXH A;  1B86 A;  1HBS A;  1LFZ A;  2D2M D;  3A0G B;  2FRJ X;  2YRS A;  4JAC A;  3R5I B;  1MYT A;  5KDQ A;  4MQH A;  3VRG B;  1C7D A;  3ONZ B;  1A00 B;  1MLF A;  1Y4B B;  2QMB A;  2D2N B;  6HBW B;  3IC2 B;  2ZS0 A;  2Z6S A;  4N8T B;  1R1Y A;  3M3A A;  1DXD A;  2O5M X;  1Y0D B;  1ABY A;  1FAW B;  1BUW A;  2NSR A;  2SPM A;  2VM0 A;  3ODQ A;  1LFT A;  3GOU A;  2VEB A;  2ZSZ A;  3GQG B;  5CN4 A;  2MGB A;  1CIK A;  2MYA A;  5C6E B;  2ZST A;  3QJB B;  5KER A;  1Y4B A;  2DN2 A;  3HRW B;  3AT5 B;  5D1V A;  2MYB A;  3D1K B;  2ZSS A;  4FC3 B;  1U7R A;  3E5O A;  3UHT A;  2GTL A;  1YEN B;  1HGC B;  1Y8H B;  1OUT A;  4X0L A;  2MGI A;  3HYU B;  2LH1 A;  2QFN A;  1MTI A;  2AUR A;  2DN2 B;  3BJ1 A;  1A6K A;  1QSH A;  1Q1F A;  1NZ3 A;  4PQ6 A;  1YVT A;  1ECN A;  3PI9 B;  3ZHW A;  102M A;  1Y22 A;  3D4X A;  3D1K A;  1J7Y B;  1MLM A;  1G08 A;  4FH6 A;  1YEU A;  2ZLX A;  1CO8 A;  3QJD B;  1F63 A;  2VLY A;  3UH5 A;  1GBU A;  3U3E A;  4MQC B;  4F6F A;  4WCH D;  2DN3 A;  3S1J A;  2DXM B;  4LPI A;  1DXU A;  5JOM A;  1NS9 A;  1DWT A;  1MLU A;  1B86 B;  3E4N A;  1COH B;  4MQJ A;  2EB8 A;  2Z6N A;  5CMV A;  1LFZ B;  1YHU A;  1S61 A;  4MQG B;  1QSI A;  1X9F D;  3K3U A;  2G0R A;  1GVH A;  4UUR A;  4FH7 A;  1CBL A;  4ROM A;  1Y7Z B;  2HHE A;  2O5S X;  2BK9 A;  2DXM A;  4O2G A;  3MN0 A;  4XDI A;  1QXD A;  1XZ5 A;  1BIN A;  1YFF B;  4BJA A;  4M4B B;  5HLQ A;  3GQP B;  1CMY B;  1X9F A;  3DUT A;  1YGD B;  5E29 B;  2DN1 B;  2KSC A;  1YE2 B;  1O1M A;  4N7N B;  1OFJ A;  2V1H A;  2V1E A;  3WTG A;  1DO7 A;  1YG5 A;  2ZSR A;  1Y35 A;  1YEV B;  1SI4 A;  1Y2Z A;  4HSX A;  1WLA A;  1XXT A;  1HGC A;  3HYU A;  1O1N A;  3LB3 A;  1SHR B;  1V07 A;  1XZV B;  2VHB A;  2ZLV A;  104M A;  3WCT C;  3UHI A;  1EWA A;  1A4F A;  1HBI A;  2HBE A;  1XCH A;  1HAC B;  4H0B A;  1DM1 A;  1YZI A;  1A01 B;  3BOM A;  1QPW B;  3WCT D;  2R1H B;  4B3W A;  1YIE A;  1KR7 A;  2ZS1 C;  3BOM B;  3UH7 A;  1U7S A;  2R1H A;  2HBE B;  1YEQ B;  4H2L B;  1HAB B;  1QI8 B;  1MYZ A;  2ZS1 A;  1H1X A;  3UH3 A;  4X0L B;  1LH6 A;  1S0H A;  2E2Y A;  1Y5J B;  2GTL B;  3AG0 A;  3LR9 A;  1RQ4 A;  5EET A;  1O1K B;  1MTK A;  4HBI A;  1YHU B;  2O5O X;  1O1P B;  1J40 B;  2SPO A;  5EYS A;  108M A;  3MYN A;  4PQB A;  2EF2 A;  5CN9 A;  1LFL A;  3WCT A;  5KKK A;  2HBF A;  2HCO A;  1A6N A;  3BA2 A;  3UHX A;  1GBU B;  4M4B A;  4MQC A;  3NL7 B;  1UX8 A;  4HHB B;  5EUI A;  1GDJ A;  3WCW C;  1YHE B;  2DN1 A;  1CLS B;  1BVD A;  2BWH A;  1Y31 B;  4O1T A;  2BLJ M;  3ARL A;  109M A;  1Y5K A;  1J7W A;  3OVU C;  2HZ2 A;  3ZJO A;  4N8T A;  1TU9 A;  1NGK A;  5CN5 A;  5CNF A;  2VLZ A;  3S65 B;  3KUN A;  5EU2 A;  4KN3 A;  1J41 B;  1URY A;  5CHQ A;  5EQM A;  1WVP A;  3UHD A;  1GBV A;  1WMU A;  3GQR B;  1EW6 A;  1CQ2 A;  5B84 A;  3EDB A;  3LQD A;  2M6Z A;  1IBE B;  1PBX A;  4U8U A;  3HXN A;  1JF3 A;  1RTE A;  1JY7 B;  3IC0 B;  1O1O A;  4G51 B;  3WCV B;  3NML A;  4XS0 A;  1JEB A;  1LFY A;  3ORD A;  3TM3 A;  2AUP A;  1RPS A;  4PQC A;  4YU3 B;  1WMU B;  3QM8 A;  1FSX A;  1T1N B;  4KMV A;  1G08 B;  2D2M B;  2M6Z B;  1Y8I A;  4AVD A;  3O7N A;  1RQ4 B;  1RSE A;  3QJE A;  4HRT B;  3QM7 A;  1LJW B;  3OK5 A;  1MLL A;  3PT8 A;  2H8D A;  1GZX B;  1UIW B;  3OO4 A;  3G4Q A;  1HBH B;  3LB4 A;  3ZJS A;  1A3O A;  1A6M A;  1RPS B;  5ILP A;  2OH8 A;  1JWN A;  2HBC A;  3HF4 A;  2BW9 M;  1CG5 A;  3B75 A;  3A2G A;  3AT6 B;  3BCQ B;  2PGH B;  2NSS A;  1YIE B;  1BZ6 A;  2O5B X;  4JYQ A;  5EUI B;  5CHR A;  1HLB A;  1YVT B;  3PI9 A;  5HU6 A;  3VRE B;  1BAB A;  1V4W A;  3WFU A;  2ZT0 A;  1XZ7 A;  1C40 B;  2EVP A;  2MYD A;  1DO3 A;  2G12 A;  2VRY A;  1QXD B;  110M A;  1NEJ B;  2B7H A;  1SPE A;  1J3Z B;  1YEO B;  5EE4 C;  1KFR A;  1BZ1 A;  1Y45 A;  3PI1 A;  5D5R A;  2IG3 A;  3A59 A;  2VYY A;  1Y0W B;  1VWT B;  1X9F C;  4HSW A;  2W6X A;  1DXU B;  1M6M A;  2AV3 A;  3WHM A;  3D7O B;  3NFE B;  1Y46 B;  3ZJM A;  4O4T A;  1VXG A;  107M A;  3WCU C;  3GQG A;  1GDI A;  3QJB A;  2VLX A;  3OO5 A;  3PIA B;  2QFK A;  1SDK A;  1Y01 B;  1BBB A;  1JZM A;  1GDL A;  3FH9 B;  1FN3 B;  4ZVA A;  1Y0A A;  1FLP A;  3DHR B;  2MGL A;  1GLI B;  6HBW A;  3P5Q B;  1Y7D B;  1HV4 B;  3G4W A;  1C7D B;  3ONZ A;  1YE0 A;  1Y8W A;  1SWM A;  3M39 A;  3QQR A;  1MOH A;  1DKE A;  1YGF B;  2HBG A;  1SPG A;  3AQ8 A;  4MBA A;  4ESA B;  1RVW A;  2QRW A;  2ZS0 D;  3H57 A;  3ZOM A;  2MGG A;  1HAB A;  1QI8 A;  4UIQ A;  4L7Y B;  2LHB A;  1NPG A;  1HDS A;  2V1G A;  3K8B B;  1A9W E;  1JEB B;  5HBI A;  3GYS A;  2ZSN A;  1MBN A;  1G0B A;  2HBD B;  1S56 A;  1Y4P B;  1Y4Q A;  4H07 A;  3E55 A;  4SDH A;  2GTL C;  3QZZ A;  4TWU A;  1MBC A;  1O1L A;  1YHR A;  1VXE A;  3PI8 B;  3VAU A;  2MGJ A;  2EKU A;  2G14 A;  1LJW A;  3ZOL A;  2D6C A;  3UH6 A;  1O1N B;  1MLR A;  1DXV B;  1UMO A;  1CG8 A;  4AVE A;  1OJ6 A;  3LR7 A;  3OO4 B;  1HBA B;  5E6E B;  1XZ4 A;  1BZZ B;  1N9I A;  3HHB B;  1LFQ B;  3UHB A;  1J3Y B;  1MOB A;  1Y7G B;  1MYM A;  3D17 A;  2EB9 A;  3HEO A;  2H35 A;  3QZX A;  4NI1 B;  1X9F B;  2MGF A;  1GCW B;  3VRE A;  1MLG A;  3V2Z A;  3BJ2 B;  1MYJ A;  3ZJP A;  5CND A;  2QLS A;  4G1B A;  4PNJ A;  3ECL A;  2GL3 A;  4NI0 A;  3QM5 A;  2AV0 A;  1G0A A;  4ROM B;  3EOK B;  2BNL A;  1YVQ B;  3UHN A;  1DUO A;  1VXF A;  3G46 A;  4NK1 A;  3SDN A;  4G1V A;  5MBN A;  3BJ3 A;  1GLI A;  1RVW B;  2ZFB B;  5CNB A;  3VHB A;  4MQK B;  1O1J A;  5EV5 A;  2ZFO A;  5HY8 A;  