1VYHC

Paf-ah holoenzyme: lis1/alfa2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
317
structure length
310
Chain Sequence
KEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSEGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling Paf Signaling to Dynein Regulation: Structure of Lis1 in Complex with Paf-Acetylhydrolase.
pubmed doi rcsb
molecule keywords PLATELET-ACTIVATING FACTOR ACETYLHYDROLASE IB BETA SUBUNIT
molecule tags Hydrolase
source organism Homo sapiens
total genus 70
structure length 310
sequence length 317
chains with identical sequence D, G, H, K, L, O, P, S, T
ec nomenclature
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
C PF08513 LisH LisH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1vyhC01
5CXBA 4XEIC 2G9AA 3CIKB 3BG0A 2IUQA 4J77A 3C9CA 1PI6A 1OLZA 4FAND 3V7DB 3BWSA 4G56B 2O9KA 2AH1A 1U4CA 2IURA 3N0EA 3EU7A 3GREA 2EBSA 2BBKH 2HJBA 2HYEA 5THAA 3DXKC 3MZKA 4ZOVA 1VYHC 4GGDA 4PSWB 5IJ7E 2H9PA 5CXBB 3SVWD 4O9DA 3IIYA 1XKSA 5CXCA 4FWWA 2OVRB 4JSVC 2H9NA 2YNPA 2P9UC 2XL3A 3AFCA 4JD2C 5AJAA 3RN1D 1GXRA 3F3GA 4O3UB 3SCYA 1JOFA 5EMKB 4CY1A 1PEVA 3UVKA 3MKSB 5AFU3 1B9YA 1A0RB 2H9LA 3EI4B 3MMYA 4TZ4A 4A11A 2H13A 2OK4A 2HKRA 3HFQA 4GGCA 3IIWA 1TYQC 1XHMA 4ZOZA 5H1MA 1L0QA 3NVNA 3PVUB 3ODTA 3RSEC 4CC9A 3EI2A 3EI1B 4A7JA 5CXCB 2CO0C 4X63B 3EG6A 2P9NC 3C99A 4Y5RD 4LGNA 4L1QD 4YVDA 3I8CA 2AGXA 3OL2B 3K26A 5FQDA 5GXHA 4A0AA 3I89A 4A2MA 4QT8A 4X61B 4A11B 2YB8B 1S4UX 3AL9A 4CI3A 4HDJA 2J56H 4H5IA 3RMZD 3JZHA 5K19A 2AH0A 4NSXA 4BL0A 4LG9A 2YMUA 4LG8A 4O45A 3EI2B 3IJ1A 3I2NA 5TEFA 4O1QD 4GQ1A 4A0BA 3I7NA 3J81g 2PM9A 4ERQA 4J86A 5IGOA 4ZOYA 2GC7A 4BUJC 5EALA 3PSLA 4GQBB 3MXXA 2CN3A 4A0AB 4OZUA 4H5JA 3PSCB 4IMMA 2QXVA 3UVMA 2QC5A 1JMZB 3SN6B 3IJCA 4J8GA 4J82A 2H47A 4GZ8A 2XL2A 5HE3B 3AL8A 3I7OA 2P9IC 3I8EA 2AGLA 2YNNA 2P9PC 3VA6A 4FAVD 1B9XA 3PXTD 5I5JA 4FA1D 2IAAA 3IJ0A 2CE8A 3JAMg 4A0BB 4X3EA 2PM9B 5HQGA 2PM7B 3MKQA 5GMKn 5C2VB 3K27A 4OWRA 3JRPA 4JSXC 1YFQA 1JJUB 4GM9A 3OTTA 2HESX 3DSMA 2H14A 4PBYA 2W18A 3V9FA 2P9LC 4J8BA 3E0CA 2IUPA 4L9OA 4PBZA 1K32A 2H6QA 2Q7QA 3C75H 2H6NA 3DXMC 3AL8B 3BG1A 2P9SC 3V5WB 1SHYB 1SQJA 3JPXA 2H3XA 2GNQA 1RI6A 2BCJB 3OKTA 2OJYA 2GC4A 3F3FA 2Z2PA 4QL1A 3IKOA 2AGWA 4X60B 2MTAH 3VH0A 3OKWA 3NVQA 1SQ9A 3W15A 1FWXA 2H6KA 5HE2B 1K8KC 4CI2A 4ZN4A 3JB9L 4K3ID 3UVNA 4CZXA 5EMJB 3MZLA 3PE7A 1N6DA 3I7KA 4J87A 2XYIA 4E5ZA 3C5MA 3UKUC 4FA4D 4AEZA 5GSAA 4A09A 3RFHA 4IA9A 4JSPC 5FXYA 1N6EA 3SWSD 2Z2OA 4JXMA 1PBYB 1P22A 4N14A 4J81A 2OVPB 4FA9D 4XYHA 3UVLA 5EMMB 4GGAA 4R7AB 5HYNB 1U2VC 2H9MA 2IUVA 1N6FA 4O3TB 3JROA 2IWFA 5EM2A 5IJ8E 4L3HD 3ZWLB 3UVOA 2CNXA 5FKSA 4D6VA 3GFCA 3JZNA 4JSNC 4E5ZB 1TBGA 5HE0B 2I0SA 1NEXB 4U1EI 4A09B 5EMLB 1XIPA 1MG3A 2G99A 4KFMB 3DWLC 4J0XA 2B4EA 3ULEC 3CFSB 1MG2A 3U4YA 1ERJA 2XU7A 3SJLD 5IGQA 2PM6B 2I0TA 4K3JB 4PSXB 2OK6A 4J0WA 3RLMD 3VGZA 4ERZA 1GOTB 5K1CC 3J80g 4A08A 5EM2B 3B7FA 3KRWB 1MDAH 5EAMA 2I3TA 3UR4A 2B5MA 5H17A 4I79A 3SBQA 3ORVD 1QNIA 3AH8B 3SBPA 3SLED 5I5IA 4UI9R 2OVQB 1R5MA 2PBIB 4J78A 2UZYB 3F3PA 3L4OD 5A2Qg 4CY2A 2AGYA 4ES0A 4ZOXA 3I7HA 4U7AA 3SBRA 4A08B 4J73A 3RN0D 2IWKA 2I3SA 3DM0A 3EI4A 4D0KA 4E54A 4XYIA 4CY5A 1GG2B 3NVXA 3FM0A 3PVWB 1OMWB 3SMRA 5TEEA 1NR0A 3OKYA 4QQEA 3EWEA 1GP2B 4FA5D 5FLXg 3PXSD 5FKQA 4Y7RA 3JZGA 5AMSA 3L4MD 1JMXB 2B5LA 3PXWD 3EI1A 3SFZA 4JT6C 4GM3A 5FKTA 4BH6A 4FB1D 3EI3A 2AGZA 4PNKB 3I7PA 