1VYIA

Structure of the c-terminal domain of the polymerase cofactor of rabies virus: insights in function and evolution.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
WSATNEEDDLSVEAEIAHQIAESFSKKYKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Structure and Function of the C-Terminal Domain of the Polymerase Cofactor of Rabies Virus
pubmed doi rcsb
source organism rabies virus cvs-11
molecule tags Transferase
total genus 39
structure length 111
sequence length 111
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vyiA00
2WZLA 3OA1A 1VYIA
chains in the Genus database with same CATH superfamily
5L0CA 1LE2A 2OEVA 4KI2A 4EBBA 4L6RA 1A7EA 2CCYA 1CPQA 3T6BA 4BJ5A 5KYNA 4JTCB 1NSGB 1EA8A 1NG1A 3TOLA 4OINF 2R02A 4U5EE 3S28A 2A6HF 2QTVA 2W45A 3IEEA 4IJJA 3QTHA 4HE8D 1G4US 1MMNA 3H65A 2ZPAA 2D4UA 2LIGA 2YLIA 4CSAA 3QZCA 4XLNF 3TK0A 2I15A 5KYUA 2R7TA 2VB6A 5B3IA 3MBGA 1L3PA 2Q7RA 3RYLA 2CNWD 2Y3GA 1T6UA 2G62A 3U8PA 4NY3A 4C7OA 2MWQA 3VF0A 1ZHZA 3K1HA 3WG7C 2QLAA 4D4XA 2J9VA 3MYFA 2Q9BA 2ZXPA 2IXMA 3QW0A 3NYJA 1CGOA 4J32B 4JW1A 1ZZPA 3S9OA 4LDQA 4NTFA 3V5XA 1GM5A 2FFHA 1YYXA 5COFA 3US6A 1V74B 3ZG1A 2WB7A 3TJ6A 1E83A 2OJQA 4CIPA 1EI7A 2CDQA 3MX3A 1K05A 4MS2A 1SYQA 1ORYA 2VC9A 3JTLO 3IQ6A 2YLDA 4OIOF 3DE9A 1OXBA 3AGTA 3GEHA 4D4NA 1ORJA 3EG9B 3JRMO 3ASNC 2XL4A 2Q9AA 4MVOA 1Z5ZA 3UMHA 2NSGA 3LS0A 3VM6A 4CS8A 3E9VA 4JIOA 2R7UA 3RIPA 1RKEA 2BE5F 2MYSA 2YEVA 3IQ5A 4A2NB 4CJGA 3EJNA 1N1CA 4FESA 2D5RB 3KKBA 1T6IA 4I3MA 4JC7A 1H7IA 1RJ9B 4JJGA 1LI5A 3QW1A 2R7OA 4GYTA 4I44A 2J9BA 4BJ6C 4WGZA 2YKZA 1E2XA 1U89A 4LACB 3KYIA 4PFOA 1BZ4A 3N24A 1MMDA 4IARA 4E7SA 3SXZA 3ZTZA 4EIYA 2A0BA 4YL0A 3S27A 3AG4C 5L3VA 1QPUA 4PJMA 2ZXWC 1TR2A 2ETSA 2HJ3A 4EUKB 3HKKA 4KNVA 3L8JA 1MQVA 5F5FA 1TWGA 1FAPB 3KH2A 3S84A 3FDQA 1A7VA 3FOOA 