1VYHC

Paf-ah holoenzyme: lis1/alfa2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
310
Chain Sequence
KEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSEGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB BETA SUBUNIT
publication title Coupling Paf Signaling to Dynein Regulation: Structure of Lis1 in Complex with Paf-Acetylhydrolase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 310
sequence length 317
chains with identical sequence D, G, H, K, L, O, P, S, T
ec nomenclature
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
C PF08513 LisH LisH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1vyhC01
4CZVA 3IKOA 4PNKB 4JT5C 4ZN4A 1OMWB 4X63B 4R7AB 3DXMC 5C9ZB 4J78A 2OJYA 3U4YA 3PXTD 2H6QA 3OW8A 5EALA 2YNOA 2H14A 4PBZA 4JSXC 3EU7A 3IJCA 3MKSB 3DM0A 5EARA 4D6VA 3I7PA 1U2VC 3IJ0A 3P4FA 4A0BB 2HJBA 1VYHC 3I7NA 3F3PA 3C99A 2G9AA 4BUJC 2H9PA 5TF2A 3IJ1A 3MKQA 4A11B 1PBYB 3SBRA 3RN0D 4FAVD 2IWFA 1GG2B 3I7KA 3OKTA 3I7OA 4O45A 3SHFA 2P9PC 4GGDA 4A0BA 5EAPA 2CE8A 3SBQA 1XKSA 3OKWA 4CY5A 4JSNC 4BL0A 4J0XA 2GNQA 2OIZA 2IURA 1GXRA 1ERJA 5I5JA 4A11A 2Z2NA 3PXSD 3SXTD 1MG3A 5IJ8E 2CE9A 4JSPC 3MZLA 3F3FA 5IJ7E 2MTAH 3EI2B 3NVNA 1R5MA 5EMJB 3RRMC 2PM7B 4A2MA 5GXIA 4KFMB 4E54B 4GQ2P 5HQGA 3HFQA 2XYIA 4IMMA 3AL9A 4X3EA 5CXCB 4ESGA 4J82A 4XEIC 1JMZB 2GC7A 4FAND 4K3ID 2I3SA 3UVNA 3F3GA 3JZHA 4J8GA 1NEXB 5EMLB 2QC5A 3EWEA 4CY2A 2YMUA 4E54A 1NR0A 3V7DB 4Y7RA 3B7FA 4GGAA 3OKYA 3AL8B 4GZ8A 3MXXA 2IWKA 3DXKC 4ZOYA 5CXCA 4XYHA 1K8KC 4CY3A 1Q47A 5HE1B 2XL3A 5JWZA 2OVPB 5IGQA 4L1QD 4G56B 4J84A 3I7HA 5FA5B 4GM9A 2P9LC 2CO0A 2O9KA 4PXWA 2B5LA 3UKUC 3SFZA 3AFCA 1GP2B 2HKMA 2IUQA 4L3HD 2P9KC 3FRXA 3W15A 5B4WA 1B9YA 3KRXB 5EMKB 2YNPA 4J87A 4ERQA 2UZYB 5IC7A 3ZWLB 4ERYA 5GXHA 2J56H 1U4CA 3GFCA 4ERZA 3FM0A 5FKTA 3SBPA 4FA9D 3PSLA 1N6DA 2B5NA 4PBYA 3JRPA 4L3GD 2AGWA 3VA6A 3EI3B 2YBAA 2AGZA 3SLED 2CN3A 4O3UB 3SWSD 3RN1D 3RFHA 2IUPA 3MMYA 2P9UC 5FKSA 3FGBA 3EMHA 2H6NA 2GC4A 2AQ5A 3A0FA 5TDHB 2CN2A 1MDAH 4CI3A 5A2Qg 4L9OA 4FHLA 4AOWA 2Z2OA 3EI1B 3C9CA 4TZ4A 3NVQA 4H5JA 5C2WB 5CXBB 3DWLC 1A0RB 2OK4A 1XIPA 5SXMA 4LGNA 1S4UX 3BWSA 4ZOVA 4J0WA 5AFU3 2H9NA 2OVRB 2H3XA 2P9NC 5H14A 2H6KA 3RSEC 3GREA 5GSAA 4O9DA 1N6EA 5H1MA 3E0CA 3K26A 4QRJA 4ES0A 4GGCA 4D0KA 5EM2B 2P9SC 3I7LA 4FA1D 4U7AA 3I89A 3EI1A 2IUVA 2HKRA 5CXBA 2CNXA 4CI1A 2AH1A 2QXVA 2I0RA 4GM3A 2XU7A 5CYKB 3SCYA 3RFGA 3IIYA 2I0SA 4HDJA 4QT8A 3EI2A 3VGZA 3ODTA 5I5MA 3JZGA 4LG9A 4IA9A 3BG1A 4YVDA 5EM2A 2W18A 4J79A 4PSWB 3AH8B 4JXMA 3JAMg 2J55H 5I5IA 3UVKA 4JSVC 4PC0A 5CYKA 1RI6A 4A0AB 1B9XA 2UZXB 3EG6A 1P22A 2G99A 1PI6A 4JD2C 2IAAA 2P9IC 2AGLA 3AL8A 2Z2PA 4QQEA 5FKQA 2H13A 5FQDA 3PVUB 4A0AA 2B5MA 3UVMA 2B4EA 2H47A 2HESX 4CC9A 5THAA 5C2VB 3PVWB 3ULEC 4N14A 4K3JB 3SVWD 1K32A 4X61B 5GMKn 2XL2A 5K1CC 4J73A 1QNIA 4Y5RD 3OTTA 4FB1D 1JMXB 2H9MA 3EI4B 1PEVA 3PXWD 2I3TA 5HE3B 5IGOA 5H17A 3SMRA 3CIKB 3I2NA 5HE2B 5AMSA 3N0EA 3RLMD 1OLZA 4E5ZB 5FXYA 1GOTB 2OK6A 4Z8LA 4FA5D 3J81g 3JB9L 3I8EA 4A2LA 4CY1A 3K27A 3SN6B 3V5WB 4FA4D 1TBGA 2TRCB 3EI4A 3NVXA 1JJUB 3EI3A 2PBIB 3IIWA 3L4MD 3OL2B 2HYEA 5AJAA 4J77A 3BG0A 4ZOXA 4OZUA 2BCJB 5FLXg 3SJLD 3UVLA 4H5IA 3DSMA 4E5ZA 4QL1A 3N0DA 5TEEA 1L0QA 2HXCA 2YNNA 3UVOA 3KRWB 4FWWA 4ZOZA 3RMZD 5TEFA 4GQBB 3CFSB 3UKRC 4U1EI 2PM9B 4CZYA 4CI2A 1JOFA 4J86A 1MG2A 2CO0C 2J57G 4LG8A 3OL2A 5K19A 2AGYA 4A08B 1XHMA 1SQJA 2I0TA 1TYQC 2OVQB 4JT6C 2H9LA 5HE0B 5KDOB 4XYIA 4CI8A 4J81A 3ORVD 5EAMA 1YFQA 5HYNB 3OKYB 4AEZA 3MZKA 2PM9A 4A09B 3JZNA 3C75H 3I8CA 3PE7A 4I79A 4A08A 4GMBA 4GM8A 2PM6B 4O3TB 4X60B 4A7JA 3CFVA 5IT9g 3V9FA 3UR4A 5FKRA 4PSXB 4NSXA 4UI9R 2Q7QA 4EWRA 2EBSA 4MK0B 2YB8B 2AH0A 4CZXA 2BBKH 4BH6A 1SQ9A 3JPXA 3VH0A 3JROA 4O1QD 4A09A 1FWXA 1N6FA 3L4OD 3PSCB 1PGUA 3C5MA 2HJ4A 3J80g 5EMMB 2AGXA 4J8BA 2H68A 4GQ1A 1SHYB 4OWRA