1UFP A;  1Y83 A;  2BLH A;  1AJ9 B;  1S5X A;  2HBS B;  4U8U C;  2HHD B;  1YE2 A;  1A6G A;  1Y4F A;  1KD2 B;  2G0V A;  2HBD A;  4FWY A;  3UHK A;  1Y22 B;  3D4X B;  3WFT A;  1BUW B;  1M9P A;  1F5O A;  1ABW A;  1IT3 A;  4U8U D;  3IC0 A;  1JW8 A;  2Z8A A;  4NXC A;  1XQ5 A;  4NXA A;  1ABY B;  2NX0 A;  5EYJ A;  2OH9 A;  1S69 A;  4DWT A;  1N9H A;  1O1J B;  3RJN B;  3GDJ A;  3MJU B;  4WJG A;  1DXV A;  1CO9 A;  4M4A B;  5KDQ B;  2OHA A;  4FWX A;  4FC3 A;  1ABS A;  1NZ4 A;  3KUO A;  4HRT A;  1MYG A;  1T1N A;  1BZ1 B;  1Y45 B;  2ZSX A;  2D60 A;  3VRF A;  1RQ3 B;  5JDO E;  1MKO B;  4NI1 A;  1RTX A;  1A3N A;  2QSS B;  2ZS1 B;  3WCV A;  1J7Y A;  4ODC A;  3BJ2 A;  3UBV A;  1YHE A;  1V75 A;  5CNC A;  3LB1 A;  5F2A A;  3MBA A;  3NMM A;  1N9X A;  4N7P B;  1NQP B;  3WCP A;  2ZLT A;  1S5Y B;  1LFV A;  2YRS B;  1K0Y A;  2H8F B;  1Y8H A;  3R5I A;  3NG6 A;  1JZK A;  1LFL B;  1HDB A;  4YU4 B;  1LHS A;  3M38 A;  3WCW B;  3ZJQ A;  1Y35 B;  1G9V A;  1UIW A;  1QSI B;  5JGG A;  3QQQ A;  1O1M B;  1VXB A;  2RI4 A;  2H8F A;  3H58 A;  5CNG A;  1NS6 A;  3OJ1 A;  2XKI A;  1LFV B;  1JP6 A;  1CH7 A;  1KD2 A;  2QLS B;  3MJP B;  1XZ5 B;  1SDL A;  1BZ0 B;  3QM9 A;  1LFY B;  5B85 A;  1Y7C A;  4F6B A;  1VXA A;  1V4X B;  1W92 A;  1ECO A;  5E83 B;  3PT7 A;  1Y4G B;  3UHY A;  3MKB A;  1CQX A;  3VRG A;  1NPF A;  1EBT A;  1B0B A;  3LHB A;  1G09 B;  1XZU B;  1C7B A;  1HDS B;  1LH3 A;  1AJG A;  4DWU A;  1GZX A;  1Y4R B;  1HBH A;  1J52 A;  1RQA B;  2ZSQ A;  5MBA A;  1MTJ A;  2D2M C;  3P5Q A;  5AB8 A;  1XXT B;  1Y85 B;  3G53 A;  1MCY A;  1HBR B;  1MOC A;  4DC8 A;  3G4Y A;  2IN4 A;  1DTM A;  4C0N A;  1JP9 A;  2G0Z A;  1BJE A;  3UHZ A;  1FHJ B;  3PIA A;  1Y8K A;  3HHB A;  2HCO B;  1DXC A;  1MBO A;  5E6E A;  4L7Y A;  1Y0T A;  3IC2 A;  1YCA A;  1Y4V A;  1Y85 A;  4IT8 A;  3A59 B;  1YMB A;  2Z6T A;  3UHE A;  3UGY A;  3UHW A;  1GCV A;  2DHB B;  3G4V A;  1HV4 A;  2MHB A;  3PEL B;  1LUE A;  1MLH A;  1NAZ A;  1Y4V B;  3UBC A;  3WCW D;  5C6E A;  1MWC A;  1MDN A;  1YVQ A;  2GDM A;  3QM6 A;  2MGK A;  1YEN A;  4N7O A;  4ROL A;  1NZ5 A;  4OF9 A;  2EVK A;  2ZLW B;  3MOU A;  1BBB B;  2WY4 A;  1ITH A;  1CMY A;  3GYS B;  1C40 A;  1MLQ A;  1FAW A;  3HEN A;  103M A;  2PEG A;  1BZ0 A;  3LQD B;  3UHG A;  1GBV B;  3ODQ B;  2R4Z A;  2R4W A;  1LA6 A;  3BCQ A;  2D2N C;  5EE4 D;  1YE0 B;  2AUQ A;  3UI0 A;  1Y7D A;  111M A;  1Y8W B;  4IRO A;  3PI4 A;  1A9W A;  1Y4R A;  1K1K B;  1CP5 A;  5JDO C;  1CH4 A;  1A4F B;  2GRZ A;  3UGZ A;  1SPG B;  2D5Z A;  1OUT B;  1R1X A;  5CN7 A;  1J3Z A;  1TES A;  2MGD A;  1DXT B;  2EKT A;  5E29 A;  2LH5 A;  3ZJH A;  3OO5 B;  1A0Z A;  1HLM A;  3CIU A;  1YOG A;  2G3H A;  2QU0 B;  1SDL B;  2LH3 A;  2GNW A;  1Y5F A;  3SZK B;  3GQR A;  2GKM A;  5F0B A;  2SPL A;  4HRR A;  1VXD A;  2ZT3 A;  4ILZ A;  1R1X B;  1YFF A;  3AT6 A;  2V1F A;  4NZI A;  4MXL A;  2O5T X;  1YZI B;  1O1P A;  3TLD A;  3ZJN A;  2AA1 A;  2HBF B;  1XZ2 B;  3WCT B;  2DHB A;  4NK2 A;  3S48 C;  2NRL A;  1NIH B;  1LTW A;  2MHB B;  1NEJ A;  1Y8I B;  2RAO A;  2ZLT B;  1DO1 A;  3WR1 B;  3UHR A;  1MZ0 A;  1XYE A;  1MBI A;  3ED9 A;  3UHS A;  1J7S A;  2G10 A;  1JPB A;  1MNJ A;  2D5X B;  2VYZ A;  1GCW A;  1Y8K B;  3S1I A;  1HGA A;  1MGN A;  2H35 B;  5JDO F;  4XS0 B;  1LFT B;  2LH2 A;  2MGC A;  1C7C A;  3HF4 B;  1HCO A;  4ZVB A;  3GQP A;  1CG5 B;  3B75 B;  3WFX A;  2GTL D;  3GLN A;  1J7S B;  3MVC A;  1A0U B;  5SW7 B;  2ZLX B;  2RAO B;  2ZFO D;  1A01 A;  2W6W A;  3ARK A;  3IXF A;  3A5A A;  1OBM A;  2WTH A;  4C44 A;  2QSS A;  1CP0 A;  5CNE A;  1NS6 B;  4MQH B;  1IRD A;  1SI4 B;  1YG5 B;  3DHR A;  3WTG B;  1CH3 A;  1YEV A;  1O1L B;  4F6I A;  1DUK A;  3GK9 A;  1XZV A;  1DO4 A;  2XKG A;  1S6A A;  1K0Y B;  3ZH0 A;  2G11 A;  3WCU D;  2MGM A;  2QU0 A;  1Y4F B;  4OOD A;  4B4Y A;  3UHV A;  2C0K A;  1MYH A;  1HBR A;  1MNK A;  1OR6 A;  1O1I A;  1CBM A;  2MGE A;  1X3K A;  1EMY A;  1L2K A;  2QSP B;  3D1A A;  3FS4 B;  3GKV A;  1Y7G A;  2CMM A;  2OIF A;  2GKN A;  1H97 A;  1V4U B;  1YCB A;  1QSH B;  3W4U B;  1MWB A;  1HSY A;  2W72 B;  1UX9 A;  2H8D B;  3IA3 B;  2ZLU B;  3UHH A;  1J7W B;  1FDH G;  1MNI A;  1Y7Z A;  2HHB A;  2G0S A;  3G52 A;  1YOI A;  2ZS0 C;  2ZFO C;  4NI0 B;  4F68 A;  1S0H B;  2QSP A;  3GKV B;  4VHB A;  1RQA A;  2DN3 B;  4YU3 A;  5ILR A;  2R80 B;  1Y5F B;  3QJD A;  2WTG A;  1Y09 A;  4MQI B;  5KER B;  3PI2 A;  3A9M A;  1NS9 B;  4N7N A;  7HBI A;  3UHC A;  5EOH A;  1OR4 A;  5HU6 B;  3ZJL A;  1YMC A;  1VXC A;  1Y4G A;  1BZZ A;  1HGB B;  1YIH A;  1R1Y B;  1Y09 B;  4MQI A;  6HBI A;  1DLY A;  1VWT A;  2NRM A;  3DHT B;  1IBE A;  1PBX B;  2V1J A;  2R80 A;  1EBC A;  4F69 A;  1V5H A;  3G4R A;  4MBN A;  4F6J A;  112M A;  5AZQ A;  2RI4 B;  1Y46 A;  1IT2 A;  1D8U A;  2HHE B;  2BLI A;  1NIH A;  2JHO A;  1YHU C;  5JGG B;  1YHR B;  3O89 A;  1IWH B;  2HZ3 A;  1HBS B;  1MLK A;  4QAU A;  3PEL A;  3EOK A;  1HBB A;  1HJT A;  4IRO B;  1GCV B;  1MNO A;  1HCO B;  3E5I A;  3PT7 B;  3WCP B;  1SDK B;  3GKT A;  1V4X A;  1FHJ A;  2B7H B;  5SW7 A;  1Y7C B;  2MGA A;  1X46 A;  1BZR A;  4N7P A;  1Y0D A;  3RJ6 A;  1HBB B;  1AJ9 A;  2G0X A;  2O58 X;  1A3O B;  1DXT A;  1A0Z B;  4MQK A;  1JDO A;  4TWV A;  4O4Z A;  1SHR A;  3G4U A;  1HDA A;  3UHU A;  2PGH A;  3KMF A;  1QPW A;  1MLO A;  2SPN A;  2W6V A;  1BIJ B;  3AT5 A;  5ILM A;  1JL6 A;  2Z6N B;  1G0A B;  2Z85 A;  1MBA A;  1ASH A;  3DR9 A;  3PT8 B;  