1D1AA 4MVQA 1ZHWA 1NU7D 2P61A 4JCHA 2HMZA 3IQCA 4NCQA 1Q0KA 3RW0A 3VYWA 5DVWA 1S7ZA 2H7OA 1H9TA 2VCAA 4JJFA 2KK1A 1VOMA 3HNLA 3B0PA 4IB4A 1BDJB 1LVKA 3ABLC 3KPHA 4MNDA 2J45A 1WOLA 2QE9A 5COGA 2EPMX 3EZIA 2L7AA 3LAYA 3NMJA 3DAGA 1VLTA 1OW7A 2CNWA 3M79A 1LM3B 5DQTA 2YVKA 2XS1A 4EKWA 5KYUB 4OIQF 2FAPB 1KTMA 3L0IA 3AGUA 4P9FA 5HSWA 1H9GA 2XLEA 3LS1A 2EIMC 4AL1A 4C7OB 1Y4CA 2R05A 4G78A 1D1BA 4DOZA 1HMDA 3EGXB 2QY9A 3M4BA 4N4WA 2GDCA 2R7QA 1GS9A 3RFYA 1LKXA 1EKYA 1OQCA 2XLHA 3PCVA 3Q6NA 5JRAA 2GFHA 3QVZA 1APCA 2TMVP 5BQHA 1YZAA 1IW7F 4CS8C 2M4EA 3EG9A 2HSQA 4YL3A 1NLXA 2J0WA 1JRAA 3NKEA 4K1OA 2P0NA 2KNHA 2R25A 4KBLA 2CW0F 3WHNA 3EH2A 3J06A 1ZYRF 2V26A 1BBHA 4XLPF 4PFPA 5B1BC 3EZHA 1SR2A 3JYYA 3U9MA 1RKEB 3I4UA 3ZTMA 5JS5A 3SXMA 5AC4A 5JLIA 3NMKA 2YLGA 4RBNA 3TOMA 2P6VA 4C3EA 2O9XA 2I8BA 4DVZA 1JPNA 1M2VA 2ASRA 3K66A 4GQHA 4MW3A 5FZTA 3NG1A 4IWBA 4CDVA 2YL3A 2J7PD 1J8YF 4F4BA 5JSLA 4YT2A 4MTOA 5BQGA 4EHPA 3AOUA 1TWCA 2L9JA 3UNGC 4E7ZA 1XWJA 2KJGA 2YL1A 3E70C 3HNJA 4DVYP 2AWCA 1TQGA 2Q3TA 5CI9A 4XPWA 1ZU4A 2MHRA 3JRTA 2CGEA 2X51A 4P6IC 3DI5A 4BJ1A 3NYMA 4XEKA 3OA1A 2QNLA 1ZHTA 2J0XA 1OCZC 2W9YA 2YQYA 4NTAA 4W8KA 2UUHA 1A0BA 2Q00A 3ABMC 3FVYA 3LNRA 1WGWA 5E3AA 1BR4A 4EBKA 2WVQA 4R32A 2KYHA 1ZU5A 3AQCA 4OD5A 1YARO 4PACA 5A6JA 5FCLA 1WN0A 3H2VA 1RMVA 5A6BA 4Z9JA 1QVXA 2AU5A 3EHMA 3T6GB 3TQOA 1E86A 1D0XA 4YJWA 1S05A 1HW1A 5DS5A 4XQ1A 1VTMP 4GEHA 3JZ0A 4I1OB 2X0CA 1Q0DA 4IGGA 4YK5A 2DB4A 3K1IA 1HE9A 1OCOC 2H7VC 1W2WA 1LPEA 2DYSC 1NFOA 2L6HA 3W8IA 3POVA 3WODF 3RKOF 3LESA 3EGXA 3HLZA 3OEOA 3U2LA 2C04A 3ZSUA 3I5PA 1TFKB 1A7DA 2R7WA 2NG1A 3RQEA 3T6JA 2OKUA 2YHSA 1O3UA 5E3CA 3U2MA 1SF8A 1QKRA 2GWWA 4LLEA 3SNHA 1NFNA 1C17M 4DBRA 1C03A 1I4YA 1YA7O 4U9EA 2YL7A 3X1OA 2HV6A 1L7CA 4DRHB 256BA 3C62A 2E87A 2RSEB 1Z23A 2XM0A 5DQZA 4BG0A 