chains in the Genus database with same CATH superfamily
4CZVA 3IKOA 4PNKB 4JT5C 4QAMA 4ZN4A 1OMWB 4X63B 2VZ1A 3DXMC 4R7AB 5C9ZB 4J78A 1TYEA 2OJYA 3U4YA 3PXTD 2VDRA 2H6QA 5M5TA 3OW8A 5EALA 4AX4A 2YNOA 4JHNA 2H14A 4WK0A 4PBZA 4JSXC 3EU7A 2QZPA 3IJCA 3MKSB 3DM0A 1UOQA 5EARA 4G55A 4D6VA 3I7PA 4AMZA 1H2ZA 1U2VC 3IJ0A 3P4FA 4A0BB 2VDQA 2HJBA 2VDNA 2XZGA 4G1MA 4DNVA 1VYHC 3I7NA 2BKLA 3O4IA 5M5VA 3F3PA 5FFGA 1VE6A 3ZDYA 3C99A 2G9AA 4BUJC 2H9PA 5TF2A 1BPOA 3IJ1A 1YR2A 3MKQA 4MMYA 4A11B 1PBYB 3SBRA 3RN0D 4FAVD 2IWFA 1GG2B 3I7KA 3OKTA 1U8CA 4DNWA 3I7OA 4NAAA 4O45A 3SHFA 1E8MA 2P9PC 4GGDA 4A0BA 5EAPA 2CE8A 3SBQA 1XKSA 3OKWA 4CY5A 4O2WA 4JSNC 5C86A 4BL0A 4J0XA 2GNQA 1UOOA 2OIZA 2IURA 5M5RA 1K3IA 1GXRA 1ERJA 5I5JA 4A11A 2Z2NA 3PXSD 3SXTD 1MG3A 5IJ8E 2CE9A 4MMXA 4JSPC 3MZLA 3F3FA 5IJ7E 2MTAH 3EI2B 3NVNA 1R5MA 5EMJB 3RRMC 1VZ2A 2PM7B 4A2MA 5GXIA 4KFMB 4Z7NA 4E54B 4GQ2P 5HQGA 4BCDA 3HFQA 2XYIA 4IMMA 3AL9A 5M5SA 4X3EA 5CXCB 4ESGA 4J82A 3ZE1A 4XEIC 1JMZB 2GC7A 3IUMA 4FAND 4K3ID 2I3SA 3UVNA 3F3GA 3JZHA 3VI3A 4J8GA 2WQ8A 1NEXB 3T3PA 5EMLB 2QC5A 3EWEA 1O6FA 4CY2A 2YMUA 2JKXA 4E54A 1NR0A 3V7DB 4Y7RA 3B7FA 1UTCA 4GGAA 3OKYA 2EIBA 3AL8B 3MXXA 4GZ8A 1H2WA 2IWKA 3DXKC 4NC4A 4ZOYA 5CXCA 3V4VA 2EIDA 1K8KC 4XYHA 4CY3A 1Q47A 3GC3B 5HE1B 2XL3A 5JWZA 2OVPB 5IGQA 3IULA 3GD1I 4G56B 4L1QD 4J84A 3I7HA 4UM8A 5FA5B 4GM9A 4UM9A 4L1MA 2VZ3A 2P9LC 2CO0A 3DDUA 2O9KA 1A12A 1M1XA 4IRZA 4PXWA 2B5LA 3MUNA 3UKUC 3O4JA 3SFZA 3AFCA 1GP2B 3QI0A 2HKMA 3IVMA 2IUQA 4L3HD 2P9KC 3FRXA 3W15A 5B4WA 1B9YA 3KRXB 5EMKB 2YNPA 3IJEA 4J87A 4ERQA 2UZYB 4Z7QA 2HU5A 5IC7A 3ZWLB 2VDMA 4ERYA 1C9LA 5GXHA 2J56H 1U4CA 3GFCA 3IUJA 4ERZA 3FM0A 5FKTA 1JTDB 3SBPA 4FA9D 3PSLA 1N6DA 2B5NA 4PBYA 4BP8A 2EIEA 3JRPA 4L3GD 2HU7A 5E6UA 2AGWA 3VA6A 3EI3B 2YBAA 2AGZA 3SLED 2CN3A 4O3UB 3SWSD 3RN1D 3RFHA 2IUPA 3MMYA 4MMZA 2P9UC 5FKSA 1GOFA 3FGBA 3EMHA 2H6NA 2GC4A 2AQ5A 3A0FA 5TDHB 2CN2A 1MDAH 4WK4A 4CI3A 5A2Qg 4L9OA 4FHLA 4AOWA 2Z2OA 3EI1B 3C9CA 4TZ4A 3NVQA 1H2XA 4H5JA 5C2WB 5CXBB 3DWLC 3ZDZA 1A0RB 2OK4A 1XIPA 5SXMA 3V4PA 4LGNA 1S4UX 3BWSA 4ZOVA 4J0WA 5AFU3 3K6SA 2H9NA 2OVRB 2H3XA 2P9NC 5H14A 2H6KA 3RSEC 3GREA 3O4HA 5GSAA 4O9DA 1N6EA 5H1MA 1T2XA 3E0CA 3K26A 4QRJA 4ES0A 4AN1A 4GGCA 1QFMA 4D0KA 3FCUA 5EM2B 2P9SC 3I7LA 1VZ3A 4FA1D 4U7AA 3I89A 3EI1A 3QHYB 2IUVA 2HKRA 3EQ8A 2CNXA 3NIDA 5CXBA 4CI1A 2AH1A 4Z7OA 2QXVA 2EICA 2I0RA 4GM3A 2XU7A 3NIFA 5CYKB 3SCYA 3RFGA 3EQ9A 1VE7A 3IIYA 5M5UA 2HU8A 1JV2A 2I0SA 4HDJA 4QT8A 1QFSA 3EI2A 3VGZA 3ODTA 5I5MA 3JZGA 4LG9A 4IA9A 3BG1A 4YVDA 5EM2A 2W18A 4J79A 3KCIA 4PSWB 3AH8B 4JXMA 3JAMg 2J55H 5I5IA 3K71A 4BCBA 3UVKA 4JSVC 4PC0A 5CYKA 4NENA 1RI6A 4A0AB 1B9XA 2UZXB 3EG6A 4RE6A 5E6RA 4BCCA 1E8NA 1P22A 2G99A 1PI6A 4JD2C 4AN0A 5E6SA 2IAAA 2P9IC 2AGLA 3AL8A 2Z2PA 4QQEA 5FKQA 2H13A 5FQDA 4O02A 3PVUB 4A0AA 2B5MA 3UVMA 2B4EA 2H47A 2HESX 4CC9A 5THAA 5C2VB 3PVWB 3ULEC 4N14A 4K3JB 3SVWD 1K32A 4NBMA 1E5TA 1UOPA 4X61B 5GMKn 3IURA 2XL2A 5K1CC 4J73A 1QNIA 3IUQA 4Y5RD 