2HXCA 3OL2A 1PGUA 3OW8A 3P4FA 5SXMA 5KDOB 3A0FA 3RFGA 3CFVA 2YBAA 4GMBA 3KRXB 4EWRA 5I5MA 4FHLA 4CI8A 5JWZA 5H14A 4CY3A 4E54B 3EMHA 2TRCB 2UZXB 4ERYA 4PC0A 4J79A 3OKYB 4J84A 3FRXA 4ESGA 4PXWA 2Z2NA 2P9KC 5CYKA 3EI3B 2OIZA 4L3GD 2H68A 2I0RA 4MK0B 4CZVA 5TF2A 4GQ2P 2CN2A 3I7LA 5EAPA 2AQ5A 4QRJA 5EARA 1Q47A 2J55H 5FA5B 4GM8A 4JT5C 2YNOA 4A2LA 3SHFA 3SXTD 4CI1A 2HKMA 4CZYA 3RRMC 5IC7A 3N0DA 5GXIA 3UKRC 5CYKB 5IT9g 5C9ZB 2B5NA 5TDHB 2J57G 5B4WA 4Z8LA 5FKRA 4AOWA 3FGBA 2CE9A 5HE1B 2HJ4A 5C2WB 2CO0A
chains in the Genus database with same CATH superfamily
5CXBA 4XEIC 2G9AA 3NIDA 3ZE2A 2VDMA 2VDQA 3CIKB 3BG0A 2IUQA 4J77A 3IUJA 3C9CA 1PI6A 1OLZA 5FFOA 3FCSA 4FAND 4WJKA 3V7DB 1U8CA 3O4IA 3BWSA 4G56B 2O9KA 2AH1A 1U4CA 2IURA 3N0EA 5M5RA 2BKLA 3EU7A 3GREA 2EBSA 2HU7A 3QI0A 2BBKH 2HJBA 2HYEA 5THAA 2VC2A 3DXKC 3MZKA 4ZOVA 3ZE1A 1VYHC 4GGDA 4PSWB 5IJ7E 2H9PA 5CXBB 2HU5A 3V4VA 3SVWD 4O9DA 3IIYA 1XKSA 4Z7OA 5FFGA 5CXCA 2VDPA 4FWWA 3O4HA 1JV2A 2OVRB 4JSVC 4DNUA 2H9NA 2YNPA 2P9UC 2XL3A 3AFCA 4JD2C 4AX4A 5AJAA 4BCCA 3RN1D 1GXRA 3F3GA 4O3UB 3SCYA 1JOFA 5EMKB 4CY1A 1PEVA 3UVKA 3MKSB 5AFU3 2XDWA 1B9YA 1A0RB 3MVDK 2H9LA 3EI4B 3MMYA 1E8MA 4TZ4A 4A11A 2H13A 2OK4A 3K6SA 2HKRA 3HFQA 4GGCA 1GOHA 3IIWA 1TYQC 1XHMA 4ZOZA 2QR5A 5H1MA 1L0QA 1UOQA 3NVNA 3PVUB 3ODTA 3RSEC 4CC9A 3EI2A 3EI1B 4A7JA 5CXCB 2CO0C 4X63B 3EG6A 4QAMA 2P9NC 3C99A 4Y5RD 4LGNA 4L1QD 4YVDA 3I8CA 2AGXA 3OL2B 3K26A 3NIGA 5FQDA 5GXHA 5E6RA 4A0AA 3I89A 1VE7A 4A2MA 4QT8A 3IUMA 4X61B 4A11B 2YB8B 1S4UX 3AL9A 4NC4A 3DDUA 4CI3A 2HU8A 4HDJA 2J56H 4H5IA 3RMZD 3JZHA 5K19A 2AH0A 4NSXA 4BL0A 4LG9A 2YMUA 4LG8A 4O45A 4AMYA 3EI2B 3IJ1A 3I2NA 5TEFA 4O1QD 4GQ1A 4A0BA 1E8NA 3I7NA 3J81g 2EIEA 3IULA 2PM9A 5E6UA 4ERQA 4J86A 5IGOA 4ZOYA 2GC7A 4BUJC 4UM8A 5EALA 3PSLA 4GQBB 4RE6A 3MXXA 4AN1A 2CN3A 4A0AB 4OZUA 1I2MB 4H5JA 3PSCB 4IMMA 2QXVA 3UVMA 2QC5A 1JMZB 1O6FA 3SN6B 3IJCA 3IUQA 4J8GA 4GZ8A 2H47A 4J82A 2XL2A 5HE3B 3AL8A 4G1EA 3I7OA 2P9IC 3I8EA 2AGLA 2YNNA 2P9PC 1H2WA 3VA6A 4FAVD 1B9XA 3PXTD 5I5JA 4FA1D 2IAAA 3IJ0A 2CE8A 4BCDA 3JAMg 4A0BB 4X3EA 2PM9B 3GD1I 5HDBA 1YR2A 5HQGA 2PM7B 1E5TA 3MKQA 3K72A 5GMKn 5C2VB 1QFSA 3K27A 4OWRA 1A12A 3JRPA 3MUNA 2QZPA 4JSXC 3ZE0A 1YFQA 1JJUB 4GM9A 3OTTA 2HESX 3DSMA 2H14A 4NAAA 4PBYA 2W18A 4IRZA 3V9FA 2P9LC 4J8BA 4MMZA 4RE5A 3E0CA 2IUPA 4L9OA 4PBZA 1C9LA 1K32A 2H6QA 2Q7QA 3C75H 2H6NA 3DXMC 3AL8B 3IJEA 3BG1A 2P9SC 3EQ7A 3V5WB 1SHYB 1SQJA 3JPXA 2H3XA 2GNQA 1RI6A 2BCJB 1BPOA 3OKTA 2OJYA 2GC4A 3F3FA 2Z2PA 4QL1A 3IKOA 2AGWA 4X60B 2MTAH 3VH0A 1JTDB 3OKWA 1GOFA 3NVQA 1SQ9A 3W15A 1FWXA 4D9SA 2H6KA 1H2YA 5HE2B 1K8KC 4CI2A 4ZN4A 3JB9L 4K3ID 3UVNA 1H2XA 4CZXA 5M5VA 5EMJB 2VZ3A 3MZLA 3PE7A 1N6DA 3I7KA 4J87A 2XYIA 4E5ZA 3C5MA 2EIDA 3UKUC 4FA4D 4AEZA 5GSAA 4A09A 3RFHA 4IA9A 4JSPC 5FXYA 1N6EA 3SWSD 2Z2OA 4JXMA 1PBYB 1P22A 4N14A 4J81A 2OVPB 4FA9D 4XYHA 2EICA 3UVLA 5EMMB 4GGAA 3EQ9A 4R7AB 5HYNB 1U2VC 2H9MA 2IUVA 1N6FA 1GOGA 1H2ZA 4O3TB 3IUNA 3JROA 2IWFA 5EM2A 5M5UA 5IJ8E 1TYEA 4L3HD 3UVOA 3ZWLB 2CNXA 5FKSA 4D6VA 3GFCA 3JZNA 4JSNC 4E5ZB 1TBGA 5HE0B 2I0SA 1NEXB 4U1EI 4A09B 5EMLB 1XIPA 1MG3A 2G99A 2VZ1A 3DWLC 4KFMB 4MMYA 4J0XA 2B4EA 3ULEC 3CFSB 1MG2A 3K71A 3U4YA 1ERJA 2XU7A 3SJLD 3KCIA 1VZ3A 2PM6B 5IGQA 2I0TA 4K3JB 4PSXB 2OK6A 4J0WA 3RLMD 2VDLA 4BP9A 2VDRA 3VGZA 4ERZA 1GOTB 4G1MA 5K1CC 1UOPA 1VE6A 3J80g 4A08A 3VI4A 4L1MA 5EM2B 5E6SA 3B7FA 3KRWB 1MDAH 5EAMA 2I3TA 3UR4A 2VDNA 5M61A 