4BJTA 1F1MA 3O6XA 4XEFA 3CQZA 3U3FA 5BUOA 2R9RB 3CEXA 3MFNA 3OWTA 3DD7A 3M1CB 3T4RA 2KW3C 3O10A 3I5QA 4HFFB 1AEPA 2HKVA 3JCUQ 1OCCC 3GM3A 4U5BE 5TJ5E 4FAPB 4LLCA 4G7HF 3S29A 4EWCA 2QUPA 4DBQA 2JPUA 2JX0A 4K7BA 2XLMA 2XLOA 3ZWIA 4UDVA 1OR3A 3O55A 2PX3A 3B0VC 2GA0A 2NPUA 2B0HA 5JUAA 2R7SA 3C8GD 4P9TA 4KC9A 4AK9A 4U9DA 5JVEA 5KYXB 4YN0B 4DRIB 3DKAA 1Z6AA 1M2VB 1WTYA 3ZQVA 4E18A 2LFFA 1YA9A 2LK4A 4LERA 2YWAA 4BJ5C 1TWAA 4JRZA 1U6HA 4YT5A 4HFKB 2OCCC 3A9CA 2WVOA 1OKKD 2BL2A 2IM8A 4MVZA 1DOWA 4NC3A 3C18A 2ZXRA 4CDYA 2W4MA 2NUPA 4O79A 3JYHA 4O6MA 1MMAA 4U5CE 4MVUA 3NKDA 4BPMA 3UGPA 4B6IA 1BR1A 2C03A 1YJGA 3G4ZA 1JOGA 4CSAC 4JVSA 4YL1A 4EBJA 1VYIA 2EIJC 3LJBA 2Y3BA 1KNYA 1Y6DA 3SP1A 3FXHA 2XM4A 4ULVA 2XXAA 2EPNA 3U0CA 1UFBA 1CGNA 1YZCA 3MYIA 3QVYA 3U5SA 3RVZA 5L0FA 1D1CA 2LSEA 1JAFA 1EQ1A 4CS7A 1RKCA 4JTAB 1FNTc 3NMIA 1DOVA 1HY5A 3AG1C 3SEOA 1ZW2A 2AWYA 1FFHA 3W2VA 4C3BA 5E2QA 5HV9A 3HJCA 2G3VA 1WATA 2OQMA 2LD6A 3BEHA 4N6CA 3RVYA 3ASOC 3GORA 4JKVA 4O6YA 4XPYA 3Q6MA 2Q9CA 2ICWG 4OIRF 2HMQA 2LQGA 3DZAA 4JCZA 3G50A 1M56C 1V4AA 3GM2A 1T01A 1RCPA 2OOCA 2WZLA 4IAQA 1FFTC 3LNMB 3VRCA 3DE8A 2J8WA 4YT4A 4O6NA 1TKNA 2J46A 2DYRC 3DMDA 2NSFA 3GEEA 4HEAJ 2OG2A 2WZGA 4MTGA 2VASA 2XL6A 3RQFA 1AUEA 2HSBA 2KC3A 3CSKA 3V7OA 5KYWA 1M6TA 3C8GA 4J30B 3L8IA 2M64A 1YAUO 3W4YA 1PCXA 5KYXA 1NU9C 5AC5A 3K33A 4CIHA 1O5HA 3JSZA 3LEOA 3DM5A 4M63A 1OXKA 4OD4A 3V5ZA 4DXWA 5B3SC 4G7ZF 4IAOA 3AG2C 3SXYA 4AE4A 1UG7A 1VMAA 4N06A 1PD1A 1OKKA 2A0UA 2KGOA 5A69A 5K0IA 4Q4ZF 2AP3A 1Q0FA 3ZIBA 3CAXA 3GANA 4RD9A 5F5HA 2HFIA 2A68F 4C3DA 2B0JA 1LS1A 2NUPB 4XTKA 3N0TA 1V55C 4Q7CA 5A6KA 2R7VA 2JD3A 3B29A 4Q5SF 2VH3A 1J8MF 1CGME 3EGDA 3EFOA 1H6GA 3B0UX 1Z63A 3T9OA 4U5FE 1Z3IX 3DXJF 4BEMJ 4ZLCA 3B9QA 3WAQA 1AVOB 3K6BA 3R2PA 2HJMA 2L6FA 1FMVA 4DJ9A 2YRFA 3B71A 