3OTTA 4FB1D 1GOHA 1JMXB 2H9MA 3EI4B 1PEVA 3PXWD 2I3TA 5HE3B 5IGOA 3EQ7A 5H17A 3SMRA 2VDLA 3CIKB 4AMYA 2XDWA 3I2NA 5HE2B 1H2YA 3N0EA 5AMSA 3RLMD 1OLZA 3VI4A 2QR5A 4E5ZB 5FXYA 1GOTB 2OK6A 4Z8LA 4FA5D 3J81g 3JB9L 3I8EA 4A2LA 4CY1A 3K27A 3SN6B 4DNUA 2VDPA 3ZE0A 3V5WB 4G1EA 4FA4D 1TBGA 2TRCB 3EI4A 3NVXA 4RE5A 1JJUB 3EI3A 4D9SA 2PBIB 3IIWA 3L4MD 3OL2B 2HYEA 5AJAA 4J77A 3BG0A 4ZOXA 4OZUA 2XE4A 2BCJB 2VDKA 5FLXg 3SJLD 3UVLA 4H5IA 3DSMA 2VDOA 4E5ZA 5HDBA 4QL1A 3N0DA 3OF7A 1L0QA 5TEEA 3MUOA 2HXCA 2YNNA 3UVOA 4BP9A 3KRWB 4FWWA 4ZOZA 3RMZD 5TEFA 4GQBB 3NIGA 3CFSB 3UKRC 4U1EI 2PM9B 4CZYA 4CI2A 1JOFA 4J86A 1MG2A 2CO0C 2J57G 3FCSA 4LG8A 3OL2A 5K19A 2AGYA 4A08B 1XHMA 3ZDXA 1SQJA 2I0TA 1TYQC 2OVQB 4JT6C 2H9LA 4JHPC 5HE0B 3T3MA 5KDOB 4XYIA 4CI8A 1O6GA 4J81A 3ORVD 5EAMA 3ZE2A 1YFQA 3IUNA 5HYNB 3O4GA 3OKYB 4AEZA 3MZKA 4WJKA 2PM9A 4A09B 3MVDK 3JZNA 1GOGA 3C75H 3I8CA 3PE7A 4I79A 1C9IA 4A08A 4GMBA 4GM8A 3K72A 2PM6B 4O3TB 1I2MB 4X60B 4A7JA 5M61A 3CFVA 5IT9g 3V9FA 3UR4A 5FKRA 4PSXB 4NSXA 4UI9R 2Q7QA 4EWRA 2EBSA 4MK0B 2YB8B 2AH0A 4CZXA 2BBKH 4BH6A 1SQ9A 3JPXA 3VH0A 1L5GA 3JROA 4O1QD 4A09A 4WK2A 1FWXA 1N6FA 3L4OD 3PSCB 1PGUA 2VC2A 3C5MA 2HJ4A 3J80g 5EMMB 2AGXA 4J8BA 2H68A 4GQ1A 1SHYB 4OWRA 5FFOA 5C92A
chains in the Genus database with same CATH topology
4CZVA 3IKOA 4PNKB 4JT5C 4ZN4A 1OMWB 4X63B 4R7AB 3DXMC 5C9ZB 4J78A 2OJYA 3U4YA 3PXTD 2H6QA 3OW8A 5EALA 2YNOA 2H14A 4PBZA 4JSXC 3EU7A 3IJCA 3MKSB 3DM0A 5EARA 4D6VA 3I7PA 1U2VC 3IJ0A 3P4FA 4A0BB 2HJBA 1VYHC 3I7NA 3F3PA 3C99A 2G9AA 4BUJC 2H9PA 5TF2A 3IJ1A 3MKQA 4A11B 1PBYB 3SBRA 3RN0D 4FAVD 2IWFA 1GG2B 3I7KA 3OKTA 3I7OA 4O45A 3SHFA 2P9PC 4GGDA 4A0BA 5EAPA 2CE8A 3SBQA 1XKSA 3OKWA 4CY5A 4JSNC 4BL0A 4J0XA 2GNQA 2OIZA 2IURA 1GXRA 1ERJA 5I5JA 4A11A 2Z2NA 3PXSD 3SXTD 1MG3A 5IJ8E 2CE9A 4JSPC 3MZLA 3F3FA 5IJ7E 2MTAH 3EI2B 3NVNA 1R5MA 5EMJB 3RRMC 2PM7B 4A2MA 5GXIA 4KFMB 4E54B 4GQ2P 5HQGA 3HFQA 2XYIA 4IMMA 3AL9A 4X3EA 5CXCB 4ESGA 4J82A 4XEIC 1JMZB 2GC7A 4FAND 4K3ID 2I3SA 3UVNA 3F3GA 3JZHA 4J8GA 1NEXB 5EMLB 2QC5A 3EWEA 4CY2A 2YMUA 4E54A 1NR0A 3V7DB 4Y7RA 3B7FA 4GGAA 3OKYA 3AL8B 4GZ8A 3MXXA 2IWKA 3DXKC 4ZOYA 5CXCA 4XYHA 1K8KC 4CY3A 1Q47A 5HE1B 2XL3A 5JWZA 2OVPB 5IGQA 4L1QD 4G56B 4J84A 3I7HA 5FA5B 4GM9A 2P9LC 2CO0A 2O9KA 4PXWA 2B5LA 3UKUC 3SFZA 3AFCA 1GP2B 2HKMA 2IUQA 4L3HD 2P9KC 3FRXA 3W15A 5B4WA 1B9YA 3KRXB 5EMKB 2YNPA 4J87A 4ERQA 2UZYB 5IC7A 3ZWLB 4ERYA 5GXHA 2J56H 1U4CA 3GFCA 4ERZA 3FM0A 5FKTA 3SBPA 4FA9D 3PSLA 1N6DA 2B5NA 4PBYA 3JRPA 4L3GD 2AGWA 3VA6A 3EI3B 2YBAA 2AGZA 3SLED 2CN3A 4O3UB 3SWSD 3RN1D 3RFHA 2IUPA 3MMYA 2P9UC 5FKSA 3FGBA 3EMHA 2H6NA 2GC4A 2AQ5A 3A0FA 5TDHB 2CN2A 1MDAH 4CI3A 5A2Qg 4L9OA 4FHLA 4AOWA 2Z2OA 3EI1B 3C9CA 4TZ4A 3NVQA 4H5JA 5C2WB 5CXBB 3DWLC 1A0RB 2OK4A 1XIPA 5SXMA 4LGNA 1S4UX 3BWSA 4ZOVA 4J0WA 5AFU3 2H9NA 2OVRB 2H3XA 2P9NC 5H14A 2H6KA 3RSEC 3GREA 5GSAA 4O9DA 1N6EA 5H1MA 3E0CA 3K26A 4QRJA 4ES0A 4GGCA 4D0KA 5EM2B 2P9SC 3I7LA 4FA1D 4U7AA 3I89A 3EI1A 2IUVA 2HKRA 5CXBA 2CNXA 4CI1A 2AH1A 2QXVA 2I0RA 4GM3A 2XU7A 5CYKB 3SCYA 3RFGA 3IIYA 2I0SA 4HDJA 4QT8A 3EI2A 3VGZA 3ODTA 5I5MA 3JZGA 4LG9A 4IA9A 3BG1A 4YVDA 5EM2A 2W18A 4J79A 4PSWB 3AH8B 4JXMA 3JAMg 2J55H 5I5IA 3UVKA 4JSVC 4PC0A 5CYKA 1RI6A 4A0AB 1B9XA 2UZXB 3EG6A 1P22A 2G99A 1PI6A 4JD2C 2IAAA 2P9IC 2AGLA 3AL8A 2Z2PA 4QQEA 5FKQA 2H13A 5FQDA 3PVUB 4A0AA 2B5MA 3UVMA 2B4EA 2H47A 2HESX 4CC9A 5THAA 5C2VB 3PVWB 