2B5MA 5H17A 3T3PA 4I79A 3SBQA 3ORVD 1QNIA 3AH8B 5C92A 3SBPA 3SLED 5I5IA 5M5SA 4UI9R 2OVQB 3NIFA 3O4GA 3ZDZA 1R5MA 3GC3B 2PBIB 4J78A 2UZYB 3F3PA 3L4OD 5A2Qg 4CY2A 5M5TA 3ZDYA 2AGYA 4ES0A 3O4JA 4ZOXA 3I7HA 4U7AA 3SBRA 4BCBA 3IURA 4A08B 4J73A 3RN0D 2IWKA 4Z7QA 2I3SA 4WK0A 3DM0A 3IVMA 1O6GA 1T2XA 3EI4A 3ZDXA 4D0KA 4E54A 4XYIA 3V4PA 4CY5A 1GG2B 3NVXA 3FM0A 3PVWB 1OMWB 3SMRA 5TEEA 1NR0A 2XZGA 3OKYA 4QQEA 3EWEA 1GP2B 4FA5D 5FLXg 3PXSD 5FKQA 4Y7RA 3JZGA 5AMSA 3L4MD 1JMXB 2B5LA 3PXWD 3EI1A 3SFZA 4JT6C 4Z7NA 1UTCA 4GM3A 5FKTA 4BH6A 4FB1D 3EI3A 2AGZA 4PNKB 3I7PA 2HXCA 3OL2A 1PGUA 3OW8A 3P4FA 4AN0A 4O02A 5SXMA 5KDOB 3A0FA 4MMXA 3RFGA 3CFVA 2YBAA 4JHPC 4GMBA 3KRXB 3T3MA 4EWRA 1M1XA 1QFMA 5I5MA 4UM9A 4FHLA 4CI8A 5JWZA 5H14A 4CY3A 4G55A 4E54B 3EMHA 2TRCB 2UZXB 1VZ2A 4BP8A 4ERYA 2WQ8A 4AMZA 3FCUA 4PC0A 4J79A 2JKXA 3OKYB 4J84A 3FRXA 4ESGA 3OF7A 3EQ8A 4O2WA 4PXWA 4NBMA 2Z2NA 3QHYB 2P9KC 4DNVA 2EIBA 5CYKA 1K3IA 3EI3B 1L5GA 2OIZA 4L3GD 1UOOA 2H68A 2I0RA 4MK0B 4JHNA 4CZVA 5TF2A 4GQ2P 2CN2A 3I7LA 5EAPA 2AQ5A 4QRJA 1C9IA 1Q47A 2J55H 5EARA 5FA5B 4DNWA 4GM8A 4JT5C 2YNOA 4A2LA 2VDOA 3SHFA 3SXTD 4CI1A 2HKMA 2XE4A 4NENA 4WK2A 4CZYA 3RRMC 3VI3A 5IC7A 3N0DA 5GXIA 4WK4A 3UKRC 5CYKB 5IT9g 5C9ZB 2B5NA 5TDHB 2J57G 5B4WA 4Z8LA 5C86A 5FKRA 4AOWA 3FGBA 2CE9A 5HE1B 2HJ4A 5C2WB 2VDKA 3MUOA 2CO0A
chains in the Genus database with same CATH topology
5CXBA 4XEIC 2G9AA 3CIKB 3BG0A 2IUQA 4J77A 3C9CA 1PI6A 1OLZA 4FAND 3V7DB 3BWSA 4G56B 2O9KA 2AH1A 1U4CA 2IURA 3N0EA 3EU7A 3GREA 2EBSA 2BBKH 2HJBA 2HYEA 5THAA 3DXKC 3MZKA 4ZOVA 1VYHC 4GGDA 4PSWB 5IJ7E 2H9PA 5CXBB 3SVWD 4O9DA 3IIYA 1XKSA 5CXCA 4FWWA 2OVRB 4JSVC 2H9NA 2YNPA 2P9UC 2XL3A 3AFCA 4JD2C 5AJAA 3RN1D 1GXRA 3F3GA 4O3UB 3SCYA 1JOFA 5EMKB 4CY1A 1PEVA 3UVKA 3MKSB 5AFU3 1B9YA 1A0RB 2H9LA 3EI4B 3MMYA 4TZ4A 4A11A 2H13A 2OK4A 2HKRA 3HFQA 4GGCA 3IIWA 1TYQC 1XHMA 4ZOZA 5H1MA 1L0QA 3NVNA 3PVUB 3ODTA 3RSEC 4CC9A 3EI2A 3EI1B 4A7JA 5CXCB 2CO0C 4X63B 3EG6A 2P9NC 3C99A 4Y5RD 4LGNA 4L1QD 4YVDA 3I8CA 2AGXA 3OL2B 3K26A 5FQDA 5GXHA 4A0AA 3I89A 4A2MA 4QT8A 4X61B 4A11B 2YB8B 1S4UX 3AL9A 4CI3A 4HDJA 2J56H 4H5IA 3RMZD 3JZHA 5K19A 2AH0A 4NSXA 4BL0A 4LG9A 2YMUA 4LG8A 4O45A 3EI2B 3IJ1A 3I2NA 5TEFA 4O1QD 4GQ1A 4A0BA 3I7NA 3J81g 2PM9A 4ERQA 4J86A 5IGOA 4ZOYA 2GC7A 4BUJC 5EALA 3PSLA 4GQBB 3MXXA 2CN3A 4A0AB 4OZUA 4H5JA 3PSCB 4IMMA 2QXVA 3UVMA 2QC5A 1JMZB 3SN6B 3IJCA 4J8GA 4J82A 2H47A 4GZ8A 2XL2A 5HE3B 3AL8A 3I7OA 2P9IC 3I8EA 2AGLA 2YNNA 2P9PC 3VA6A 4FAVD 1B9XA 3PXTD 5I5JA 4FA1D 2IAAA 3IJ0A 2CE8A 3JAMg 4A0BB 4X3EA 2PM9B 5HQGA 2PM7B 3MKQA 5GMKn 5C2VB 3K27A 4OWRA 3JRPA 4JSXC 1YFQA 1JJUB 4GM9A 3OTTA 2HESX 3DSMA 2H14A 4PBYA 2W18A 3V9FA 2P9LC 4J8BA 3E0CA 2IUPA 4L9OA 4PBZA 1K32A 2H6QA 2Q7QA 3C75H 2H6NA 3DXMC 3AL8B 3BG1A 2P9SC 3V5WB 1SHYB 1SQJA 3JPXA 2H3XA 2GNQA 1RI6A 2BCJB 3OKTA 2OJYA 2GC4A 3F3FA 2Z2PA 4QL1A 3IKOA 2AGWA 4X60B 2MTAH 3VH0A 3OKWA 3NVQA 1SQ9A 3W15A 1FWXA 2H6KA 5HE2B 1K8KC 4CI2A 4ZN4A 3JB9L 4K3ID 3UVNA 4CZXA 5EMJB 3MZLA 3PE7A 1N6DA 3I7KA 4J87A 2XYIA 4E5ZA 3C5MA 3UKUC 4FA4D 4AEZA 5GSAA 4A09A 3RFHA 4IA9A 4JSPC 5FXYA 1N6EA 3SWSD 2Z2OA 4JXMA 1PBYB 1P22A 4N14A 4J81A 2OVPB 4FA9D 4XYHA 3UVLA 5EMMB 4GGAA 4R7AB 5HYNB 1U2VC 2H9MA 2IUVA 1N6FA 4O3TB 3JROA 2IWFA 5EM2A 5IJ8E 4L3HD 3ZWLB 3UVOA 2CNXA 5FKSA 4D6VA 3GFCA 3JZNA 4JSNC 4E5ZB 1TBGA 5HE0B 2I0SA 1NEXB 4U1EI 4A09B 5EMLB 1XIPA 1MG3A 2G99A 4KFMB 3DWLC 4J0XA 2B4EA 3ULEC 3CFSB 