1HDA B;  2HZ1 A;  3QJE B;  2AA1 B;  2W31 A;  1ECA A;  2V1K A;  2ZSY A;  4H2L A;  3R0G A;  3GDJ B;  2MYE A;  3HEP A;  105M A;  1DWR A;  3ASE A;  1FN3 A;  1Y4P A;  1AJH A;  3CY5 A;  3MKB B;  1AZI A;  3GOU B;  1IRC A;  3EU1 B;  1OUU B;  2FRK X;  1F5P A;  3VRF B;  3OGB A;  2D60 B;  1MBD A;  2HHD A;  1RQ3 A;  2D2N A;  1MNH A;  1Z8U B;  2V1I A;  2ZS0 B;  2W72 A;  1CG8 B;  1IOP A;  1GJN A;  5ILE A;  4MPM A;  1IWH A;  2VYW A;  1GDK A;  4WJG 1;  3K9Z A;  3A5B A;  1YEO A;  1I3D A;  3QJC A;  2ZT1 A;  1HHO B;  1N9F A;  1XZ2 A;  3M3B A;  1CLS A;  1A0U A;  2XYK A;  2DC3 A;  1Y0C A;  1NZ2 A;  1HDB B;  1MYI A;  1LHT A;  1LH2 A;  3NG6 B;  1Y5K B;  2GNV A;  2R4X A;  1Y31 A;  1M9P B;  5M3S A;  3SZK A;  1YGD A;  2R4Y A;  2GLN A;  1MKO A;  3MJP A;  1V75 B;  3SDH A;  2D5X A;  1J40 A;  2R50 A;  3BJ1 B;  1A00 A;  1CH5 A;  4MAX A;  2QMB B;  3WFW A;  2LH6 A;  3D17 B;  1NWN A;  3ZJI A;  3KMF C;  2HBC B;  1CH1 A;  2ZFB A;  1IDR A;  5HLU A;  5HLX A;  2BMM A;  3PI8 A;  1UVX A;  1Y2Z B;  2OLP A;  1C7B B;  1Y0A B;  1CIO A;  2FAM A;  1O1K A;  1V4U A;  1ABW B;  1JZL A;  4KJT A;  4F4O B;  3ARJ A;  4MU5 A;  3HRW A;  4L2M A;  1MBS A;  1MLJ A;  1DTI A;  3CY5 B;  2GRH A;  1XY0 B;  1JL7 A;  1CPW A;  1THB A;  1V4W B;  1VRF A;  4F6G A;  2GRF A;  3ZJJ A;  2W6Y A;  5IKS A;  1O16 A;  1QXE A;  1BVC A;  2MGH A;  3AQ9 A;  4F4O A;  2VEE A;  2FRF A;  3K8B A;  5C6Y A;  2D5Z B;  5AZR A;  2ZFO B;  2ZT4 A;  1UT0 A;  1BIJ A;  5CN8 A;  3S66 A;  3QJC B;  3WR1 A;  1YDZ A;  4DC7 A;  1G09 A;  1XZU A;  1Y5J A;  3W4U A;  4UZV A;  2ZLV B;  1CH2 A;  2ZWJ A;  4F6D A;  3PI3 A;  1FSL A;  3BJ3 B;  2OHB A;  2ZS1 D;  3DHT A;  2O5Q X;  3DUT B;  1XZ7 B;  3ZJR A;  2FAL A;  1BAB B;  1XQ5 B;  1JF4 A;  3FH9 A;  3EDA A;  2MB5 A;  1OUU A;  1OFK A;  3NL7 A;  2W72 C;  4HRR B;  3WCU B;  2ZLW A;  1J3Y A;  1LFQ A;  2ZSO A;  4N7O B;  3LB2 A;  4ROL B;  1PMB A;  5CN6 A;  1ECD A;  1S5X B;  4HHB A;  3ECZ A;  2HBS A;  1JY7 A;  101M A;  1G9V B;  3V2V A;  1Y0W A;  1LH5 A;  3OZW A;  4ESA A;  1IRD B;  3WCW A;  1HHO A;  4O35 A;  3ECX A;  1UC3 A;  3A0G A;  1VRE A;  3D7O A;  3NFE A;  1DWS A;  3S65 A;  3WCV D;  1YHU D;  3AQ6 A;  1HBG A;  2FRI X;  1LA6 B;  1FSX B;  4GZG A;  1URV A;  1VHB A;  3MJU A;  2XKH A;  1LH1 A;  3NMM B;  1FDH A;  3TM9 A;  3WI8 A;  1YH9 B; 
#chains in the Genus database with same CATH topology
 106M A;  2MBW A;  4A8M P;  1THB B;  3QMA A;  1DLW A;  1JP8 A;  4FWZ A;  1C7C B;  1XY0 A;  1MOA A;  1FCS A;  5E83 A;  1NQP A;  3D1A B;  3FS4 A;  4G51 A;  1YEQ A;  5JDO D;  3AQ7 A;  1BZP A;  3HXN B;  4U8U B;  1O1O B;  1XYE B;  1Y83 B;  1HAC A;  1YEU B;  2JL9 A;  3CIU B;  5HY8 B;  4MXK A;  2D2N D;  1YMA A;  1NXF A;  5HAV A;  2BV8 A;  1DKE B;  1YGF A;  1HGA B;  3WHM B;  1I3E A;  1YH9 A;  1MWD A;  1MOD A;  1UVY A;  4NS2 A;  1XZ4 B;  4A8Y A;  2HHB B;  2UUL C;  1HBA A;  1YDZ B;  1YOH A;  1K1K A;  2D2M A;  2ZT2 A;  3O2C A;  1COH A;  4KMW A;  4MQJ B;  1HRM A;  3EU1 A;  4YU4 A;  3MYM A;  4PO5 B;  1Y4Q B;  4M4A A;  1S5Y A;  1G0B B;  3GIO A;  1O1I B;  1MYF A;  3AQ5 A;  1NY9 A;  3OZU A;  1MLS A;  1MLN A;  3LQ9 A;  2BKM A;  2PEG B;  1QXE B;  1Y0T B;  1CH9 A;  3A5G A;  3OZV A;  1V9Q A;  2MYC A;  3WCV C;  1YIH B;  3RGK A;  2O5L X;  2ZSP A;  1Y0C B;  1HGB A;  2DKD A;  4ODC B;  1J3F A;  2UUL H;  3WCU A;  3UHQ A;  1A3N B;  1M6C A;  3HC9 A;  1F65 A;  1UFJ A;  4TYX A;  3S66 B;  2LH7 A;  1J41 A;  2AUO A;  2ZLU A;  4MQG A;  1NWI A;  1LH7 A;  2W6V B;  1VXH A;  1B86 A;  1HBS A;  1LFZ A;  2D2M D;  3A0G B;  2FRJ X;  2YRS A;  4JAC A;  1B33 A;  3R5I B;  1MYT A;  5KDQ A;  4MQH A;  3VRG B;  4A8O A;  1C7D A;  3ONZ B;  4H0M A;  1A00 B;  1MLF A;  4ESU A;  1XG0 C;  1Y4B B;  2QMB A;  2D2N B;  6HBW B;  3IC2 B;  2ZS0 A;  2Z6S A;  4N8T B;  1R1Y A;  3M3A A;  1DXD A;  2O5M X;  1Y0D B;  1ABY A;  1FAW B;  1BUW A;  2NSR A;  2SPM A;  2VM0 A;  3ODQ A;  1LFT A;  1LIA B;  3GOU A;  2VEB A;  2ZSZ A;  3GQG B;  5CN4 A;  2MGB A;  1CIK A;  2MYA A;  5C6E B;  2ZST A;  3QJB B;  5KER A;  1Y4B A;  2DN2 A;  3HRW B;  3AT5 B;  5D1V A;  2MYB A;  3D1K B;  2ZSS A;  4FC3 B;  1U7R A;  3E5O A;  2UUL A;  3UHT A;  2GTL A;  1YEN B;  1HGC B;  4YJJ A;  1Y8H B;  1OUT A;  4X0L A;  2MGI A;  3HYU B;  3O2C B;  2LH1 A;  2QFN A;  1MTI A;  2AUR A;  2DN2 B;  3BJ1 A;  4B02 A;  1A6K A;  1QSH A;  1Q1F A;  1NZ3 A;  4PQ6 A;  1YVT A;  1ECN A;  3PI9 B;  3ZHW A;  102M A;  2VML B;  1Y22 A;  3D4X A;  3D1K A;  1J7Y B;  1MLM A;  1G08 A;  4FH6 A;  1YEU A;  5AQD M;  2ZLX A;  1CO8 A;  3QJD B;  1F63 A;  2VLY A;  3UH5 A;  1GBU A;  3U3E A;  4MQC B;  4F6F A;  2UUM X;  4WCH D;  2DN3 A;  3S1J A;  2DXM B;  4LPI A;  1DXU A;  5JOM A;  1NS9 A;  1DWT A;  1MLU A;  1B86 B;  3E4N A;  1COH B;  4MQJ A;  2EB8 A;  2Z6N A;  5CMV A;  1LFZ B;  1YHU A;  1S61 A;  4MQG B;  1QSI A;  1X9F D;  3K3U A;  2G0R A;  1GVH A;  4UUR A;  4FH7 A;  3V57 A;  1CBL A;  4ROM A;  1Y7Z B;  2HHE A;  2O5S X;  2BK9 A;  2DXM A;  4O2G A;  3MN0 A;  4XDI A;  1QXD A;  1XZ5 A;  2V8A B;  1BIN A;  1YFF B;  4BJA A;  4M4B B;  5HLQ A;  3GQP B;  1CMY B;  1X9F A;  4GY3 B;  3DUT A;  1YGD B;  5E29 B;  2DN1 B;  2KSC A;  1YE2 B;  1O1M A;  4N7N B;  4F0U A;  1OFJ A;  2V1H A;  4ZIZ A;  2V1E A;  3WTG A;  1DO7 A;  1YG5 A;  2ZSR A;  1Y35 A;  1YEV B;  1PHN B;  1SI4 A;  1Y2Z A;  4HSX A;  1WLA A;  2YSK A;  1XXT A;  1HGC A;  3HYU A;  1O1N A;  3LB3 A;  1ALL B;  1SHR B;  1V07 A;  3DBJ A;  2UUN A;  1XZV B;  2VHB