3ULEC 4N14A 4K3JB 3SVWD 1K32A 4X61B 5GMKn 2XL2A 5K1CC 4J73A 1QNIA 4Y5RD 3OTTA 4FB1D 1JMXB 2H9MA 3EI4B 1PEVA 3PXWD 2I3TA 5HE3B 5IGOA 5H17A 3SMRA 3CIKB 3I2NA 5HE2B 5AMSA 3N0EA 3RLMD 1OLZA 4E5ZB 5FXYA 1GOTB 2OK6A 4Z8LA 4FA5D 3J81g 3JB9L 3I8EA 4A2LA 4CY1A 3K27A 3SN6B 3V5WB 4FA4D 1TBGA 2TRCB 3EI4A 3NVXA 1JJUB 3EI3A 2PBIB 3IIWA 3L4MD 3OL2B 2HYEA 5AJAA 4J77A 3BG0A 4ZOXA 4OZUA 2BCJB 5FLXg 3SJLD 3UVLA 4H5IA 3DSMA 4E5ZA 4QL1A 3N0DA 5TEEA 1L0QA 2HXCA 2YNNA 3UVOA 3KRWB 4FWWA 4ZOZA 3RMZD 5TEFA 4GQBB 3CFSB 3UKRC 4U1EI 2PM9B 4CZYA 4CI2A 1JOFA 4J86A 1MG2A 2CO0C 2J57G 4LG8A 3OL2A 5K19A 2AGYA 4A08B 1XHMA 1SQJA 2I0TA 1TYQC 2OVQB 4JT6C 2H9LA 5HE0B 5KDOB 4XYIA 4CI8A 4J81A 3ORVD 5EAMA 1YFQA 5HYNB 3OKYB 4AEZA 3MZKA 2PM9A 4A09B 3JZNA 3C75H 3I8CA 3PE7A 4I79A 4A08A 4GMBA 4GM8A 2PM6B 4O3TB 4X60B 4A7JA 3CFVA 5IT9g 3V9FA 3UR4A 5FKRA 4PSXB 4NSXA 4UI9R 2Q7QA 4EWRA 2EBSA 4MK0B 2YB8B 2AH0A 4CZXA 2BBKH 4BH6A 1SQ9A 3JPXA 3VH0A 3JROA 4O1QD 4A09A 1FWXA 1N6FA 3L4OD 3PSCB 1PGUA 3C5MA 2HJ4A 3J80g 5EMMB 2AGXA 4J8BA 2H68A 4GQ1A 1SHYB 4OWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZV A;  3IKO A;  4PNK B;  4JT5 C;  4ZN4 A;  1OMW B;  4X63 B;  4R7A B;  3DXM C;  5C9Z B;  4J78 A;  2OJY A;  3U4Y A;  3PXT D;  2H6Q A;  3OW8 A;  5EAL A;  2YNO A;  2H14 A;  4PBZ A;  4JSX C;  3EU7 A;  3IJC A;  3MKS B;  3DM0 A;  5EAR A;  4D6V A;  3I7P A;  1U2V C;  3IJ0 A;  3P4F A;  4A0B B;  2HJB A;  1VYH C;  3I7N A;  3F3P A;  3C99 A;  2G9A A;  4BUJ C;  2H9P A;  5TF2 A;  3IJ1 A;  3MKQ A;  4A11 B;  1PBY B;  3SBR A;  3RN0 D;  4FAV D;  2IWF A;  1GG2 B;  3I7K A;  3OKT A;  3I7O A;  4O45 A;  3SHF A;  2P9P C;  4GGD A;  4A0B A;  5EAP A;  2CE8 A;  3SBQ A;  1XKS A;  3OKW A;  4CY5 A;  4JSN C;  4BL0 A;  4J0X A;  2GNQ A;  2OIZ A;  2IUR A;  1GXR A;  1ERJ A;  5I5J A;  4A11 A;  2Z2N A;  3PXS D;  3SXT D;  1MG3 A;  5IJ8 E;  2CE9 A;  4JSP C;  3MZL A;  3F3F A;  5IJ7 E;  2MTA H;  3EI2 B;  3NVN A;  1R5M A;  5EMJ B;  3RRM C;  2PM7 B;  4A2M A;  5GXI A;  4KFM B;  4E54 B;  4GQ2 P;  5HQG A;  3HFQ A;  2XYI A;  4IMM A;  3AL9 A;  4X3E A;  5CXC B;  4ESG A;  4J82 A;  4XEI C;  1JMZ B;  2GC7 A;  4FAN D;  4K3I D;  2I3S A;  3UVN A;  3F3G A;  3JZH A;  4J8G A;  1NEX B;  5EML B;  2QC5 A;  3EWE A;  4CY2 A;  2YMU A;  4E54 A;  1NR0 A;  3V7D B;  4Y7R A;  3B7F A;  4GGA A;  3OKY A;  3AL8 B;  4GZ8 A;  3MXX A;  2IWK A;  3DXK C;  4ZOY A;  5CXC A;  4XYH A;  1K8K C;  4CY3 A;  1Q47 A;  5HE1 B;  2XL3 A;  5JWZ A;  2OVP B;  5IGQ A;  4L1Q D;  4G56 B;  4J84 A;  3I7H A;  5FA5 B;  4GM9 A;  2P9L C;  2CO0 A;  2O9K A;  4PXW A;  2B5L A;  3UKU C;  3SFZ A;  3AFC A;  1GP2 B;  2HKM A;  2IUQ A;  4L3H D;  2P9K C;  3FRX A;  3W15 A;  5B4W A;  1B9Y A;  3KRX B;  5EMK B;  2YNP A;  4J87 A;  4ERQ A;  2UZY B;  5IC7 A;  3ZWL B;  4ERY A;  5GXH A;  2J56 H;  1U4C A;  3GFC A;  4ERZ A;  3FM0 A;  5FKT A;  3SBP A;  4FA9 D;  3PSL A;  1N6D A;  2B5N A;  4PBY A;  3JRP A;  4L3G D;  2AGW A;  3VA6 A;  3EI3 B;  2YBA A;  2AGZ A;  3SLE D;  2CN3 A;  4O3U B;  3SWS D;  3RN1 D;  3RFH A;  2IUP A;  3MMY A;  2P9U C;  5FKS A;  3FGB A;  3EMH A;  2H6N A;  2GC4 A;  2AQ5 A;  3A0F A;  5TDH B;  2CN2 A;  1MDA H;  4CI3 A;  5A2Q g;  4L9O A;  4FHL A;  4AOW A;  2Z2O A;  3EI1 B;  3C9C A;  4TZ4 A;  3NVQ A;  4H5J A;  5C2W B;  5CXB B;  3DWL C;  1A0R B;  2OK4 A;  1XIP A;  5SXM A;  4LGN A;  1S4U X;  3BWS A;  4ZOV A;  4J0W A;  5AFU 3;  2H9N A;  2OVR B;  2H3X A;  2P9N