1MG2A 3U4YA 1ERJA 2XU7A 3SJLD 5IGQA 2PM6B 2I0TA 4K3JB 4PSXB 2OK6A 4J0WA 3RLMD 3VGZA 4ERZA 1GOTB 5K1CC 3J80g 4A08A 5EM2B 3B7FA 3KRWB 1MDAH 5EAMA 2I3TA 3UR4A 2B5MA 5H17A 4I79A 3SBQA 3ORVD 1QNIA 3AH8B 3SBPA 3SLED 5I5IA 4UI9R 2OVQB 1R5MA 2PBIB 4J78A 2UZYB 3F3PA 3L4OD 5A2Qg 4CY2A 2AGYA 4ES0A 4ZOXA 3I7HA 4U7AA 3SBRA 4A08B 4J73A 3RN0D 2IWKA 2I3SA 3DM0A 3EI4A 4D0KA 4E54A 4XYIA 4CY5A 1GG2B 3NVXA 3FM0A 3PVWB 1OMWB 3SMRA 5TEEA 1NR0A 3OKYA 4QQEA 3EWEA 1GP2B 4FA5D 5FLXg 3PXSD 5FKQA 4Y7RA 3JZGA 5AMSA 3L4MD 1JMXB 2B5LA 3PXWD 3EI1A 3SFZA 4JT6C 4GM3A 5FKTA 4BH6A 4FB1D 3EI3A 2AGZA 4PNKB 3I7PA 2HXCA 3OL2A 1PGUA 3OW8A 3P4FA 5SXMA 5KDOB 3A0FA 3RFGA 3CFVA 2YBAA 4GMBA 3KRXB 4EWRA 5I5MA 4FHLA 4CI8A 5JWZA 5H14A 4CY3A 4E54B 3EMHA 2TRCB 2UZXB 4ERYA 4PC0A 4J79A 3OKYB 4J84A 3FRXA 4ESGA 4PXWA 2Z2NA 2P9KC 5CYKA 3EI3B 2OIZA 4L3GD 2H68A 2I0RA 4MK0B 4CZVA 5TF2A 4GQ2P 2CN2A 3I7LA 5EAPA 2AQ5A 4QRJA 5EARA 1Q47A 2J55H 5FA5B 4GM8A 4JT5C 2YNOA 4A2LA 3SHFA 3SXTD 4CI1A 2HKMA 4CZYA 3RRMC 5IC7A 3N0DA 5GXIA 3UKRC 5CYKB 5IT9g 5C9ZB 2B5NA 5TDHB 2J57G 5B4WA 4Z8LA 5FKRA 4AOWA 3FGBA 2CE9A 5HE1B 2HJ4A 5C2WB 2CO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB A;  4XEI C;  2G9A A;  3CIK B;  3BG0 A;  2IUQ A;  4J77 A;  3C9C A;  1PI6 A;  1OLZ A;  4FAN D;  3V7D B;  3BWS A;  4G56 B;  2O9K A;  2AH1 A;  1U4C A;  2IUR A;  3N0E A;  3EU7 A;  3GRE A;  2EBS A;  2BBK H;  2HJB A;  2HYE A;  5THA A;  3DXK C;  3MZK A;  4ZOV A;  1VYH C;  4GGD A;  4PSW B;  5IJ7 E;  2H9P A;  5CXB B;  3SVW D;  4O9D A;  3IIY A;  1XKS A;  5CXC A;  4FWW A;  2OVR B;  4JSV C;  2H9N A;  2YNP A;  2P9U C;  2XL3 A;  3AFC A;  4JD2 C;  5AJA A;  3RN1 D;  1GXR A;  3F3G A;  4O3U B;  3SCY A;  1JOF A;  5EMK B;  4CY1 A;  1PEV A;  3UVK A;  3MKS B;  5AFU 3;  1B9Y A;  1A0R B;  2H9L A;  3EI4 B;  3MMY A;  4TZ4 A;  4A11 A;  2H13 A;  2OK4 A;  2HKR A;  3HFQ A;  4GGC A;  3IIW A;  1TYQ C;  1XHM A;  4ZOZ A;  5H1M A;  1L0Q A;  3NVN A;  3PVU B;  3ODT A;  3RSE C;  4CC9 A;  3EI2 A;  3EI1 B;  4A7J A;  5CXC B;  2CO0 C;  4X63 B;  3EG6 A;  2P9N C;  3C99 A;  4Y5R D;  4LGN A;  4L1Q D;  4YVD A;  3I8C A;  2AGX A;  3OL2 B;  3K26 A;  5FQD A;  5GXH A;  4A0A A;  3I89 A;  4A2M A;  4QT8 A;  4X61 B;  4A11 B;  2YB8 B;  1S4U X;  3AL9 A;  4CI3 A;  4HDJ A;  2J56 H;  4H5I A;  3RMZ D;  3JZH A;  5K19 A;  2AH0 A;  4NSX A;  4BL0 A;  4LG9 A;  2YMU A;  4LG8 A;  4O45 A;  3EI2 B;  3IJ1 A;  3I2N A;  5TEF A;  4O1Q D;  4GQ1 A;  4A0B A;  3I7N A;  3J81 g;  2PM9 A;  4ERQ A;  4J86 A;  5IGO A;  4ZOY A;  2GC7 A;  4BUJ C;  5EAL A;  3PSL A;  4GQB B;  3MXX A;  2CN3 A;  4A0A B;  4OZU A;  4H5J A;  3PSC B;  4IMM A;  2QXV A;  3UVM A;  2QC5 A;  1JMZ B;  3SN6 B;  3IJC A;  4J8G A;  4J82 A;  2H47 A;  4GZ8 A;  2XL2 A;  5HE3 B;  3AL8 A;  3I7O A;  2P9I C;  3I8E A;  2AGL A;  2YNN A;  2P9P C;  3VA6 A;  4FAV D;  1B9X A;  3PXT D;  5I5J A;  4FA1 D;  2IAA A;  3IJ0 A;  2CE8 A;  3JAM g;  4A0B B;  4X3E A;  2PM9 B;  5HQG A;  2PM7 B;  3MKQ A;  5GMK n;  5C2V B;  3K27 A;  4OWR A;  3JRP A;  4JSX C;  1YFQ A;  1JJU B;  4GM9 A;  3OTT A;  2HES X;  3DSM A;  2H14 A;  4PBY A;  2W18 A;  3V9F A;  2P9L C;  4J8B A;  3E0C A;  2IUP A;  4L9O A;  4PBZ A;  1K32 A;  2H6Q A;  2Q7Q A;  3C75 H;  2H6N A;  3DXM C;  3AL8 B;  3BG1 A;  2P9S C;  3V5W B;  1SHY B;  1SQJ A;  3JPX A;  2H3X A;  2GNQ A;  1RI6 A;  2BCJ B;  3OKT A;  2OJY A;  2GC4 A;  3F3F A;  2Z2P A;  4QL1 A;  3IKO A;  2AGW A;  4X60 B;  2MTA