A;  3L0F B;  2ZLV A;  104M A;  4N6S B;  3WCT C;  3UHI A;  1EWA A;  1A4F A;  1HBI A;  2HBE A;  1XCH A;  1HAC B;  4H0B A;  1DM1 A;  1YZI A;  1A01 B;  3BOM A;  1QPW B;  3WCT D;  2R1H B;  4B3W A;  2C7L A;  1YIE A;  1KR7 A;  2ZS1 C;  3BOM B;  3UH7 A;  1U7S A;  2R1H A;  2HBE B;  1YEQ B;  4H2L B;  1HAB B;  1QI8 B;  1MYZ A;  2ZS1 A;  1H1X A;  1F99 B;  3UH3 A;  4X0L B;  1LH6 A;  1S0H A;  2E2Y A;  2C7L B;  1Y5J B;  2GTL B;  3AG0 A;  3LR9 A;  1RQ4 A;  5EET A;  1O1K B;  1MTK A;  4HBI A;  4F0T A;  1YHU B;  2O5O X;  1O1P B;  4TMA B;  3V58 B;  1J40 B;  2SPO A;  5EYS A;  108M A;  3O18 A;  3MYN A;  4PQB A;  2EF2 A;  5CN9 A;  1LFL A;  3WCT A;  5KKK A;  2HBF A;  2HCO A;  1A6N A;  3BA2 A;  3UHX A;  1GBU B;  4M4B A;  4MQC A;  3NL7 B;  1UX8 A;  2UUN D;  4HHB B;  5EUI A;  1GDJ A;  3WCW C;  1YHE B;  2DN1 A;  1CLS B;  1BVD A;  4Q70 B;  2BWH A;  1Y31 B;  4O1T A;  2BLJ M;  3ARL A;  109M A;  1Y5K A;  1J7W A;  3OVU C;  2HZ2 A;  1ON7 A;  3ZJO A;  4AE1 A;  4N8T A;  1TU9 A;  1NGK A;  5CN5 A;  5AQD A;  2VJH B;  5CNF A;  2VLZ A;  3S65 B;  3KUN A;  5EU2 A;  4KN3 A;  1J41 B;  1URY A;  5CHQ A;  2VJT B;  5EQM A;  1WVP A;  1GH0 B;  3UHD A;  4Q70 A;  1GBV A;  1WMU A;  3GQR B;  1EW6 A;  1CQ2 A;  5B84 A;  3EDB A;  3LQD A;  2M6Z A;  4GY3 A;  1IBE B;  1PBX A;  3KVS B;  3HXN A;  1JF3 A;  1RTE A;  4U8U A;  3PMC A;  1HA7 A;  1JY7 B;  3IC0 B;  1O1O A;  4G51 B;  3WCV B;  3NML A;  4XS0 A;  1JEB A;  1LFY A;  3ORD A;  3TM3 A;  2AUP A;  1RPS A;  3KVS A;  4PQC A;  4YU3 B;  1WMU B;  3QM8 A;  1QGW C;  1FSX A;  1T1N B;  4KMV A;  1G08 B;  2D2M B;  2M6Z B;  1Y8I A;  2I88 A;  4AVD A;  3O7N A;  1RQ4 B;  1RSE A;  3QJE A;  4HRT B;  3QM7 A;  1LJW B;  1ALL A;  3OK5 A;  2UUN B;  1MLL A;  3PT8 A;  2H8D A;  1GZX B;  1UIW B;  3OO4 A;  3G4Q A;  1HBH B;  3LB4 A;  3ZJS A;  1A3O A;  1A6M A;  1RPS B;  5B13 G;  5ILP A;  2OH8 A;  1JWN A;  2HBC A;  3HF4 A;  2BW9 M;  4A8K A;  1CG5 A;  3B75 A;  3A2G A;  3AT6 B;  4L1E B;  3BCQ B;  2PGH B;  2NSS A;  1YIE B;  1BZ6 A;  2O5B X;  4JYQ A;  1COL A;  5EUI B;  5CHR A;  1HLB A;  1YVT B;  3PI9 A;  5HU6 A;  3VRE B;  1BAB A;  1V4W A;  3WFU A;  4LMX B;  2ZT0 A;  1XZ7 A;  1C40 B;  2EVP A;  2MYD A;  1DO3 A;  2G12 A;  2VRY A;  2VJR B;  1QXD B;  110M A;  1NEJ B;  2B7H A;  1SPE A;  1J3Z B;  1YEO B;  5EE4 C;  1KFR A;  1BZ1 A;  1Y45 A;  3PI1 A;  5D5R A;  2IG3 A;  3A59 A;  2VYY A;  4ZIZ B;  1Y0W B;  1VWT B;  1X9F C;  4HSW A;  2W6X A;  1DXU B;  1M6M A;  2AV3 A;  3WHM A;  3D7O B;  3NFE B;  1Y46 B;  3ZJM A;  4O4T A;  1CII A;  1VXG A;  1UVN A;  107M A;  3WCU C;  3GQG A;  1GDI A;  3QJB A;  2VLX A;  3OO5 A;  1LIA A;  3PIA B;  2QFK A;  1SDK A;  1Y01 B;  1BBB A;  1JZM A;  1GDL A;  4Z8K B;  1XF6 C;  2C7K A;  3FH9 B;  1FN3 B;  4ZVA A;  1Y0A A;  1WAC A;  1FLP A;  3DHR B;  2MGL A;  1GLI B;  6HBW A;  3BRP B;  4YJJ B;  3P5Q B;  1Y7D B;  1HV4 B;  3G4W A;  1C7D B;  3ONZ A;  1YE0 A;  1Y8W A;  1SWM A;  3M39 A;  3QQR A;  1MOH A;  1DKE A;  1YGF B;  2HBG A;  1SPG A;  1F99 A;  3AQ8 A;  4MBA A;  4ESA B;  1RVW A;  2QRW A;  2ZS0 D;  5FVB M;  3H57 A;  3ZOM A;  2MGG A;  1HAB A;  1QI8 A;  4UIQ A;  3NUH B;  4L7Y B;  2LHB A;  1NPG A;  1HDS A;  2V1G A;  3K8B B;  1A9W E;  1JEB B;  5HBI A;  3GYS A;  2ZSN A;  1MBN A;  1G0B A;  2HBD B;  1S56 A;  1Y4P B;  1Y4Q A;  4H07 A;  3E55 A;  3VNC A;  4SDH A;  2GTL C;  3QZZ A;  4TWU A;  1MBC A;  1O1L A;  5FVB A;  1YHR A;  1VXE A;  3PI8 B;  3VAU A;  2MGJ A;  2EKU A;  1UVJ A;  2G14 A;  1LJW A;  3ZOL A;  2D6C A;  3UH6 A;  1O1N B;  1MLR A;  1DXV B;  1UMO A;  1CG8 A;  4AVE A;  1HHT P;  1OJ6 A;  3LR7 A;  3OO4 B;  1HBA B;  5E6E B;  1XZ4 A;  1BZZ B;  1N9I A;  3HHB B;  1LFQ B;  3UHB A;  1J3Y B;  1MOB A;  1Y7G B;  1MYM A;  3D17 A;  2EB9 A;  3HEO A;  2H35 A;  3QZX A;  4NI1 B;  1X9F B;  2MGF A;  1GCW B;  3VRE A;  1MLG A;  3V2Z A;  3BJ2 B;  1MYJ A;  3ZJP A;  5CND A;  2QLS A;  4G1B A;  2UUM B;  4PNJ A;  3ECL A;  2GL3 A;  4NI0 A;  3QM5 A;  2AV0 A;  1G0A A;  4ROM B;  3EOK B;  2BNL A;  1YVQ B;  3UHN A;  1DUO A;  1VXF A;  3G46 A;  4NK1 A;  3SDN A;  4G1V A;  5MBN A;  3BJ3 A;  1GLI A;  2C7J A;  1RVW B;  2ZFB B;  5CNB A;  1EYX A;  3VHB A;  4MQK B;  1O1J A;  5EV5 A;  2ZFO A;  5HY8 A;  1UFP A;  1Y83 A;  2BLH A;  1AJ9 B;  1S5X A;  2HBS B;  4U8U C;  2HHD B;  1YE2 A;  1A6G A;  1Y4F A;  1KD2 B;  2G0V A;  2HBD A;  4FWY A;  3UHK A;  1Y22 B;  3D4X B;  3WFT A;  1BUW B;  1M9P A;  1F5O A;  1ABW A;  1IT3 A;  3IC0 A;  4U8U D;  1JW8 A;  2Z8A A;  4NXC A;  1XQ5 A;  4NXA A;  1ABY B;  2NX0 A;  5EYJ A;  2OH9 A;  1S69 A;  4DWT A;  1N9H A;  4F0T B;  1O1J B;  3RJN B;  3GDJ A;  3MJU B;  4WJG A;  1DXV A;  1CO9 A;  4M4A B;  4N6S A;  5KDQ B;  2OHA A;  4FWX A;  4FC3 A;  1ABS A;  1NZ4 A;  3KUO A;  4HRT A;  1MYG A;  1T1N A;  1BZ1 B;  1Y45 B;  2ZSX A;  2D60 A;  3VRF A;  1RQ3 B;  1MKO B;  5JDO E;  4NI1 A;  1RTX A;  1A3N A;  2QSS B;  2ZS1 B;  3WCV A;  1J7Y A;  4ODC A;  3BJ2 A;  3UBV A;  1YHE A;  1V75 A;  2V8A A;  5CNC A;  2J96 A;  3LB1 A;  5F2A A;  3MBA A;  3NMM A;  1N9X A;  4N7P B;  1NQP B;  3WCP A;  2ZLT A;  1S5Y B;  1LFV A;  2YRS B;  4H0M B;  1K0Y A;  1F0L A;  2H8F B;  1Y8H A;  2VJT A;  3R5I A;  4LM6 B;  3NG6 A;  1JZK A;  1LFL B;  1HDB A;  4YU4 B;  1LHS A;  3V58 A;  3M38 A;  3WCW B;  3ZJQ A;  1Y35 B;  1G9V A;  1UIW A;  1KTP B;  1QSI B;  4GXE A;  5JGG A;  3QQQ A;  2UUL D;  1O1M B;  1VXB A;  2RI4 A;  2H8F A;  3H58 A;  2BV8 B;  5CNG A;  1A87 A;  1NS6 A;  3OJ1 