C;  5H14 A;  2H6K A;  3RSE C;  3GRE A;  5GSA A;  4O9D A;  1N6E A;  5H1M A;  3E0C A;  3K26 A;  4QRJ A;  4ES0 A;  4GGC A;  4D0K A;  5EM2 B;  2P9S C;  3I7L A;  4FA1 D;  4U7A A;  3I89 A;  3EI1 A;  2IUV A;  2HKR A;  5CXB A;  2CNX A;  4CI1 A;  2AH1 A;  2QXV A;  2I0R A;  4GM3 A;  2XU7 A;  5CYK B;  3SCY A;  3RFG A;  3IIY A;  2I0S A;  4HDJ A;  4QT8 A;  3EI2 A;  3VGZ A;  3ODT A;  5I5M A;  3JZG A;  4LG9 A;  4IA9 A;  3BG1 A;  4YVD A;  5EM2 A;  2W18 A;  4J79 A;  4PSW B;  3AH8 B;  4JXM A;  3JAM g;  2J55 H;  5I5I A;  3UVK A;  4JSV C;  4PC0 A;  5CYK A;  1RI6 A;  4A0A B;  1B9X A;  2UZX B;  3EG6 A;  1P22 A;  2G99 A;  1PI6 A;  4JD2 C;  2IAA A;  2P9I C;  2AGL A;  3AL8 A;  2Z2P A;  4QQE A;  5FKQ A;  2H13 A;  5FQD A;  3PVU B;  4A0A A;  2B5M A;  3UVM A;  2B4E A;  2H47 A;  2HES X;  4CC9 A;  5THA A;  5C2V B;  3PVW B;  3ULE C;  4N14 A;  4K3J B;  3SVW D;  1K32 A;  4X61 B;  5GMK n;  2XL2 A;  5K1C C;  4J73 A;  1QNI A;  4Y5R D;  3OTT A;  4FB1 D;  1JMX B;  2H9M A;  3EI4 B;  1PEV A;  3PXW D;  2I3T A;  5HE3 B;  5IGO A;  5H17 A;  3SMR A;  3CIK B;  3I2N A;  5HE2 B;  5AMS A;  3N0E A;  3RLM D;  1OLZ A;  4E5Z B;  5FXY A;  1GOT B;  2OK6 A;  4Z8L A;  4FA5 D;  3J81 g;  3JB9 L;  3I8E A;  4A2L A;  4CY1 A;  3K27 A;  3SN6 B;  3V5W B;  4FA4 D;  1TBG A;  2TRC B;  3EI4 A;  3NVX A;  1JJU B;  3EI3 A;  2PBI B;  3IIW A;  3L4M D;  3OL2 B;  2HYE A;  5AJA A;  4J77 A;  3BG0 A;  4ZOX A;  4OZU A;  2BCJ B;  5FLX g;  3SJL D;  3UVL A;  4H5I A;  3DSM A;  4E5Z A;  4QL1 A;  3N0D A;  5TEE A;  1L0Q A;  2HXC A;  2YNN A;  3UVO A;  3KRW B;  4FWW A;  4ZOZ A;  3RMZ D;  5TEF A;  4GQB B;  3CFS B;  3UKR C;  4U1E I;  2PM9 B;  4CZY A;  4CI2 A;  1JOF A;  4J86 A;  1MG2 A;  2CO0 C;  2J57 G;  4LG8 A;  3OL2 A;  5K19 A;  2AGY A;  4A08 B;  1XHM A;  1SQJ A;  2I0T A;  1TYQ C;  2OVQ B;  4JT6 C;  2H9L A;  5HE0 B;  5KDO B;  4XYI A;  4CI8 A;  4J81 A;  3ORV D;  5EAM A;  1YFQ A;  5HYN B;  3OKY B;  4AEZ A;  3MZK A;  2PM9 A;  4A09 B;  3JZN A;  3C75 H;  3I8C A;  3PE7 A;  4I79 A;  4A08 A;  4GMB A;  4GM8 A;  2PM6 B;  4O3T B;  4X60 B;  4A7J A;  3CFV A;  5IT9 g;  3V9F A;  3UR4 A;  5FKR A;  4PSX B;  4NSX A;  4UI9 R;  2Q7Q A;  4EWR A;  2EBS A;  4MK0 B;  2YB8 B;  2AH0 A;  4CZX A;  2BBK H;  4BH6 A;  1SQ9 A;  3JPX A;  3VH0 A;  3JRO A;  4O1Q D;  4A09 A;  1FWX A;  1N6F A;  3L4O D;  3PSC B;  1PGU A;  3C5M A;  2HJ4 A;  3J80 g;  5EMM B;  2AGX A;  4J8B A;  2H68 A;  4GQ1 A;  1SHY B;  4OWR A; 
#chains in the Genus database with same CATH topology
 4CZV A;  3IKO A;  4PNK B;  4JT5 C;  4QAM A;  4ZN4 A;  1OMW B;  4X63 B;  2VZ1 A;  3DXM C;  4R7A B;  5C9Z B;  4J78 A;  1TYE A;  2OJY A;  3U4Y A;  3PXT D;  2VDR A;  2H6Q A;  5M5T A;  3OW8 A;  5EAL A;  4AX4 A;  2YNO A;  4JHN A;  2H14 A;  4WK0 A;  4PBZ A;  4JSX C;  3EU7 A;  2QZP A;  3IJC A;  3MKS B;  3DM0 A;  1UOQ A;  5EAR A;  4G55 A;  4D6V A;  3I7P A;  4AMZ A;  1H2Z A;  1U2V C;  3IJ0 A;  3P4F A;  4A0B B;  2VDQ A;  2HJB A;  2VDN A;  2XZG A;  4G1M A;  4DNV A;  1VYH C;  3I7N A;  2BKL A;  3O4I A;  5M5V A;  3F3P A;  5FFG A;  1VE6 A;  3ZDY A;  3C99 A;  2G9A A;  4BUJ C;  2H9P A;  5TF2 A;  1BPO A;  3IJ1 A;  1YR2 A;  3MKQ A;  4MMY A;  4A11 B;  1PBY B;  3SBR A;  3RN0 D;  4FAV D;  2IWF A;  1GG2 B;  3I7K A;  3OKT A;  1U8C A;  4DNW A;  3I7O A;  4NAA A;  4O45 A;  3SHF A;  1E8M A;  2P9P C;  4GGD A;  4A0B A;  5EAP A;  2CE8 A;  3SBQ A;  1XKS A;  3OKW A;  4CY5 A;  4O2W