2XLVA 3L34A 1I5NA 2OJED 1VLSA 4I1MA 2NUTA 4BEJA 5IY5C 2XXAB 3HNIA 1OW6A 4QDLA 1M2OA 4CBEA 3FHDA 1CPRA 3FAJA 5T3WA 4MW8A 3GM1A 1HE1A 1B68A 4XEVA 1KU2A 1LE4A 2EPLX 5DS4A 5L0JA 4ONSA 2PBEA 2PX0A 1MNEA 1OCRC 1NZEA 3QMKA 2L81A 4PK4A 3GWNA 2PNOA 3ZC4A 3HTKC 3FMSA 5JP7A 1YVIA 2EPKX 4JE9A 4NTBA 1YYJA 3R7CA 4K0DA 2OEXA 3DWWA 1Q0GA 1R4TA 1TWHA 3CZ6A 3LUTB 4WABA 1WWPA 2IOQA 4MVSA 5T1DB 3LLKA 3H2UA 4U5DE 4CX9A 1TFOB 3GEIA 4PJJA 2L6GA 2LFDA 2A69F 5F28E 4MTFA 2EILC 3DJNB 5KYYA 2VCCA 2DGJA 1OR2A 3RF3A 2HV7A 1MMGA 3AQBA 5EHHA 3AJMA 4ULWA 1K40A 2RD9A 5KYWB 3C8GB 4YWQA 3DJUB 1ORSC 3KL4A 4IRUA 3RH3A 1U0BB 3ZVRA 4WJ0A 3JSEO 3K7DA 2J7PA 4JEBA 3ABKC 3BRJA 1JPJA 4KNWA 4MQ9F 5L3QA 1ZVZA 1O87A 1ZW3A 1XZPA 2XS8A 3O39A 4G0HA 4AE4B 2G3KA 4XPXA 3EHNA 2HZ8A 3IQTA 2R7RA 3ZQYA 5BQIA 4AL0A 4CS9A 3AG3C 4CDAA 1NBBA 1V54C 1PD0A 2LP4A 2XRHA 3DM9B 4LDRA 4JZAA 5EK0A 2XLDA 3UR3C 3UGOA 2R03A 1SMYF 3LLIA 4N6HA 2XL8A 3SYNA 4AX2A 2HS5A 2IXPA 2F22A 5CI8A 5D91A 1T9KA 1LS4A 3EQLF 1R5ID 3S90A 4OIPF 2HUJA 2OU6A 3VAYA 3PDMP 3U9JA 4MVMA 2YL0A 3EFOB 3EGDB 3GWLA 3K1IC 4PJNA 4Z9IA 1QZXA 2KSFA 3IPMO 1GQAA 2A1DD 1JMWA 2Y39A 2J9UA 3MLGA 3N2ZB 3RQGA 3U3BA 4YT8A 3M15A 1E85A 3C7JA 3U8VA 4PJLA 3GODA 3Q7GA 1VK5A 2VCBA 2NUTB 2J9WA 1GGQA 3TJ5A 1C02A 3F47A 3EPVA 4O7GA 3JT1A 2ZD9A 3KMIA 3A11A 2GAQA 1QQ3A 3DAFA 4LDKA 3ATPA 3S0XA 5L0IA 1VYKA 3C63A 4ER9A 1BR2A 1MNDA 3KYJA 1G8XA 1OW8A 2IBFA 4G7OF 4WGYA 1HMOA 2KQ9A 3ZDLA 4ZLDA 2EINC 2BC5A 2PP4A 5A6BD 2PF4E 1ZHYA 1YLMA 4PR9A 4XWJA 3NRHA 2WVNA 4W8PA 3W8HA 4Z9HA 5GPGB 4A4AA 1A41A 4MVRA 1Z7Qc 4JTDB 4E0IA 3L1MA 2PFDA 2ZXOA 4U5HA 1HW2A 4FWVA 1G5ZA 1M57C 3W2WA 1D0YA 3FOPA 2EIKC 3LEVA 3UMKA 1FR0A 1VB5A 1E84A 3SXKA 1Q0MA 1QSPA 2Q4FA 3F46A 5E33A 5KYYB 1ST6A 1YDIA 2DI3A 2Z15A 3C8ZA 1WASA 4J7TA 3UMIA 2LCHA 5JT4A 4X0RA 5L0HA 2R7XA 5B1AC 2YZSA 