H;  3VH0 A;  3OKW A;  3NVQ A;  1SQ9 A;  3W15 A;  1FWX A;  2H6K A;  5HE2 B;  1K8K C;  4CI2 A;  4ZN4 A;  3JB9 L;  4K3I D;  3UVN A;  4CZX A;  5EMJ B;  3MZL A;  3PE7 A;  1N6D A;  3I7K A;  4J87 A;  2XYI A;  4E5Z A;  3C5M A;  3UKU C;  4FA4 D;  4AEZ A;  5GSA A;  4A09 A;  3RFH A;  4IA9 A;  4JSP C;  5FXY A;  1N6E A;  3SWS D;  2Z2O A;  4JXM A;  1PBY B;  1P22 A;  4N14 A;  4J81 A;  2OVP B;  4FA9 D;  4XYH A;  3UVL A;  5EMM B;  4GGA A;  4R7A B;  5HYN B;  1U2V C;  2H9M A;  2IUV A;  1N6F A;  4O3T B;  3JRO A;  2IWF A;  5EM2 A;  5IJ8 E;  4L3H D;  3ZWL B;  3UVO A;  2CNX A;  5FKS A;  4D6V A;  3GFC A;  3JZN A;  4JSN C;  4E5Z B;  1TBG A;  5HE0 B;  2I0S A;  1NEX B;  4U1E I;  4A09 B;  5EML B;  1XIP A;  1MG3 A;  2G99 A;  4KFM B;  3DWL C;  4J0X A;  2B4E A;  3ULE C;  3CFS B;  1MG2 A;  3U4Y A;  1ERJ A;  2XU7 A;  3SJL D;  5IGQ A;  2PM6 B;  2I0T A;  4K3J B;  4PSX B;  2OK6 A;  4J0W A;  3RLM D;  3VGZ A;  4ERZ A;  1GOT B;  5K1C C;  3J80 g;  4A08 A;  5EM2 B;  3B7F A;  3KRW B;  1MDA H;  5EAM A;  2I3T A;  3UR4 A;  2B5M A;  5H17 A;  4I79 A;  3SBQ A;  3ORV D;  1QNI A;  3AH8 B;  3SBP A;  3SLE D;  5I5I A;  4UI9 R;  2OVQ B;  1R5M A;  2PBI B;  4J78 A;  2UZY B;  3F3P A;  3L4O D;  5A2Q g;  4CY2 A;  2AGY A;  4ES0 A;  4ZOX A;  3I7H A;  4U7A A;  3SBR A;  4A08 B;  4J73 A;  3RN0 D;  2IWK A;  2I3S A;  3DM0 A;  3EI4 A;  4D0K A;  4E54 A;  4XYI A;  4CY5 A;  1GG2 B;  3NVX A;  3FM0 A;  3PVW B;  1OMW B;  3SMR A;  5TEE A;  1NR0 A;  3OKY A;  4QQE A;  3EWE A;  1GP2 B;  4FA5 D;  5FLX g;  3PXS D;  5FKQ A;  4Y7R A;  3JZG A;  5AMS A;  3L4M D;  1JMX B;  2B5L A;  3PXW D;  3EI1 A;  3SFZ A;  4JT6 C;  4GM3 A;  5FKT A;  4BH6 A;  4FB1 D;  3EI3 A;  2AGZ A;  4PNK B;  3I7P A;  2HXC A;  3OL2 A;  1PGU A;  3OW8 A;  3P4F A;  5SXM A;  5KDO B;  3A0F A;  3RFG A;  3CFV A;  2YBA A;  4GMB A;  3KRX B;  4EWR A;  5I5M A;  4FHL A;  4CI8 A;  5JWZ A;  5H14 A;  4CY3 A;  4E54 B;  3EMH A;  2TRC B;  2UZX B;  4ERY A;  4PC0 A;  4J79 A;  3OKY B;  4J84 A;  3FRX A;  4ESG A;  4PXW A;  2Z2N A;  2P9K C;  5CYK A;  3EI3 B;  2OIZ A;  4L3G D;  2H68 A;  2I0R A;  4MK0 B;  4CZV A;  5TF2 A;  4GQ2 P;  2CN2 A;  3I7L A;  5EAP A;  2AQ5 A;  4QRJ A;  5EAR A;  1Q47 A;  2J55 H;  5FA5 B;  4GM8 A;  4JT5 C;  2YNO A;  4A2L A;  3SHF A;  3SXT D;  4CI1 A;  2HKM A;  4CZY A;  3RRM C;  5IC7 A;  3N0D A;  5GXI A;  3UKR C;  5CYK B;  5IT9 g;  5C9Z B;  2B5N A;  5TDH B;  2J57 G;  5B4W A;  4Z8L A;  5FKR A;  4AOW A;  3FGB A;  2CE9 A;  5HE1 B;  2HJ4 A;  5C2W B;  2CO0 A; 
#chains in the Genus database with same CATH topology
 5CXB A;  4XEI C;  2G9A A;  3NID A;  3ZE2 A;  2VDM A;  2VDQ A;  3CIK B;  3BG0 A;  2IUQ A;  4J77 A;  3IUJ A;  3C9C A;  1PI6 A;  1OLZ A;  5FFO A;  3FCS A;  4FAN D;  4WJK A;  3V7D B;  1U8C A;  3O4I A;  3BWS A;  4G56 B;  2O9K A;  2AH1 A;  1U4C A;  2IUR A;  3N0E A;  5M5R A;  2BKL A;  3EU7 A;  3GRE A;  2EBS A;  2HU7 A;  3QI0 A;  2BBK H;  2HJB A;  2HYE A;  5THA A;  2VC2 A;  3DXK C;  3MZK A;  4ZOV A;  3ZE1 A;  1VYH C;  4GGD A;  4PSW B;  5IJ7 E;  2H9P A;  5CXB B;  2HU5 A;  3V4V A;  3SVW D;  4O9D A;  3IIY A;  1XKS A;  4Z7O A;  5FFG A;  5CXC A;  2VDP A;  4FWW A;  3O4H A;  1JV2 A;  2OVR B;  4JSV C;  4DNU A;  2H9N A;  2YNP A;  2P9U C;  2XL3 A;  3AFC A;  4JD2 C;  4AX4 A;  5AJA A;  4BCC A;  3RN1 D;  1GXR A;  3F3G A;  4O3U B;  3SCY A;  1JOF A;  5EMK B;  4CY1 A;  1PEV A;  3UVK A;  3MKS B;  5AFU 3;  2XDW A;  1B9Y A;  1A0R B;  