A;  4JSN C;  5C86 A;  4BL0 A;  4J0X A;  2GNQ A;  1UOO A;  2OIZ A;  2IUR A;  5M5R A;  1K3I A;  1GXR A;  1ERJ A;  5I5J A;  4A11 A;  2Z2N A;  3PXS D;  3SXT D;  1MG3 A;  5IJ8 E;  2CE9 A;  4MMX A;  4JSP C;  3MZL A;  3F3F A;  5IJ7 E;  2MTA H;  3EI2 B;  3NVN A;  1R5M A;  5EMJ B;  3RRM C;  1VZ2 A;  2PM7 B;  4A2M A;  5GXI A;  4KFM B;  4Z7N A;  4E54 B;  4GQ2 P;  5HQG A;  4BCD A;  3HFQ A;  2XYI A;  4IMM A;  3AL9 A;  5M5S A;  4X3E A;  5CXC B;  4ESG A;  4J82 A;  3ZE1 A;  4XEI C;  1JMZ B;  2GC7 A;  3IUM A;  4FAN D;  4K3I D;  2I3S A;  3UVN A;  3F3G A;  3JZH A;  3VI3 A;  4J8G A;  2WQ8 A;  1NEX B;  3T3P A;  5EML B;  2QC5 A;  3EWE A;  1O6F A;  4CY2 A;  2YMU A;  2JKX A;  4E54 A;  1NR0 A;  3V7D B;  4Y7R A;  3B7F A;  1UTC A;  4GGA A;  3OKY A;  2EIB A;  3AL8 B;  3MXX A;  4GZ8 A;  1H2W A;  2IWK A;  3DXK C;  4NC4 A;  4ZOY A;  5CXC A;  3V4V A;  2EID A;  1K8K C;  4XYH A;  4CY3 A;  1Q47 A;  3GC3 B;  5HE1 B;  2XL3 A;  5JWZ A;  2OVP B;  5IGQ A;  3IUL A;  3GD1 I;  4G56 B;  4L1Q D;  4J84 A;  3I7H A;  4UM8 A;  5FA5 B;  4GM9 A;  4UM9 A;  4L1M A;  2VZ3 A;  2P9L C;  2CO0 A;  3DDU A;  2O9K A;  1A12 A;  1M1X A;  4IRZ A;  4PXW A;  2B5L A;  3MUN A;  3UKU C;  3O4J A;  3SFZ A;  3AFC A;  1GP2 B;  3QI0 A;  2HKM A;  3IVM A;  2IUQ A;  4L3H D;  2P9K C;  3FRX A;  3W15 A;  5B4W A;  1B9Y A;  3KRX B;  5EMK B;  2YNP A;  3IJE A;  4J87 A;  4ERQ A;  2UZY B;  4Z7Q A;  2HU5 A;  5IC7 A;  3ZWL B;  2VDM A;  4ERY A;  1C9L A;  5GXH A;  2J56 H;  1U4C A;  3GFC A;  3IUJ A;  4ERZ A;  3FM0 A;  5FKT A;  1JTD B;  3SBP A;  4FA9 D;  3PSL A;  1N6D A;  2B5N A;  4PBY A;  4BP8 A;  2EIE A;  3JRP A;  4L3G D;  2HU7 A;  5E6U A;  2AGW A;  3VA6 A;  3EI3 B;  2YBA A;  2AGZ A;  3SLE D;  2CN3 A;  4O3U B;  3SWS D;  3RN1 D;  3RFH A;  2IUP A;  3MMY A;  4MMZ A;  2P9U C;  5FKS A;  1GOF A;  3FGB A;  3EMH A;  2H6N A;  2GC4 A;  2AQ5 A;  3A0F A;  5TDH B;  2CN2 A;  1MDA H;  4WK4 A;  4CI3 A;  5A2Q g;  4L9O A;  4FHL A;  4AOW A;  2Z2O A;  3EI1 B;  3C9C A;  4TZ4 A;  3NVQ A;  1H2X A;  4H5J A;  5C2W B;  5CXB B;  3DWL C;  3ZDZ A;  1A0R B;  2OK4 A;  1XIP A;  5SXM A;  3V4P A;  4LGN A;  1S4U X;  3BWS A;  4ZOV A;  4J0W A;  5AFU 3;  3K6S A;  2H9N A;  2OVR B;  2H3X A;  2P9N C;  5H14 A;  2H6K A;  3RSE C;  3GRE A;  3O4H A;  5GSA A;  4O9D A;  1N6E A;  5H1M A;  1T2X A;  3E0C A;  3K26 A;  4QRJ A;  4ES0 A;  4AN1 A;  4GGC A;  1QFM A;  4D0K A;  3FCU A;  5EM2 B;  2P9S C;  3I7L A;  1VZ3 A;  4FA1 D;  4U7A A;  3I89 A;  3EI1 A;  3QHY B;  2IUV A;  2HKR A;  3EQ8 A;  2CNX A;  3NID A;  5CXB A;  4CI1 A;  2AH1 A;  4Z7O A;  2QXV A;  2EIC A;  2I0R A;  4GM3 A;  2XU7 A;  3NIF A;  5CYK B;  3SCY A;  3RFG A;  3EQ9 A;  1VE7 A;  3IIY A;  5M5U A;  2HU8 A;  1JV2 A;  2I0S A;  4HDJ A;  4QT8 A;  1QFS A;  3EI2 A;  3VGZ A;  3ODT A;  5I5M A;  3JZG A;  4LG9 A;  4IA9 A;  3BG1 A;  4YVD A;  5EM2 A;  2W18 A;  4J79 A;  3KCI A;  4PSW B;  3AH8 B;  4JXM A;  3JAM g;  2J55 H;  5I5I A;  3K71 A;  4BCB A;  3UVK A;  4JSV C;  4PC0 A;  5CYK A;  4NEN A;  1RI6 A;  4A0A B;  1B9X A;  2UZX B;  3EG6 A;  4RE6 A;  5E6R A;  4BCC A;  1E8N A;  1P22 A;  2G99 A;  1PI6 A;  4JD2 C;  4AN0 A;  5E6S A;  2IAA A;  2P9I C;  2AGL A;  3AL8 A;  2Z2P A;  4QQE A;  5FKQ A;  2H13 A;  5FQD A;  4O02 A;  3PVU B;  4A0A A;  2B5M A;  3UVM A;  2B4E A;  2H47 A;  2HES X;  4CC9 A;  5THA A;  5C2V B;  3PVW B;  3ULE C;  4N14 A;  4K3J B;  3SVW D;  1K32 A;  4NBM A;  1E5T A;  1UOP A;  