A;  2XKI A;  1LFV B;  3PMD A;  1JP6 A;  1CH7 A;  1KD2 A;  2QLS B;  3MJP B;  1XZ5 B;  1SDL A;  1BZ0 B;  3QM9 A;  1LFY B;  5B85 A;  1Y7C A;  4F6B A;  1VXA A;  1V4X B;  1W92 A;  1ECO A;  5E83 B;  3PT7 A;  1Y4G B;  3UHY A;  3MKB A;  1CQX A;  3VRG A;  1NPF A;  4HH0 A;  1EBT A;  1B0B A;  3LHB A;  1G09 B;  1XZU B;  1CPC B;  1C7B A;  1HDS B;  1LH3 A;  1AJG A;  4DWU A;  1GZX A;  1Y4R B;  1HBH A;  1J52 A;  1RQA B;  1UVL A;  4RMP B;  2ZSQ A;  5MBA A;  4Z8K A;  1MTJ A;  2D2M C;  3P5Q A;  5AB8 A;  1XXT B;  1Y85 B;  3G53 A;  1MCY A;  1HBR B;  1MOC A;  4DC8 A;  3G4Y A;  2IN4 A;  1DTM A;  4C0N A;  1JP9 A;  2G0Z A;  1BJE A;  3UHZ A;  1FHJ B;  1HI8 A;  3PIA A;  2VJR A;  1Y8K A;  3HHB A;  2HCO B;  1DXC A;  1MBO A;  5E6E A;  4L7Y A;  1Y0T A;  1JBO A;  3IC2 A;  1YCA A;  1Y4V A;  1Y85 A;  4IT8 A;  3A59 B;  1YMB A;  2Z6T A;  3UHE A;  1HI1 A;  2VML A;  3UGY A;  3UHW A;  1GCV A;  2DHB B;  3G4V A;  1HV4 A;  2MHB A;  3PEL B;  1LUE A;  2JLG A;  1MLH A;  1NAZ A;  1Y4V B;  3UBC A;  4A8F A;  3WCW D;  5C6E A;  1MWC A;  1MDN A;  1YVQ A;  2GDM A;  3QM6 A;  1JBO B;  1YEN A;  2MGK A;  4N7O A;  4ROL A;  1NZ5 A;  4OF9 A;  2EVK A;  2ZLW B;  3MOU A;  1BBB B;  4BS9 A;  2WY4 A;  1ITH A;  1CMY A;  3GYS B;  1C40 A;  1MLQ A;  1FAW A;  3HEN A;  103M A;  2PEG A;  1BZ0 A;  3LQD B;  3UHG A;  1GBV B;  3ODQ B;  1GH0 A;  2R4Z A;  2R4W A;  1LA6 A;  3BCQ A;  2D2N C;  5EE4 D;  1YE0 B;  2AUQ A;  3UI0 A;  1Y7D A;  111M A;  3DBJ B;  1Y8W B;  4IRO A;  3PI4 A;  1A9W A;  1Y4R A;  1K1K B;  1CP5 A;  5JDO C;  3RQR A;  1CH4 A;  1A4F B;  2GRZ A;  3UGZ A;  1SPG B;  1ON7 B;  2D5Z A;  1OUT B;  1R1X A;  5CN7 A;  1J3Z A;  1TES A;  4HH1 A;  2MGD A;  1DXT B;  2WCR A;  2EKT A;  5E29 A;  2LH5 A;  3ZJH A;  3OO5 B;  1A0Z A;  1B8D A;  1HLM A;  1PHN A;  3CIU A;  1YOG A;  4F0U B;  2G3H A;  2QU0 B;  1SDL B;  2LH3 A;  2GNW A;  1Y5F A;  3SZK B;  3GQR A;  2GKM A;  4XXI A;  5F0B A;  2SPL A;  4HRR A;  1VXD A;  2ZT3 A;  4ILZ A;  1R1X B;  1YFF A;  3AT6 A;  4L1E A;  2V1F A;  4NZI A;  4MXL A;  2O5T X;  1YZI B;  1O1P A;  3TLD A;  3ZJN A;  2AA1 A;  2HBF B;  1XZ2 B;  3WCT B;  2DHB A;  4NK2 A;  3S48 C;  2NRL A;  1NIH B;  1LTW A;  2MHB B;  1NEJ A;  1Y8I B;  2RAO A;  2ZLT B;  1DO1 A;  3WR1 B;  3UHR A;  1MZ0 A;  1XYE A;  1UVI A;  1MBI A;  3ED9 A;  3UHS A;  1J7S A;  2G10 A;  1JPB A;  1MNJ A;  2D5X B;  2VYZ A;  1GCW A;  1Y8K B;  3S1I A;  1HGA A;  1MGN A;  2H35 B;  5JDO F;  4XS0 B;  1LFT B;  2LH2 A;  2MGC A;  1C7C A;  3HF4 B;  4AE0 A;  1HCO A;  4ZVB A;  3GQP A;  1CG5 B;  3B75 B;  3WFX A;  2GTL D;  3GLN A;  1J7S B;  3FEW X;  3MVC A;  1A0U B;  5SW7 B;  2ZLX B;  2RAO B;  2ZFO D;  1A01 A;  3MWN A;  2W6W A;  3ARK A;  3IXF A;  3A5A A;  1OBM A;  2WTH A;  4C44 A;  2QSS A;  1CP0 A;  5CNE A;  1NS6 B;  4ETU A;  4MQH B;  2DKC A;  1B33 B;  4A8W A;  3O18 B;  1IRD A;  1SI4 B;  1YG5 B;  3DHR A;  3WTG B;  1CH3 A;  1YEV A;  1O1L B;  4F6I A;  1DUK A;  3GK9 A;  1XZV A;  3L0F A;  1DO4 A;  2C7K B;  2XKG A;  1S6A A;  2DKA A;  1K0Y B;  3ZH0 A;  2G11 A;  3WCU D;  2MGM A;  2QU0 A;  1Y4F B;  4OOD A;  1MDT A;  4B4Y A;  3UHV A;  2C0K A;  1MYH A;  1HBR A;  1MNK A;  1OR6 A;  1O1I A;  1CBM A;  2MGE A;  1X3K A;  1EMY A;  1L2K A;  2QSP B;  3D1A A;  3FS4 B;  3GKV A;  4ERV A;  1Y7G A;  2CMM A;  2OIF A;  2GKN A;  1H97 A;  1V4U B;  3V57 B;  1YCB A;  1RH1 A;  1QSH B;  3W4U B;  1MWB A;  1HSY A;  4ERT A;  2W72 B;  1UX9 A;  2H8D B;  3IA3 B;  2ZLU B;  3UHH A;  1J7W B;  1FDH G;  1MNI A;  1Y7Z A;  2HHB A;  2G0S A;  3G52 A;  3GUQ A;  1YOI A;  2ZS0 C;  2ZFO C;  4ETT A;  4LMS B;  4NI0 B;  4F68 A;  1S0H B;  2QSP A;  3GKV B;  4VHB A;  1RQA A;  2DN3 B;  4YU3 A;  5ILR A;  2R80 B;  1Y5F B;  3QJD A;  2WTG A;  1Y09 A;  4MQI B;  5KER B;  3PI2 A;  3A9M A;  1NS9 B;  4N7N A;  7HBI A;  3UHC A;  5EOH A;  1OR4 A;  5HU6 B;  3ZJL A;  1YMC A;  4BJU A;  1VXC A;  1Y4G A;  1KN1 B;  1BZZ A;  1HGB B;  1YIH A;  1R1Y B;  1Y09 B;  4MQI A;  6HBI A;  1DLY A;  1VWT A;  2NRM A;  3DHT B;  1IBE A;  1PBX B;  1UVK A;  2V1J A;  2R80 A;  1EBC A;  4F69 A;  1V5H A;  3G4R A;  4MBN A;  4F6J A;  112M A;  5AZQ A;  2RI4 B;  1Y46 A;  1IT2 A;  1D8U A;  2HHE B;  2BLI A;  1NIH A;  2JHO A;  1YHU C;  4RMP A;  4GXE B;  5JGG B;  2VJH A;  1YHR B;  3O89 A;  1IWH B;  2HZ3 A;  1HBS B;  1MLK A;  4QAU A;  3PEL A;  3EOK A;  1HBB A;  1HJT A;  4IRO B;  2WCQ A;  1GCV B;  1MNO A;  1HCO B;  3E5I A;  3PT7 B;  3WCP B;  1SDK B;  3GKT A;  1V4X A;  1FHJ A;  2B7H B;  5SW7 A;  1Y7C B;  1HA7 B;  2MGA A;  1X46 A;  1BZR A;  4N7P A;  1Y0D A;  1HI0 P;  3RJ6 A;  1DDT A;  1HBB B;  1AJ9 A;  2G0X A;  2O58 X;  2X49 A;  1A3O B;  1DXT A;  1A0Z B;  1EYX B;  4MQK A;  1JDO A;  4TWV A;  4O4Z A;  4PO5 A;  1SHR A;  3G4U A;  1HDA A;  3UHU A;  2PGH A;  3KMF A;  1HHS A;  1QPW A;  1KTP A;  1MLO A;  2SPN A;  2W6V A;  1BIJ B;  3AT5 A;  5ILM A;  1JL6 A;  2Z6N B;  1G0A B;  2Z85 A;  1MBA A;  1ASH A;  3DR9 A;  3PT8 B;  2UUL B;  1HDA B;  3ZTA A;  2HZ1 A;  3QJE B;  2AA1 B;  2W31 A;  1I7Y B;  1ECA A;  2V1K A;  2ZSY A;  4H2L A;  3R0G A;  3GDJ B;  2MYE A;  3HEP A;  105M A;  1DWR A;  3ASE A;  1FN3 A;  1Y4P A;  1AJH A;  3CY5 A;  3MKB B;  1KN1 A;  1AZI A;  2JLF A;  3GOU B;  1IRC A;  1I7Y A;  3EU1 B;  1OUU B;  2FRK X;  1F5P A;  4XXK A;  3VRF B;  3OGB A;  2D60 B;  1MBD A;  2HHD A;  1RQ3 A;  2D2N A;  1MNH A;  1Z8U B;  2V1I A;  2ZS0 B;  2W72 A;  1CG8 B;  1IOP A;  1GJN A;  5ILE A;  4MPM A;  1IWH A;  2VYW A;  