3MVD K;  2H9L A;  3EI4 B;  3MMY A;  1E8M A;  4TZ4 A;  4A11 A;  2H13 A;  2OK4 A;  3K6S A;  2HKR A;  3HFQ A;  4GGC A;  1GOH A;  3IIW A;  1TYQ C;  1XHM A;  4ZOZ A;  2QR5 A;  5H1M A;  1L0Q A;  1UOQ A;  3NVN A;  3PVU B;  3ODT A;  3RSE C;  4CC9 A;  3EI2 A;  3EI1 B;  4A7J A;  5CXC B;  2CO0 C;  4X63 B;  3EG6 A;  4QAM A;  2P9N C;  3C99 A;  4Y5R D;  4LGN A;  4L1Q D;  4YVD A;  3I8C A;  2AGX A;  3OL2 B;  3K26 A;  3NIG A;  5FQD A;  5GXH A;  5E6R A;  4A0A A;  3I89 A;  1VE7 A;  4A2M A;  4QT8 A;  3IUM A;  4X61 B;  4A11 B;  2YB8 B;  1S4U X;  3AL9 A;  4NC4 A;  3DDU A;  4CI3 A;  2HU8 A;  4HDJ A;  2J56 H;  4H5I A;  3RMZ D;  3JZH A;  5K19 A;  2AH0 A;  4NSX A;  4BL0 A;  4LG9 A;  2YMU A;  4LG8 A;  4O45 A;  4AMY A;  3EI2 B;  3IJ1 A;  3I2N A;  5TEF A;  4O1Q D;  4GQ1 A;  4A0B A;  1E8N A;  3I7N A;  3J81 g;  2EIE A;  3IUL A;  2PM9 A;  5E6U A;  4ERQ A;  4J86 A;  5IGO A;  4ZOY A;  2GC7 A;  4BUJ C;  4UM8 A;  5EAL A;  3PSL A;  4GQB B;  4RE6 A;  3MXX A;  4AN1 A;  2CN3 A;  4A0A B;  4OZU A;  1I2M B;  4H5J A;  3PSC B;  4IMM A;  2QXV A;  3UVM A;  2QC5 A;  1JMZ B;  1O6F A;  3SN6 B;  3IJC A;  3IUQ A;  4J8G A;  4GZ8 A;  2H47 A;  4J82 A;  2XL2 A;  5HE3 B;  3AL8 A;  4G1E A;  3I7O A;  2P9I C;  3I8E A;  2AGL A;  2YNN A;  2P9P C;  1H2W A;  3VA6 A;  4FAV D;  1B9X A;  3PXT D;  5I5J A;  4FA1 D;  2IAA A;  3IJ0 A;  2CE8 A;  4BCD A;  3JAM g;  4A0B B;  4X3E A;  2PM9 B;  3GD1 I;  5HDB A;  1YR2 A;  5HQG A;  2PM7 B;  1E5T A;  3MKQ A;  3K72 A;  5GMK n;  5C2V B;  1QFS A;  3K27 A;  4OWR A;  1A12 A;  3JRP A;  3MUN A;  2QZP A;  4JSX C;  3ZE0 A;  1YFQ A;  1JJU B;  4GM9 A;  3OTT A;  2HES X;  3DSM A;  2H14 A;  4NAA A;  4PBY A;  2W18 A;  4IRZ A;  3V9F A;  2P9L C;  4J8B A;  4MMZ A;  4RE5 A;  3E0C A;  2IUP A;  4L9O A;  4PBZ A;  1C9L A;  1K32 A;  2H6Q A;  2Q7Q A;  3C75 H;  2H6N A;  3DXM C;  3AL8 B;  3IJE A;  3BG1 A;  2P9S C;  3EQ7 A;  3V5W B;  1SHY B;  1SQJ A;  3JPX A;  2H3X A;  2GNQ A;  1RI6 A;  2BCJ B;  1BPO A;  3OKT A;  2OJY A;  2GC4 A;  3F3F A;  2Z2P A;  4QL1 A;  3IKO A;  2AGW A;  4X60 B;  2MTA H;  3VH0 A;  1JTD B;  3OKW A;  1GOF A;  3NVQ A;  1SQ9 A;  3W15 A;  1FWX A;  4D9S A;  2H6K A;  1H2Y A;  5HE2 B;  1K8K C;  4CI2 A;  4ZN4 A;  3JB9 L;  4K3I D;  3UVN A;  1H2X A;  4CZX A;  5M5V A;  5EMJ B;  2VZ3 A;  3MZL A;  3PE7 A;  1N6D A;  3I7K A;  4J87 A;  2XYI A;  4E5Z A;  3C5M A;  2EID A;  3UKU C;  4FA4 D;  4AEZ A;  5GSA A;  4A09 A;  3RFH A;  4IA9 A;  4JSP C;  5FXY A;  1N6E A;  3SWS D;  2Z2O A;  4JXM A;  1PBY B;  1P22 A;  4N14 A;  4J81 A;  2OVP B;  4FA9 D;  4XYH A;  2EIC A;  3UVL A;  5EMM B;  4GGA A;  3EQ9 A;  4R7A B;  5HYN B;  1U2V C;  2H9M A;  2IUV A;  1N6F A;  1GOG A;  1H2Z A;  4O3T B;  3IUN A;  3JRO A;  2IWF A;  5EM2 A;  5M5U A;  5IJ8 E;  1TYE A;  4L3H D;  3UVO A;  3ZWL B;  2CNX A;  5FKS A;  4D6V A;  3GFC A;  3JZN A;  4JSN C;  4E5Z B;  1TBG A;  5HE0 B;  2I0S A;  1NEX B;  4U1E I;  4A09 B;  5EML B;  1XIP A;  1MG3 A;  2G99 A;  2VZ1 A;  3DWL C;  4KFM B;  4MMY A;  4J0X A;  2B4E A;  3ULE C;  3CFS B;  1MG2 A;  3K71 A;  3U4Y A;  1ERJ A;  2XU7 A;  3SJL D;  3KCI A;  1VZ3 A;  2PM6 B;  5IGQ A;  2I0T A;  4K3J B;  4PSX B;  2OK6 A;  4J0W A;  3RLM D;  2VDL A;  4BP9 A;  2VDR A;  3VGZ A;  4ERZ A;  1GOT B;  4G1M A;  5K1C C;  1UOP A;  1VE6 A;  3J80 g;  4A08 A;  3VI4 A;  4L1M A;  5EM2 B;  5E6S A;  3B7F A;  3KRW B;  1MDA H;  5EAM A;  2I3T A;  3UR4 A;  2VDN A;  5M61 A;  2B5M A;  5H17 A;  