4X61 B;  5GMK n;  3IUR A;  2XL2 A;  5K1C C;  4J73 A;  1QNI A;  3IUQ A;  4Y5R D;  3OTT A;  4FB1 D;  1GOH A;  1JMX B;  2H9M A;  3EI4 B;  1PEV A;  3PXW D;  2I3T A;  5HE3 B;  5IGO A;  3EQ7 A;  5H17 A;  3SMR A;  2VDL A;  3CIK B;  4AMY A;  2XDW A;  3I2N A;  5HE2 B;  1H2Y A;  3N0E A;  5AMS A;  3RLM D;  1OLZ A;  3VI4 A;  2QR5 A;  4E5Z B;  5FXY A;  1GOT B;  2OK6 A;  4Z8L A;  4FA5 D;  3J81 g;  3JB9 L;  3I8E A;  4A2L A;  4CY1 A;  3K27 A;  3SN6 B;  4DNU A;  2VDP A;  3ZE0 A;  3V5W B;  4G1E A;  4FA4 D;  1TBG A;  2TRC B;  3EI4 A;  3NVX A;  4RE5 A;  1JJU B;  3EI3 A;  4D9S A;  2PBI B;  3IIW A;  3L4M D;  3OL2 B;  2HYE A;  5AJA A;  4J77 A;  3BG0 A;  4ZOX A;  4OZU A;  2XE4 A;  2BCJ B;  2VDK A;  5FLX g;  3SJL D;  3UVL A;  4H5I A;  3DSM A;  2VDO A;  4E5Z A;  5HDB A;  4QL1 A;  3N0D A;  3OF7 A;  1L0Q A;  5TEE A;  3MUO A;  2HXC A;  2YNN A;  3UVO A;  4BP9 A;  3KRW B;  4FWW A;  4ZOZ A;  3RMZ D;  5TEF A;  4GQB B;  3NIG A;  3CFS B;  3UKR C;  4U1E I;  2PM9 B;  4CZY A;  4CI2 A;  1JOF A;  4J86 A;  1MG2 A;  2CO0 C;  2J57 G;  3FCS A;  4LG8 A;  3OL2 A;  5K19 A;  2AGY A;  4A08 B;  1XHM A;  3ZDX A;  1SQJ A;  2I0T A;  1TYQ C;  2OVQ B;  4JT6 C;  2H9L A;  4JHP C;  5HE0 B;  3T3M A;  5KDO B;  4XYI A;  4CI8 A;  1O6G A;  4J81 A;  3ORV D;  5EAM A;  3ZE2 A;  1YFQ A;  3IUN A;  5HYN B;  3O4G A;  3OKY B;  4AEZ A;  3MZK A;  4WJK A;  2PM9 A;  4A09 B;  3MVD K;  3JZN A;  1GOG A;  3C75 H;  3I8C A;  3PE7 A;  4I79 A;  1C9I A;  4A08 A;  4GMB A;  4GM8 A;  3K72 A;  2PM6 B;  4O3T B;  1I2M B;  4X60 B;  4A7J A;  5M61 A;  3CFV A;  5IT9 g;  3V9F A;  3UR4 A;  5FKR A;  4PSX B;  4NSX A;  4UI9 R;  2Q7Q A;  4EWR A;  2EBS A;  4MK0 B;  2YB8 B;  2AH0 A;  4CZX A;  2BBK H;  4BH6 A;  1SQ9 A;  3JPX A;  3VH0 A;  1L5G A;  3JRO A;  4O1Q D;  4A09 A;  4WK2 A;  1FWX A;  1N6F A;  3L4O D;  3PSC B;  1PGU A;  2VC2 A;  3C5M A;  2HJ4 A;  3J80 g;  5EMM B;  2AGX A;  4J8B A;  2H68 A;  4GQ1 A;  1SHY B;  4OWR A;  5FFO A;  5C92 A; 
#chains in the Genus database with same CATH homology
 4CZV A;  3IKO A;  4PNK B;  4JT5 C;  4ZN4 A;  1OMW B;  4X63 B;  4R7A B;  3DXM C;  5C9Z B;  4J78 A;  2OJY A;  3U4Y A;  3PXT D;  2H6Q A;  3OW8 A;  5EAL A;  2YNO A;  2H14 A;  4PBZ A;  4JSX C;  3EU7 A;  3IJC A;  3MKS B;  3DM0 A;  5EAR A;  4D6V A;  3I7P A;  1U2V C;  3IJ0 A;  3P4F A;  4A0B B;  2HJB A;  1VYH C;  3I7N A;  3F3P A;  3C99 A;  2G9A A;  4BUJ C;  2H9P A;  5TF2 A;  3IJ1 A;  3MKQ A;  4A11 B;  1PBY B;  3SBR A;  3RN0 D;  4FAV D;  2IWF A;  1GG2 B;  3I7K A;  3OKT A;  3I7O A;  4O45 A;  3SHF A;  2P9P C;  4GGD A;  4A0B A;  5EAP A;  2CE8 A;  3SBQ A;  1XKS A;  3OKW A;  4CY5 A;  4JSN C;  4BL0 A;  4J0X A;  2GNQ A;  2OIZ A;  2IUR A;  1GXR A;  1ERJ A;  5I5J A;  4A11 A;  2Z2N A;  3PXS D;  3SXT D;  1MG3 A;  5IJ8 E;  2CE9 A;  4JSP C;  3MZL A;  3F3F A;  5IJ7 E;  2MTA H;  3EI2 B;  3NVN A;  1R5M A;  5EMJ B;  3RRM C;  2PM7 B;  4A2M A;  5GXI A;  4KFM B;  4E54 B;  4GQ2 P;  5HQG A;  3HFQ A;  2XYI A;  4IMM A;  3AL9 A;  4X3E A;  5CXC B;  4ESG A;  4J82 A;  4XEI C;  1JMZ B;  2GC7 A;  4FAN D;  4K3I D;  2I3S A;  3UVN A;  3F3G A;  3JZH A;  4J8G A;  1NEX B;  5EML B;  2QC5 A;  3EWE A;  4CY2 A;  2YMU A;  4E54 A;  1NR0 A;  3V7D B;  4Y7R A;  3B7F A;  4GGA A;  3OKY A;  3AL8 B;  4GZ8 A;  3MXX A;  2IWK A;  3DXK C;  4ZOY A;  5CXC A;  4XYH A;  1K8K C;  4CY3 A;  1Q47 A;  5HE1 B;  2XL3 A;  5JWZ A;  2OVP B;  5IGQ A;  4L1Q D;  4G56 B;  