3ECSA 2W4BA 1G4WR 4E0HA 5DS6A 4CS9C 3V5YA 5COMA 5AGFA 2IYLD 4H4KC 2IXNA 2Y69C 2XLWA 1RXQA 3FAPB 4RDAA 2IXOA 2WL8A 3IHUA 1D0ZA 2H7BA 3G4XA 3Q7LA 4ANJA 4CJOA 5A6AA 4QI2A 2Y3HA 4JEAA 2XSEA 3X2QC 2FGYA 3SZRA 5CIVA 2AVKA 1IZMA 3HNKA 4QI0A 3EH1A 2A6EF 4J7YA 4JURI 3M4CA 1XZQA 2CYDA 1T5OA 5DLJA 1RJ9A 1SZIA 2H8AA 2WZFA 4U5GA 1FMWA 3NYLA 1LIHA 5L0DA 3PMRA 1PV3A 1ZHXA 2P1AA 1T6QA 3TULA 1I4ZA 1QLEC 1LI7A 5L0GA 2P7VA 5EGYA 5T3TA 2Y3DA 3PHF2 1JR8A 3TD7A 4NQFA 1FTSA 4DRJB 5D92A 2V3CC 4BJ6A 3ITFA 1K04A 2EPOA 4FX5A 2UUIA 4E17A 3NDBB 4H54A
chains in the Genus database with same CATH topology
4KI2A 4EBBA 3T6BA 4BJ5A 5KYNA 1NG1A 4OINF 4U5EE 3S28A 2A6HF 2QTVA 2W45A 3IEEA 4IJJA 4HE8D 1MMNA 3H65A 2ZPAA 4CSAA 3QZCA 4XLNF 5KYUA 2R7TA 2VB6A 3RYLA 2CNWD 2Y3GA 2G62A 4C7OA 4NY3A 2MWQA 1ZHZA 3K1HA 3WG7C 2J9VA 2Q9BA 2ZXPA 2IXMA 4J32B 3NYJA 4JW1A 2FFHA 3ZG1A 2WB7A 2CDQA 3MX3A 4OIOF 3EG9B 3ASNC 2XL4A 2Q9AA 1Z5ZA 3UMHA 3LS0A 4CS8A 3E9VA 2R7UA 3RIPA 2YEVA 2BE5F 2MYSA 4A2NB 3EJNA 1N1CA 4FESA 2D5RB 3KKBA 4I3MA 1RJ9B 4JJGA 4BJ6C 2R7OA 4GYTA 4I44A 4LACB 4PFOA 3N24A 1MMDA 4E7SA 3S27A 3AG4C 5L3VA 4PJMA 2ZXWC 1TR2A 4KNVA 5F5FA 1TWGA 3KH2A 3FDQA 1D1AA 1ZHWA 1NU7D 4JCHA 3VYWA 5DVWA 1S7ZA 2H7OA 4JJFA 1VOMA 3B0PA 1LVKA 3ABLC 4MNDA 2J45A 3EZIA 3LAYA 3DAGA 2CNWA 5DQTA 5KYUB 4OIQF 3L0IA 5HSWA 3LS1A 2EIMC 4C7OB 1D1BA 4DOZA 3EGXB 2QY9A 2R7QA 3RFYA 1LKXA 3Q6NA 2GFHA 1IW7F 4CS8C 2M4EA 3EG9A 2J0WA 3NKEA 2KNHA 4KBLA 2CW0F 3EH2A 1ZYRF 2V26A 4PFPA 5B1BC 3EZHA 3I4UA 4RBNA 4C3EA 2P6VA 2O9XA 2I8BA 1JPNA 1M2VA 3K66A 3NG1A 4IWBA 2J7PD 1J8YF 4F4BA 4YT2A 1TWCA 2L9JA 3UNGC 4E7ZA 2KJGA 3E70C 4DVYP 2Q3TA 5CI9A 4BJ1A 1ZU4A 3JRTA 4XLPF 2CGEA 2X51A 4P6IC 3NYMA 3OA1A 1ZHTA 2J0XA 1OCZC 2W9YA 4W8KA 3FVYA 3ABMC 3LNRA 1WGWA 5E3AA 1BR4A 2WVQA 1ZU5A 3AQCA 4OD5A 5FCLA 3EHMA 1D0XA 4YJWA 