3T3P A;  4I79 A;  3SBQ A;  3ORV D;  1QNI A;  3AH8 B;  5C92 A;  3SBP A;  3SLE D;  5I5I A;  5M5S A;  4UI9 R;  2OVQ B;  3NIF A;  3O4G A;  3ZDZ A;  1R5M A;  3GC3 B;  2PBI B;  4J78 A;  2UZY B;  3F3P A;  3L4O D;  5A2Q g;  4CY2 A;  5M5T A;  3ZDY A;  2AGY A;  4ES0 A;  3O4J A;  4ZOX A;  3I7H A;  4U7A A;  3SBR A;  4BCB A;  3IUR A;  4A08 B;  4J73 A;  3RN0 D;  2IWK A;  4Z7Q A;  2I3S A;  4WK0 A;  3DM0 A;  3IVM A;  1O6G A;  1T2X A;  3EI4 A;  3ZDX A;  4D0K A;  4E54 A;  4XYI A;  3V4P A;  4CY5 A;  1GG2 B;  3NVX A;  3FM0 A;  3PVW B;  1OMW B;  3SMR A;  5TEE A;  1NR0 A;  2XZG A;  3OKY A;  4QQE A;  3EWE A;  1GP2 B;  4FA5 D;  5FLX g;  3PXS D;  5FKQ A;  4Y7R A;  3JZG A;  5AMS A;  3L4M D;  1JMX B;  2B5L A;  3PXW D;  3EI1 A;  3SFZ A;  4JT6 C;  4Z7N A;  1UTC A;  4GM3 A;  5FKT A;  4BH6 A;  4FB1 D;  3EI3 A;  2AGZ A;  4PNK B;  3I7P A;  2HXC A;  3OL2 A;  1PGU A;  3OW8 A;  3P4F A;  4AN0 A;  4O02 A;  5SXM A;  5KDO B;  3A0F A;  4MMX A;  3RFG A;  3CFV A;  2YBA A;  4JHP C;  4GMB A;  3KRX B;  3T3M A;  4EWR A;  1M1X A;  1QFM A;  5I5M A;  4UM9 A;  4FHL A;  4CI8 A;  5JWZ A;  5H14 A;  4CY3 A;  4G55 A;  4E54 B;  3EMH A;  2TRC B;  2UZX B;  1VZ2 A;  4BP8 A;  4ERY A;  2WQ8 A;  4AMZ A;  3FCU A;  4PC0 A;  4J79 A;  2JKX A;  3OKY B;  4J84 A;  3FRX A;  4ESG A;  3OF7 A;  3EQ8 A;  4O2W A;  4PXW A;  4NBM A;  2Z2N A;  3QHY B;  2P9K C;  4DNV A;  2EIB A;  5CYK A;  1K3I A;  3EI3 B;  1L5G A;  2OIZ A;  4L3G D;  1UOO A;  2H68 A;  2I0R A;  4MK0 B;  4JHN A;  4CZV A;  5TF2 A;  4GQ2 P;  2CN2 A;  3I7L A;  5EAP A;  2AQ5 A;  4QRJ A;  1C9I A;  1Q47 A;  2J55 H;  5EAR A;  5FA5 B;  4DNW A;  4GM8 A;  4JT5 C;  2YNO A;  4A2L A;  2VDO A;  3SHF A;  3SXT D;  4CI1 A;  2HKM A;  2XE4 A;  4NEN A;  4WK2 A;  4CZY A;  3RRM C;  3VI3 A;  5IC7 A;  3N0D A;  5GXI A;  4WK4 A;  3UKR C;  5CYK B;  5IT9 g;  5C9Z B;  2B5N A;  5TDH B;  2J57 G;  5B4W A;  4Z8L A;  5C86 A;  5FKR A;  4AOW A;  3FGB A;  2CE9 A;  5HE1 B;  2HJ4 A;  5C2W B;  2VDK A;  3MUO A;  2CO0 A; 
#chains in the Genus database with same CATH homology
 5CXB A;  4XEI C;  2G9A A;  3CIK B;  3BG0 A;  2IUQ A;  4J77 A;  3C9C A;  1PI6 A;  1OLZ A;  4FAN D;  3V7D B;  3BWS A;  4G56 B;  2O9K A;  2AH1 A;  1U4C A;  2IUR A;  3N0E A;  3EU7 A;  3GRE A;  2EBS A;  2BBK H;  2HJB A;  2HYE A;  5THA A;  3DXK C;  3MZK A;  4ZOV A;  1VYH C;  4GGD A;  4PSW B;  5IJ7 E;  2H9P A;  5CXB B;  3SVW D;  4O9D A;  3IIY A;  1XKS A;  5CXC A;  4FWW A;  2OVR B;  4JSV C;  2H9N A;  2YNP A;  2P9U C;  2XL3 A;  3AFC A;  4JD2 C;  5AJA A;  3RN1 D;  1GXR A;  3F3G A;  4O3U B;  3SCY A;  1JOF A;  5EMK B;  4CY1 A;  1PEV A;  3UVK A;  3MKS B;  5AFU 3;  1B9Y A;  1A0R B;  2H9L A;  3EI4 B;  3MMY A;  4TZ4 A;  4A11 A;  2H13 A;  2OK4 A;  2HKR A;  3HFQ A;  4GGC A;  3IIW A;  1TYQ C;  1XHM A;  4ZOZ A;  5H1M A;  1L0Q A;  3NVN A;  3PVU B;  3ODT A;  3RSE C;  4CC9 A;  3EI2 A;  3EI1 B;  4A7J A;  5CXC B;  2CO0 C;  4X63 B;  3EG6 A;  2P9N C;  3C99 A;  4Y5R D;  4LGN A;  4L1Q D;  4YVD A;  3I8C A;  2AGX A;  3OL2 B;  3K26 A;  5FQD A;  5GXH A;  4A0A A;  3I89 A;  4A2M A;  4QT8 A;  4X61 B;  4A11 B;  2YB8 B;  1S4U X;  3AL9 A;  4CI3 A;  4HDJ A;  2J56 H;  4H5I A;  3RMZ D;  3JZH A;  5K19 A;  2AH0 A;  4NSX A;  4BL0 A;  4LG9 A;  2YMU A;  4LG8 A;  4O45 A;  3EI2 B;  3IJ1 A;  3I2N A;  5TEF A;  4O1Q D;  4GQ1 A;  4A0B A;  3I7N A;  3J81 g;  2PM9 A;  4ERQ A;  4J86 A;  5IGO A;  4ZOY A;  2GC7 A;  4BUJ C;  5EAL A;  3PSL