1GDK A;  4WJG 1;  3K9Z A;  3A5B A;  1YEO A;  1I3D A;  3QJC A;  2ZT1 A;  1HHO B;  1N9F A;  1XZ2 A;  3M3B A;  1CLS A;  1A0U A;  2XYK A;  2DC3 A;  1Y0C A;  1NZ2 A;  1HDB B;  1MYI A;  1LHT A;  1LH2 A;  3NG6 B;  1Y5K B;  2GNV A;  2R4X A;  1Y31 A;  1M9P B;  5M3S A;  3SZK A;  1SGK A;  1YGD A;  2R4Y A;  2GLN A;  1MKO A;  3MJP A;  1V75 B;  3SDH A;  2D5X A;  1J40 A;  2R50 A;  3BJ1 B;  1A00 A;  1CH5 A;  4MAX A;  2QMB B;  3WFW A;  5B13 A;  2LH6 A;  3D17 B;  1NWN A;  3ZJI A;  3KMF C;  2HBC B;  4ETV A;  1CH1 A;  2ZFB A;  1IDR A;  5HLU A;  5HLX A;  2BMM A;  3PI8 A;  1UVX A;  3BRP A;  1Y2Z B;  2OLP A;  1C7B B;  4A8Q A;  1Y0A B;  1CIO A;  2FAM A;  1O1K A;  1V4U A;  1CPC A;  1ABW B;  2UUM A;  1JZL A;  1UVM A;  4KJT A;  4F4O B;  3ARJ A;  4MU5 A;  3HRW A;  4L2M A;  1MBS A;  1XDT T;  1MLJ A;  1DTI A;  3CY5 B;  2GRH A;  1XY0 B;  1JL7 A;  1CPW A;  1THB A;  1V4W B;  1VRF A;  4F6G A;  2GRF A;  3ZJJ A;  2W6Y A;  5IKS A;  1O16 A;  1QXE A;  1BVC A;  2MGH A;  3AQ9 A;  4F4O A;  2VEE A;  2FRF A;  3K8B A;  2X4A A;  5C6Y A;  2D5Z B;  4A8S A;  5AZR A;  2ZFO B;  2ZT4 A;  1UT0 A;  1BIJ A;  5CN8 A;  3S66 A;  3QJC B;  3WR1 A;  1YDZ A;  4DC7 A;  1G09 A;  1XZU A;  1Y5J A;  3W4U A;  4UZV A;  2ZLV B;  1CH2 A;  2ZWJ A;  4F6D A;  3PI3 A;  1FSL A;  3BJ3 B;  2OHB A;  2ZS1 D;  3DHT A;  2O5Q X;  3DUT B;  1XZ7 B;  3ZJR A;  2FAL A;  1BAB B;  1XQ5 B;  1JF4 A;  3FH9 A;  3EDA A;  2MB5 A;  1OUU A;  1OFK A;  3NL7 A;  2W72 C;  4HRR B;  3WCU B;  2ZLW A;  1J3Y A;  1LFQ A;  2ZSO A;  4N7O B;  3LB2 A;  4ROL B;  1PMB A;  5CN6 A;  1ECD A;  1S5X B;  4HHB A;  3ECZ A;  2HBS A;  1JY7 A;  1B8D B;  101M A;  1G9V B;  3V2V A;  1Y0W A;  1LH5 A;  3OZW A;  4ESA A;  1IRD B;  3WCW A;  1HHO A;  4O35 A;  3ECX A;  1UC3 A;  3A0G A;  1VRE A;  3D7O A;  3NFE A;  1DWS A;  1TOX A;  3S65 A;  3WCV D;  1YHU D;  3AQ6 A;  1HBG A;  2FRI X;  1LA6 B;  1FSX B;  4GZG A;  2C7J B;  1URV A;  1VHB A;  3MJU A;  2XKH A;  1LH1 A;  3NMM B;  1FDH A;  3TM9 A;  3WI8 A;  1YH9 B; 
#chains in the Genus database with same CATH homology
 106M A;  2MBW A;  1THB B;  3QMA A;  1DLW A;  1JP8 A;  4FWZ A;  1C7C B;  1XY0 A;  1MOA A;  1FCS A;  5E83 A;  1NQP A;  3D1A B;  3FS4 A;  4G51 A;  1YEQ A;  5JDO D;  3AQ7 A;  1BZP A;  3HXN B;  4U8U B;  1O1O B;  1XYE B;  1Y83 B;  1HAC A;  1YEU B;  3CIU B;  5HY8 B;  4MXK A;  2D2N D;  1YMA A;  1NXF A;  5HAV A;  1DKE B;  1YGF A;  1HGA B;  3WHM B;  1I3E A;  1YH9 A;  1MWD A;  1MOD A;  1UVY A;  4NS2 A;  1XZ4 B;  2HHB B;  1HBA A;  1YDZ B;  1YOH A;  1K1K A;  2D2M A;  2ZT2 A;  1COH A;  4KMW A;  4MQJ B;  1HRM A;  3EU1 A;  4YU4 A;  3MYM A;  1Y4Q B;  4M4A A;  1S5Y A;  1G0B B;  1O1I B;  1MYF A;  3AQ5 A;  3OZU A;  1MLS A;  1MLN A;  2BKM A;  2PEG B;  1QXE B;  1Y0T B;  1CH9 A;  3A5G A;  3OZV A;  1V9Q A;  2MYC A;  3WCV C;  1YIH B;  3RGK A;  2O5L X;  2ZSP A;  1Y0C B;  1HGB A;  4ODC B;  1J3F A;  3WCU A;  3UHQ A;  1A3N B;  1M6C A;  3HC9 A;  1F65 A;  1UFJ A;  4TYX A;  3S66 B;  2LH7 A;  1J41 A;  2AUO A;  2ZLU A;  4MQG A;  1NWI A;  1LH7 A;  2W6V B;  1VXH A;  1B86 A;  1HBS A;  1LFZ A;  2D2M D;  3A0G B;  2FRJ X;  2YRS A;  4JAC A;  3R5I B;  1MYT A;  5KDQ A;  4MQH A;  3VRG B;  1C7D A;  3ONZ B;  1A00 B;  1MLF A;  1Y4B B;  2QMB A;  2D2N B;  6HBW B;  3IC2 B;  2ZS0 A;  2Z6S A;  4N8T B;  1R1Y A;  3M3A A;  1DXD A;  2O5M X;  1Y0D B;  1ABY A;  1FAW B;  1BUW A;  2NSR A;  2SPM A;  2VM0 A;  3ODQ A;  1LFT A;  3GOU A;  2VEB A;  2ZSZ A;  3GQG B;  5CN4 A;  2MGB A;  1CIK A;  2MYA A;  5C6E B;  2ZST A;  3QJB B;  5KER A;  1Y4B A;  2DN2 A;  3HRW B;  3AT5 B;  5D1V A;  2MYB A;  3D1K B;  2ZSS A;  4FC3 B;  1U7R A;  3E5O A;  3UHT A;  2GTL A;  1YEN B;  1HGC B;  1Y8H B;  1OUT A;  4X0L A;  2MGI A;  3HYU B;  2LH1 A;  2QFN A;  1MTI A;  2AUR A;  2DN2 B;  3BJ1 A;  1A6K A;  1QSH A;  1Q1F A;  1NZ3 A;  4PQ6 A;  1YVT A;  1ECN A;  3PI9 B;  3ZHW A;  102M A;  1Y22 A;  3D4X A;  3D1K A;  1J7Y B;  1MLM A;  1G08 A;  4FH6 A;  1YEU A;  2ZLX A;  1CO8 A;  3QJD B;  1F63 A;  2VLY A;  3UH5 A;  1GBU A;  3U3E A;  4MQC B;  4F6F A;  4WCH D;  2DN3 A;  3S1J A;  2DXM B;  4LPI A;  1DXU A;  5JOM A;  1NS9 A;  1DWT A;  1MLU A;  1B86 B;  3E4N A;  1COH B;  4MQJ A;  2EB8 A;  2Z6N A;  5CMV A;  1LFZ B;  1YHU A;  1S61 A;  4MQG B;  1QSI A;  1X9F D;  3K3U A;  2G0R A;  1GVH A;  4UUR A;  4FH7 A;  1CBL A;  4ROM A;  1Y7Z B;  2HHE A;  2O5S X;  2BK9 A;  2DXM A;  4O2G A;  3MN0 A;  4XDI A;  1QXD A;  1XZ5 A;  1BIN A;  1YFF B;  4BJA A;  4M4B B;  5HLQ A;  3GQP B;  1CMY B;  1X9F A;  3DUT A;  1YGD B;  5E29 B;  2DN1 B;  2KSC A;  1YE2 B;  1O1M A;  4N7N B;  1OFJ A;  2V1H A;  2V1E A;  3WTG A;  1DO7 A;  1YG5 A;  2ZSR A;  1Y35 A;  1YEV B;  1SI4 A;  1Y2Z A;  4HSX A;  1WLA A;  1XXT A;  1HGC A;  3HYU A;  1O1N A;  3LB3 A;  1SHR B;  1V07 A;  1XZV B;  2VHB A;  2ZLV A;  104M A;  3WCT C;  3UHI A;  1EWA A;  1A4F A;  1HBI A;  2HBE A;  1XCH A;  1HAC B;  4H0B A;  1DM1 A;  1YZI A;  1A01 B;  3BOM A;  1QPW B;  3WCT D;  2R1H B;  4B3W A;  1YIE A;  1KR7 A;  2ZS1 C;  3BOM B;  3UH7 A;  1U7S A;  2R1H A;  2HBE B;  1YEQ B;  4H2L B;  1HAB B;  1QI8 B;  1MYZ A;  2ZS1 A;  1H1X A;  3UH3 A;  4X0L B;  1LH6 A;  1S0H A;  2E2Y A;  1Y5J B;  2GTL B;  3AG0 A;  3LR9 A;  1RQ4 A;  5EET A;  1O1K B;  1MTK A;  4HBI A;  1YHU B;  2O5O X;  1O1P B;  1J40 B;  2SPO A;  5EYS A;  108M A;  3MYN A;  4PQB A;  2EF2 A;  5CN9 A;  1LFL A;  3WCT A;  5KKK A;  2HBF A;  2HCO A;  1A6N A;  3BA2 A;  3UHX A;  1GBU B;  