4J84 A;  3I7H A;  5FA5 B;  4GM9 A;  2P9L C;  2CO0 A;  2O9K A;  4PXW A;  2B5L A;  3UKU C;  3SFZ A;  3AFC A;  1GP2 B;  2HKM A;  2IUQ A;  4L3H D;  2P9K C;  3FRX A;  3W15 A;  5B4W A;  1B9Y A;  3KRX B;  5EMK B;  2YNP A;  4J87 A;  4ERQ A;  2UZY B;  5IC7 A;  3ZWL B;  4ERY A;  5GXH A;  2J56 H;  1U4C A;  3GFC A;  4ERZ A;  3FM0 A;  5FKT A;  3SBP A;  4FA9 D;  3PSL A;  1N6D A;  2B5N A;  4PBY A;  3JRP A;  4L3G D;  2AGW A;  3VA6 A;  3EI3 B;  2YBA A;  2AGZ A;  3SLE D;  2CN3 A;  4O3U B;  3SWS D;  3RN1 D;  3RFH A;  2IUP A;  3MMY A;  2P9U C;  5FKS A;  3FGB A;  3EMH A;  2H6N A;  2GC4 A;  2AQ5 A;  3A0F A;  5TDH B;  2CN2 A;  1MDA H;  4CI3 A;  5A2Q g;  4L9O A;  4FHL A;  4AOW A;  2Z2O A;  3EI1 B;  3C9C A;  4TZ4 A;  3NVQ A;  4H5J A;  5C2W B;  5CXB B;  3DWL C;  1A0R B;  2OK4 A;  1XIP A;  5SXM A;  4LGN A;  1S4U X;  3BWS A;  4ZOV A;  4J0W A;  5AFU 3;  2H9N A;  2OVR B;  2H3X A;  2P9N C;  5H14 A;  2H6K A;  3RSE C;  3GRE A;  5GSA A;  4O9D A;  1N6E A;  5H1M A;  3E0C A;  3K26 A;  4QRJ A;  4ES0 A;  4GGC A;  4D0K A;  5EM2 B;  2P9S C;  3I7L A;  4FA1 D;  4U7A A;  3I89 A;  3EI1 A;  2IUV A;  2HKR A;  5CXB A;  2CNX A;  4CI1 A;  2AH1 A;  2QXV A;  2I0R A;  4GM3 A;  2XU7 A;  5CYK B;  3SCY A;  3RFG A;  3IIY A;  2I0S A;  4HDJ A;  4QT8 A;  3EI2 A;  3VGZ A;  3ODT A;  5I5M A;  3JZG A;  4LG9 A;  4IA9 A;  3BG1 A;  4YVD A;  5EM2 A;  2W18 A;  4J79 A;  4PSW B;  3AH8 B;  4JXM A;  3JAM g;  2J55 H;  5I5I A;  3UVK A;  4JSV C;  4PC0 A;  5CYK A;  1RI6 A;  4A0A B;  1B9X A;  2UZX B;  3EG6 A;  1P22 A;  2G99 A;  1PI6 A;  4JD2 C;  2IAA A;  2P9I C;  2AGL A;  3AL8 A;  2Z2P A;  4QQE A;  5FKQ A;  2H13 A;  5FQD A;  3PVU B;  4A0A A;  2B5M A;  3UVM A;  2B4E A;  2H47 A;  2HES X;  4CC9 A;  5THA A;  5C2V B;  3PVW B;  3ULE C;  4N14 A;  4K3J B;  3SVW D;  1K32 A;  4X61 B;  5GMK n;  2XL2 A;  5K1C C;  4J73 A;  1QNI A;  4Y5R D;  3OTT A;  4FB1 D;  1JMX B;  2H9M A;  3EI4 B;  1PEV A;  3PXW D;  2I3T A;  5HE3 B;  5IGO A;  5H17 A;  3SMR A;  3CIK B;  3I2N A;  5HE2 B;  5AMS A;  3N0E A;  3RLM D;  1OLZ A;  4E5Z B;  5FXY A;  1GOT B;  2OK6 A;  4Z8L A;  4FA5 D;  3J81 g;  3JB9 L;  3I8E A;  4A2L A;  4CY1 A;  3K27 A;  3SN6 B;  3V5W B;  4FA4 D;  1TBG A;  2TRC B;  3EI4 A;  3NVX A;  1JJU B;  3EI3 A;  2PBI B;  3IIW A;  3L4M D;  3OL2 B;  2HYE A;  5AJA A;  4J77 A;  3BG0 A;  4ZOX A;  4OZU A;  2BCJ B;  5FLX g;  3SJL D;  3UVL A;  4H5I A;  3DSM A;  4E5Z A;  4QL1 A;  3N0D A;  5TEE A;  1L0Q A;  2HXC A;  2YNN A;  3UVO A;  3KRW B;  4FWW A;  4ZOZ A;  3RMZ D;  5TEF A;  4GQB B;  3CFS B;  3UKR C;  4U1E I;  2PM9 B;  4CZY A;  4CI2 A;  1JOF A;  4J86 A;  1MG2 A;  2CO0 C;  2J57 G;  4LG8 A;  3OL2 A;  5K19 A;  2AGY A;  4A08 B;  1XHM A;  1SQJ A;  2I0T A;  1TYQ C;  2OVQ B;  4JT6 C;  2H9L A;  5HE0 B;  5KDO B;  4XYI A;  4CI8 A;  4J81 A;  3ORV D;  5EAM A;  1YFQ A;  5HYN B;  3OKY B;  4AEZ A;  3MZK A;  2PM9 A;  4A09 B;  3JZN A;  3C75 H;  3I8C A;  3PE7 A;  4I79 A;  4A08 A;  4GMB A;  4GM8 A;  2PM6 B;  4O3T B;  4X60 B;  4A7J A;  3CFV A;  5IT9 g;  3V9F A;  3UR4 A;  5FKR A;  4PSX B;  4NSX A;  4UI9 R;  2Q7Q A;  4EWR A;  2EBS A;  4MK0 B;  2YB8 B;  2AH0 A;  4CZX A;  2BBK H;  4BH6 A;  1SQ9 A;  3JPX A;  3VH0 A;  3JRO A;  4O1Q D;  4A09 A;  1FWX A;  1N6F A;  3L4O D;  3PSC B;  1PGU A;  3C5M A;  2HJ4 A;  3J80 g;  5EMM B;  2AGX A;  4J8B A;  2H68 A;  4GQ1 A;  1SHY B;  4OWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...