A;  4GQB B;  3MXX A;  2CN3 A;  4A0A B;  4OZU A;  4H5J A;  3PSC B;  4IMM A;  2QXV A;  3UVM A;  2QC5 A;  1JMZ B;  3SN6 B;  3IJC A;  4J8G A;  4J82 A;  2H47 A;  4GZ8 A;  2XL2 A;  5HE3 B;  3AL8 A;  3I7O A;  2P9I C;  3I8E A;  2AGL A;  2YNN A;  2P9P C;  3VA6 A;  4FAV D;  1B9X A;  3PXT D;  5I5J A;  4FA1 D;  2IAA A;  3IJ0 A;  2CE8 A;  3JAM g;  4A0B B;  4X3E A;  2PM9 B;  5HQG A;  2PM7 B;  3MKQ A;  5GMK n;  5C2V B;  3K27 A;  4OWR A;  3JRP A;  4JSX C;  1YFQ A;  1JJU B;  4GM9 A;  3OTT A;  2HES X;  3DSM A;  2H14 A;  4PBY A;  2W18 A;  3V9F A;  2P9L C;  4J8B A;  3E0C A;  2IUP A;  4L9O A;  4PBZ A;  1K32 A;  2H6Q A;  2Q7Q A;  3C75 H;  2H6N A;  3DXM C;  3AL8 B;  3BG1 A;  2P9S C;  3V5W B;  1SHY B;  1SQJ A;  3JPX A;  2H3X A;  2GNQ A;  1RI6 A;  2BCJ B;  3OKT A;  2OJY A;  2GC4 A;  3F3F A;  2Z2P A;  4QL1 A;  3IKO A;  2AGW A;  4X60 B;  2MTA H;  3VH0 A;  3OKW A;  3NVQ A;  1SQ9 A;  3W15 A;  1FWX A;  2H6K A;  5HE2 B;  1K8K C;  4CI2 A;  4ZN4 A;  3JB9 L;  4K3I D;  3UVN A;  4CZX A;  5EMJ B;  3MZL A;  3PE7 A;  1N6D A;  3I7K A;  4J87 A;  2XYI A;  4E5Z A;  3C5M A;  3UKU C;  4FA4 D;  4AEZ A;  5GSA A;  4A09 A;  3RFH A;  4IA9 A;  4JSP C;  5FXY A;  1N6E A;  3SWS D;  2Z2O A;  4JXM A;  1PBY B;  1P22 A;  4N14 A;  4J81 A;  2OVP B;  4FA9 D;  4XYH A;  3UVL A;  5EMM B;  4GGA A;  4R7A B;  5HYN B;  1U2V C;  2H9M A;  2IUV A;  1N6F A;  4O3T B;  3JRO A;  2IWF A;  5EM2 A;  5IJ8 E;  4L3H D;  3ZWL B;  3UVO A;  2CNX A;  5FKS A;  4D6V A;  3GFC A;  3JZN A;  4JSN C;  4E5Z B;  1TBG A;  5HE0 B;  2I0S A;  1NEX B;  4U1E I;  4A09 B;  5EML B;  1XIP A;  1MG3 A;  2G99 A;  4KFM B;  3DWL C;  4J0X A;  2B4E A;  3ULE C;  3CFS B;  1MG2 A;  3U4Y A;  1ERJ A;  2XU7 A;  3SJL D;  5IGQ A;  2PM6 B;  2I0T A;  4K3J B;  4PSX B;  2OK6 A;  4J0W A;  3RLM D;  3VGZ A;  4ERZ A;  1GOT B;  5K1C C;  3J80 g;  4A08 A;  5EM2 B;  3B7F A;  3KRW B;  1MDA H;  5EAM A;  2I3T A;  3UR4 A;  2B5M A;  5H17 A;  4I79 A;  3SBQ A;  3ORV D;  1QNI A;  3AH8 B;  3SBP A;  3SLE D;  5I5I A;  4UI9 R;  2OVQ B;  1R5M A;  2PBI B;  4J78 A;  2UZY B;  3F3P A;  3L4O D;  5A2Q g;  4CY2 A;  2AGY A;  4ES0 A;  4ZOX A;  3I7H A;  4U7A A;  3SBR A;  4A08 B;  4J73 A;  3RN0 D;  2IWK A;  2I3S A;  3DM0 A;  3EI4 A;  4D0K A;  4E54 A;  4XYI A;  4CY5 A;  1GG2 B;  3NVX A;  3FM0 A;  3PVW B;  1OMW B;  3SMR A;  5TEE A;  1NR0 A;  3OKY A;  4QQE A;  3EWE A;  1GP2 B;  4FA5 D;  5FLX g;  3PXS D;  5FKQ A;  4Y7R A;  3JZG A;  5AMS A;  3L4M D;  1JMX B;  2B5L A;  3PXW D;  3EI1 A;  3SFZ A;  4JT6 C;  4GM3 A;  5FKT A;  4BH6 A;  4FB1 D;  3EI3 A;  2AGZ A;  4PNK B;  3I7P A;  2HXC A;  3OL2 A;  1PGU A;  3OW8 A;  3P4F A;  5SXM A;  5KDO B;  3A0F A;  3RFG A;  3CFV A;  2YBA A;  4GMB A;  3KRX B;  4EWR A;  5I5M A;  4FHL A;  4CI8 A;  5JWZ A;  5H14 A;  4CY3 A;  4E54 B;  3EMH A;  2TRC B;  2UZX B;  4ERY A;  4PC0 A;  4J79 A;  3OKY B;  4J84 A;  3FRX A;  4ESG A;  4PXW A;  2Z2N A;  2P9K C;  5CYK A;  3EI3 B;  2OIZ A;  4L3G D;  2H68 A;  2I0R A;  4MK0 B;  4CZV A;  5TF2 A;  4GQ2 P;  2CN2 A;  3I7L A;  5EAP A;  2AQ5 A;  4QRJ A;  5EAR A;  1Q47 A;  2J55 H;  5FA5 B;  4GM8 A;  4JT5 C;  2YNO A;  4A2L A;  3SHF A;  3SXT D;  4CI1 A;  2HKM A;  4CZY A;  3RRM C;  5IC7 A;  3N0D A;  5GXI A;  3UKR C;  5CYK B;  5IT9 g;  5C9Z B;  2B5N A;  5TDH B;  2J57 G;  5B4W A;  4Z8L A;  5FKR A;  4AOW A;  3FGB A;  2CE9 A;  5HE1 B;  2HJ4 A;  5C2W B;  2CO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...