4M4B A;  4MQC A;  3NL7 B;  1UX8 A;  4HHB B;  5EUI A;  1GDJ A;  3WCW C;  1YHE B;  2DN1 A;  1CLS B;  1BVD A;  2BWH A;  1Y31 B;  4O1T A;  2BLJ M;  3ARL A;  109M A;  1Y5K A;  1J7W A;  3OVU C;  2HZ2 A;  3ZJO A;  4N8T A;  1TU9 A;  1NGK A;  5CN5 A;  5CNF A;  2VLZ A;  3S65 B;  3KUN A;  5EU2 A;  4KN3 A;  1J41 B;  1URY A;  5CHQ A;  5EQM A;  1WVP A;  3UHD A;  1GBV A;  1WMU A;  3GQR B;  1EW6 A;  1CQ2 A;  5B84 A;  3EDB A;  3LQD A;  2M6Z A;  1IBE B;  1PBX A;  4U8U A;  3HXN A;  1JF3 A;  1RTE A;  1JY7 B;  3IC0 B;  1O1O A;  4G51 B;  3WCV B;  3NML A;  4XS0 A;  1JEB A;  1LFY A;  3ORD A;  3TM3 A;  2AUP A;  1RPS A;  4PQC A;  4YU3 B;  1WMU B;  3QM8 A;  1FSX A;  1T1N B;  4KMV A;  1G08 B;  2D2M B;  2M6Z B;  1Y8I A;  4AVD A;  3O7N A;  1RQ4 B;  1RSE A;  3QJE A;  4HRT B;  3QM7 A;  1LJW B;  3OK5 A;  1MLL A;  3PT8 A;  2H8D A;  1GZX B;  1UIW B;  3OO4 A;  3G4Q A;  1HBH B;  3LB4 A;  3ZJS A;  1A3O A;  1A6M A;  1RPS B;  5ILP A;  2OH8 A;  1JWN A;  2HBC A;  3HF4 A;  2BW9 M;  1CG5 A;  3B75 A;  3A2G A;  3AT6 B;  3BCQ B;  2PGH B;  2NSS A;  1YIE B;  1BZ6 A;  2O5B X;  4JYQ A;  5EUI B;  5CHR A;  1HLB A;  1YVT B;  3PI9 A;  5HU6 A;  3VRE B;  1BAB A;  1V4W A;  3WFU A;  2ZT0 A;  1XZ7 A;  1C40 B;  2EVP A;  2MYD A;  1DO3 A;  2G12 A;  2VRY A;  1QXD B;  110M A;  1NEJ B;  2B7H A;  1SPE A;  1J3Z B;  1YEO B;  5EE4 C;  1KFR A;  1BZ1 A;  1Y45 A;  3PI1 A;  5D5R A;  2IG3 A;  3A59 A;  2VYY A;  1Y0W B;  1VWT B;  1X9F C;  4HSW A;  2W6X A;  1DXU B;  1M6M A;  2AV3 A;  3WHM A;  3D7O B;  3NFE B;  1Y46 B;  3ZJM A;  4O4T A;  1VXG A;  107M A;  3WCU C;  3GQG A;  1GDI A;  3QJB A;  2VLX A;  3OO5 A;  3PIA B;  2QFK A;  1SDK A;  1Y01 B;  1BBB A;  1JZM A;  1GDL A;  3FH9 B;  1FN3 B;  4ZVA A;  1Y0A A;  1FLP A;  3DHR B;  2MGL A;  1GLI B;  6HBW A;  3P5Q B;  1Y7D B;  1HV4 B;  3G4W A;  1C7D B;  3ONZ A;  1YE0 A;  1Y8W A;  1SWM A;  3M39 A;  3QQR A;  1MOH A;  1DKE A;  1YGF B;  2HBG A;  1SPG A;  3AQ8 A;  4MBA A;  4ESA B;  1RVW A;  2QRW A;  2ZS0 D;  3H57 A;  3ZOM A;  2MGG A;  1HAB A;  1QI8 A;  4UIQ A;  4L7Y B;  2LHB A;  1NPG A;  1HDS A;  2V1G A;  3K8B B;  1A9W E;  1JEB B;  5HBI A;  3GYS A;  2ZSN A;  1MBN A;  1G0B A;  2HBD B;  1S56 A;  1Y4P B;  1Y4Q A;  4H07 A;  3E55 A;  4SDH A;  2GTL C;  3QZZ A;  4TWU A;  1MBC A;  1O1L A;  1YHR A;  1VXE A;  3PI8 B;  3VAU A;  2MGJ A;  2EKU A;  2G14 A;  1LJW A;  3ZOL A;  2D6C A;  3UH6 A;  1O1N B;  1MLR A;  1DXV B;  1UMO A;  1CG8 A;  4AVE A;  1OJ6 A;  3LR7 A;  3OO4 B;  1HBA B;  5E6E B;  1XZ4 A;  1BZZ B;  1N9I A;  3HHB B;  1LFQ B;  3UHB A;  1J3Y B;  1MOB A;  1Y7G B;  1MYM A;  3D17 A;  2EB9 A;  3HEO A;  2H35 A;  3QZX A;  4NI1 B;  1X9F B;  2MGF A;  1GCW B;  3VRE A;  1MLG A;  3V2Z A;  3BJ2 B;  1MYJ A;  3ZJP A;  5CND A;  2QLS A;  4G1B A;  4PNJ A;  3ECL A;  2GL3 A;  4NI0 A;  3QM5 A;  2AV0 A;  1G0A A;  4ROM B;  3EOK B;  2BNL A;  1YVQ B;  3UHN A;  1DUO A;  1VXF A;  3G46 A;  4NK1 A;  3SDN A;  4G1V A;  5MBN A;  3BJ3 A;  1GLI A;  1RVW B;  2ZFB B;  5CNB A;  3VHB A;  4MQK B;  1O1J A;  5EV5 A;  2ZFO A;  5HY8 A;  1UFP A;  1Y83 A;  2BLH A;  1AJ9 B;  1S5X A;  2HBS B;  4U8U C;  2HHD B;  1YE2 A;  1A6G A;  1Y4F A;  1KD2 B;  2G0V A;  2HBD A;  4FWY A;  3UHK A;  1Y22 B;  3D4X B;  3WFT A;  1BUW B;  1M9P A;  1F5O A;  1ABW A;  1IT3 A;  4U8U D;  3IC0 A;  1JW8 A;  2Z8A A;  4NXC A;  1XQ5 A;  4NXA A;  1ABY B;  2NX0 A;  5EYJ A;  2OH9 A;  1S69 A;  4DWT A;  1N9H A;  1O1J B;  3RJN B;  3GDJ A;  3MJU B;  4WJG A;  1DXV A;  1CO9 A;  4M4A B;  5KDQ B;  2OHA A;  4FWX A;  4FC3 A;  1ABS A;  1NZ4 A;  3KUO A;  4HRT A;  1MYG A;  1T1N A;  1BZ1 B;  1Y45 B;  2ZSX A;  2D60 A;  3VRF A;  1RQ3 B;  5JDO E;  1MKO B;  4NI1 A;  1RTX A;  1A3N A;  2QSS B;  2ZS1 B;  3WCV A;  1J7Y A;  4ODC A;  3BJ2 A;  3UBV A;  1YHE A;  1V75 A;  5CNC A;  3LB1 A;  5F2A A;  3MBA A;  3NMM A;  1N9X A;  4N7P B;  1NQP B;  3WCP A;  2ZLT A;  1S5Y B;  1LFV A;  2YRS B;  1K0Y A;  2H8F B;  1Y8H A;  3R5I A;  3NG6 A;  1JZK A;  1LFL B;  1HDB A;  4YU4 B;  1LHS A;  3M38 A;  3WCW B;  3ZJQ A;  1Y35 B;  1G9V A;  1UIW A;  1QSI B;  5JGG A;  3QQQ A;  1O1M B;  1VXB A;  2RI4 A;  2H8F A;  3H58 A;  5CNG A;  1NS6 A;  3OJ1 A;  2XKI A;  1LFV B;  1JP6 A;  1CH7 A;  1KD2 A;  2QLS B;  3MJP B;  1XZ5 B;  1SDL A;  1BZ0 B;  3QM9 A;  1LFY B;  5B85 A;  1Y7C A;  4F6B A;  1VXA A;  1V4X B;  1W92 A;  1ECO A;  5E83 B;  3PT7 A;  1Y4G B;  3UHY A;  3MKB A;  1CQX A;  3VRG A;  1NPF A;  1EBT A;  1B0B A;  3LHB A;  1G09 B;  1XZU B;  1C7B A;  1HDS B;  1LH3 A;  1AJG A;  4DWU A;  1GZX A;  1Y4R B;  1HBH A;  1J52 A;  1RQA B;  2ZSQ A;  5MBA A;  1MTJ A;  2D2M C;  3P5Q A;  5AB8 A;  1XXT B;  1Y85 B;  3G53 A;  1MCY A;  1HBR B;  1MOC A;  4DC8 A;  3G4Y A;  2IN4 A;  1DTM A;  4C0N A;  1JP9 A;  2G0Z A;  1BJE A;  3UHZ A;  1FHJ B;  3PIA A;  1Y8K A;  3HHB A;  2HCO B;  1DXC A;  1MBO A;  5E6E A;  4L7Y A;  1Y0T A;  3IC2 A;  1YCA A;  1Y4V A;  1Y85 A;  4IT8 A;  3A59 B;  1YMB A;  2Z6T A;  3UHE A;  3UGY A;  3UHW A;  1GCV A;  2DHB B;  3G4V A;  1HV4 A;  2MHB A;  3PEL B;  1LUE A;  1MLH A;  1NAZ A;  1Y4V B;  3UBC A;  3WCW D;  5C6E A;  1MWC A;  1MDN A;  1YVQ A;  2GDM A;  3QM6 A;  2MGK A;  1YEN A;  4N7O A;  4ROL A;  1NZ5 A;  4OF9 A;  2EVK A;  2ZLW B;  3MOU A;  1BBB B;  2WY4 A;  1ITH A;  1CMY A;  3GYS B;  1C40 A;  1MLQ A;  1FAW A;  3HEN A;  103M A;  2PEG A;  1BZ0 A;  3LQD B;  3UHG A;  1GBV B;  3ODQ B;  2R4Z A;  2R4W A;  1LA6 A;  3BCQ A;  2D2N C;  5EE4 D;  1YE0 B;  2AUQ A;  3UI0 A;  1Y7D A;  111M A;  1Y8W B;  4IRO A;  3PI4 A;  1A9W A;  1Y4R A;  1K1K B;  1CP5 A;  5JDO C;  1CH4 A;  1A4F B;  2GRZ A;  3UGZ A;  1SPG B;  2D5Z A;  1OUT B;  1R1X A;  5CN7 A;  1J3Z A;  1TES A;  2MGD A;  1DXT B;  2EKT A;  5E29 A;  2LH5 A;  3ZJH A;  3OO5 B;  1A0Z A;  1HLM A;  3CIU A;  1YOG A;  2G3H A;  2QU0 B;  1SDL B;  2LH3 A;  2GNW A;  1Y5F A;  3SZK B;  3GQR A;  2GKM A;  5F0B A;  2SPL A;  4HRR A;  1VXD A;  2ZT3 A;  4ILZ A;  1R1X B;  1YFF A;  3AT6 A;  2V1F A;  4NZI A;  4MXL A;  2O5T X;  1YZI B;  1O1P A;  3TLD A;  3ZJN A;  2AA1 A;  2HBF B;  1XZ2 B;  3WCT B;  2DHB A;  4NK2 A;  3S48 C;  2NRL A;  1NIH B;  1LTW A;  2MHB B;  1NEJ A;  1Y8I B;  2RAO A;  2ZLT B;  1DO1 A;  3WR1 B;  3UHR A;  1MZ0 A;  1XYE A;  1MBI A;  3ED9 A;  3UHS A;  1J7S A;  2G10 A;  1JPB A;  1MNJ A;  2D5X B;  2VYZ A;  1GCW A;  1Y8K B;  3S1I A;  1HGA A;  1MGN A;  2H35 B;  5JDO F;  4XS0 B;  1LFT B;  2LH2 A;  2MGC A;  1C7C A;  3HF4 B;  1HCO A;  4ZVB A;  3GQP A;  1CG5 B;  3B75 B;  3WFX A;  2GTL D;  3GLN A;  1J7S B;  3MVC A;  1A0U B;  5SW7 B;  2ZLX B;  2RAO B;  2ZFO D;  1A01 A;  2W6W A;  3ARK A;  3IXF A;  3A5A A;  1OBM A;  2WTH A;  4C44 A;  2QSS A;  1CP0 A;  5CNE A;  1NS6 B;  4MQH B;  1IRD A;  1SI4 B;  1YG5 B;  3DHR A;  3WTG B;  1CH3 A;  1YEV A;  1O1L B;  4F6I A;  1DUK A;  3GK9 A;  1XZV A;  1DO4 A;  2XKG A;  1S6A A;  1K0Y B;  3ZH0 A;  2G11 A;  3WCU D;  2MGM A;  2QU0 A;  1Y4F B;  4OOD A;  4B4Y A;  3UHV A;  2C0K A;  1MYH A;  1HBR A;  1MNK A;  1OR6 A;  1O1I A;  1CBM A;  2MGE A;  1X3K A;  1EMY A;  1L2K A;  2QSP B;  3D1A A;  3FS4 B;  3GKV A;  1Y7G A;  2CMM A;  2OIF A;  2GKN A;  1H97 A;  1V4U B;  1YCB A;  1QSH B;  3W4U B;  1MWB A;  1HSY A;  2W72 B;  1UX9 A;  2H8D B;  3IA3 B;  2ZLU B;  3UHH A;  1J7W B;  1FDH G;  1MNI A;  1Y7Z A;  2HHB A;  2G0S A;  3G52 A;  1YOI A;  2ZS0 C;  2ZFO C;  4NI0 B;  4F68 A;  1S0H B;  2QSP A;  3GKV B;  4VHB A;  1RQA A;  2DN3 B;  4YU3 A;  5ILR A;  2R80 B;  1Y5F B;  3QJD A;  2WTG A;  1Y09 A;  4MQI B;  5KER B;  3PI2 A;  3A9M A;  1NS9 B;  4N7N A;  7HBI A;  3UHC A;  5EOH A;  1OR4 A;  5HU6 B;  3ZJL A;  1YMC A;  1VXC A;  1Y4G A;  1BZZ A;  1HGB B;  1YIH A;  1R1Y B;  1Y09 B;  4MQI A;  6HBI A;  1DLY A;  1VWT A;  2NRM A;  3DHT B;  1IBE A;  1PBX B;  2V1J A;  2R80 A;  1EBC A;  4F69 A;  1V5H A;  3G4R A;  4MBN A;  4F6J A;  112M A;  5AZQ A;  2RI4 B;  1Y46 A;  1IT2 A;  1D8U A;  2HHE B;  2BLI A;  1NIH A;  2JHO A;  1YHU C;  5JGG B;  1YHR B;  3O89 A;  1IWH B;  2HZ3 A;  1HBS B;  1MLK A;  4QAU A;  3PEL A;  3EOK A;  1HBB A;  1HJT A;  4IRO B;  1GCV B;  1MNO A;  1HCO B;  3E5I A;  3PT7 B;  3WCP B;  1SDK B;  3GKT A;  1V4X A;  1FHJ A;  2B7H B;  5SW7 A;  1Y7C B;  2MGA A;  1X46 A;  1BZR A;  4N7P A;  1Y0D A;  3RJ6 A;  1HBB B;  1AJ9 A;  2G0X A;  2O58 X;  1A3O B;  1DXT A;  1A0Z B;  4MQK A;  1JDO A;  4TWV A;  4O4Z A;  1SHR A;  3G4U A;  1HDA A;  3UHU A;  2PGH A;  3KMF A;  1QPW A;  1MLO A;  2SPN A;  2W6V A;  1BIJ B;  3AT5 A;  5ILM A;  1JL6 A;  2Z6N B;  1G0A B;  2Z85 A;  1MBA A;  1ASH A;  3DR9 A;  3PT8 B;  1HDA B;  2HZ1 A;  3QJE B;  2AA1 B;  2W31 A;  1ECA A;  2V1K A;  2ZSY A;  4H2L A;  3R0G A;  3GDJ B;  2MYE A;  3HEP A;  105M A;  1DWR A;  3ASE A;  1FN3 A;  1Y4P A;  1AJH A;  3CY5 A;  3MKB B;  1AZI A;  3GOU B;  1IRC A;  3EU1 B;  1OUU B;  2FRK X;  1F5P A;  3VRF B;  3OGB A;  2D60 B;  1MBD A;  2HHD A;  1RQ3 A;  2D2N A;  1MNH A;  1Z8U B;  2V1I A;  2ZS0 B;  2W72 A;  1CG8 B;  1IOP A;  1GJN A;  5ILE A;  4MPM A;  1IWH A;  2VYW A;  1GDK A;  4WJG 1;  3K9Z A;  3A5B A;  1YEO A;  1I3D A;  3QJC A;  2ZT1 A;  1HHO B;  1N9F A;  1XZ2 A;  3M3B A;  1CLS A;  1A0U A;  2XYK A;  2DC3 A;  1Y0C A;  1NZ2 A;  1HDB B;  1MYI A;  1LHT A;  1LH2 A;  3NG6 B;  1Y5K B;  2GNV A;  2R4X A;  1Y31 A;  1M9P B;  5M3S A;  3SZK A;  1YGD A;  2R4Y A;  2GLN A;  1MKO A;  3MJP A;  1V75 B;  3SDH A;  2D5X A;  1J40 A;  2R50 A;  3BJ1 B;  1A00 A;  1CH5 A;  4MAX A;  2QMB B;  3WFW A;  2LH6 A;  3D17 B;  1NWN A;  3ZJI A;  3KMF C;  2HBC B;  1CH1 A;  2ZFB A;  1IDR A;  5HLU A;  5HLX A;  2BMM A;  3PI8 A;  1UVX A;  1Y2Z B;  2OLP A;  1C7B B;  1Y0A B;  1CIO A;  2FAM A;  1O1K A;  1V4U A;  1ABW B;  1JZL A;  4KJT A;  4F4O B;  3ARJ A;  4MU5 A;  3HRW A;  4L2M A;  1MBS A;  1MLJ A;  1DTI A;  3CY5 B;  2GRH A;  1XY0 B;  1JL7 A;  1CPW A;  1THB A;  1V4W B;  1VRF A;  4F6G A;  2GRF A;  3ZJJ A;  2W6Y A;  5IKS A;  1O16 A;  1QXE A;  1BVC A;  2MGH A;  3AQ9 A;  4F4O A;  2VEE A;  2FRF A;  3K8B A;  5C6Y A;  2D5Z B;  5AZR A;  2ZFO B;  2ZT4 A;  1UT0 A;  1BIJ A;  5CN8 A;  3S66 A;  3QJC B;  3WR1 A;  1YDZ A;  4DC7 A;  1G09 A;  1XZU A;  1Y5J A;  3W4U A;  4UZV A;  2ZLV B;  1CH2 A;  2ZWJ A;  4F6D A;  3PI3 A;  1FSL A;  3BJ3 B;  2OHB A;  2ZS1 D;  3DHT A;  2O5Q X;  3DUT B;  1XZ7 B;  3ZJR A;  2FAL A;  1BAB B;  1XQ5 B;  1JF4 A;  3FH9 A;  3EDA A;  2MB5 A;  1OUU A;  1OFK A;  3NL7 A;  2W72 C;  4HRR B;  3WCU B;  2ZLW A;  1J3Y A;  1LFQ A;  2ZSO A;  4N7O B;  3LB2 A;  4ROL B;  1PMB A;  5CN6 A;  1ECD A;  1S5X B;  4HHB A;  3ECZ A;  2HBS A;  1JY7 A;  101M A;  1G9V B;  3V2V A;  1Y0W A;  1LH5 A;  3OZW A;  4ESA A;  1IRD B;  3WCW A;  1HHO A;  4O35 A;  3ECX A;  1UC3 A;  3A0G A;  1VRE A;  3D7O A;  3NFE A;  1DWS A;  3S65 A;  3WCV D;  1YHU D;  3AQ6 A;  1HBG A;  2FRI X;  1LA6 B;  1FSX B;  4GZG A;  1URV A;  1VHB A;  3MJU A;  2XKH A;  1LH1 A;  3NMM B;  1FDH A;  3TM9 A;  3WI8 A;  1YH9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...