5DS5A 4GEHA 4I1OB 1OCOC 2H7VC 1W2WA 2DYSC 3W8IA 3POVA 3WODF 3RKOF 3LESA 3EGXA 3HLZA 3OEOA 2C04A 3ZSUA 3I5PA 2R7WA 2NG1A 3T6JA 2YHSA 5E3CA 1SF8A 4LLEA 3SNHA 4DBRA 3X1OA 2HV6A 2E87A 1Z23A 5DQZA 4BG0A 4BJTA 3O6XA 3CQZA 5BUOA 3OWTA 3DD7A 3M1CB 3T4RA 2KW3C 4HFFB 3I5QA 3JCUQ 4U5BE 1OCCC 4G7HF 4LLCA 3S29A 4EWCA 4DBQA 4K7BA 3B0VC 2PX3A 2R7SA 4KC9A 4AK9A 5KYXB 4YN0B 1Z6AA 1M2VB 4LERA 4BJ5C 1TWAA 4YT5A 4HFKB 2OCCC 2WVOA 1OKKD 2ZXRA 2W4MA 2NUPA 4O79A 3JYHA 4O6MA 1MMAA 4U5CE 3NKDA 3UGPA 4B6IA 1BR1A 2C03A 4CSAC 4JVSA 1VYIA 2EIJC 3LJBA 2Y3BA 3SP1A 2XXAA 1D1CA 2LSEA 4CS7A 3AG1C 3SEOA 1FFHA 3W2VA 4C3BA 5E2QA 3HJCA 2G3VA 3ASOC 4O6YA 3Q6MA 2Q9CA 4OIRF 3DZAA 1M56C 2WZLA 1FFTC 4YT4A 4O6NA 1TKNA 2J46A 2DYRC 3DMDA 4HEAJ 2OG2A 2WZGA 2VASA 3CSKA 3V7OA 5KYWA 4J30B 1PCXA 5KYXA 1NU9C 3K33A 4CIHA 1O5HA 3JSZA 4M63A 3DM5A 4G7ZF 4OD4A 5B3SC 4IAOA 3AG2C 4AE4A 1VMAA 4N06A 1PD1A 1OKKA 2KGOA 4Q4ZF 3ZIBA 3GANA 4RD9A 5F5HA 2A68F 4C3DA 2B0JA 1LS1A 2NUPB 4XTKA 3N0TA 1V55C 4Q7CA 2R7VA 2JD3A 4Q5SF 2VH3A 1J8MF 3EGDA 3EFOA 3B0UX 1Z63A 4U5FE 1Z3IX 3DXJF 4ZLCA 3B9QA 3K6BA 1FMVA 3L34A 4BEJA 4I1MA 5IY5C 2NUTA 2XXAB 4QDLA 1M2OA 4CBEA 3FHDA 3FAJA 5T3WA 1KU2A 5DS4A 2PX0A 1MNEA 1OCRC 1NZEA 3QMKA 2L81A 4PK4A 3ZC4A 3HTKC 4K0DA 1TWHA 3CZ6A 2IOQA 5T1DB 3LLKA 4U5DE 4PJJA 2A69F 2EILC 3DJNB 5KYYA 2DGJA 2HV7A 1MMGA 3AQBA 5EHHA 4ULWA 5KYWB 4YWQA 3DJUB 3KL4A 4IRUA 3RH3A 3ZVRA 4WJ0A 3K7DA 2J7PA 3ABKC 4KNWA 1JPJA 4MQ9F 5L3QA 1O87A 3O39A 4G0HA 4AE4B 2G3KA 3EHNA 2R7RA 4CS9A 3AG3C 1V54C 2XRHA 1PD0A 3DM9B 4JZAA 4DVZA 3UR3C 3UGOA 1SMYF 3LLIA 3SYNA 4AX2A 2IXPA 5CI8A 5D91A 3EQLF 4OIPF 3VAYA 3EGDB 3EFOB 3K1IC 4PJNA 1QZXA 3N2ZB 2A1DD 3MLGA 2Y39A 2J9UA 4YT8A 4PJLA 3GODA 3Q7GA 1VK5A 2NUTB 2J9WA 3F47A 3EPVA 4O7GA 3JT1A 3KMIA 3DAFA 3S0XA 1VYKA 1BR2A 1MNDA 1G8XA 4G7OF 2KQ9A 4ZLDA 2EINC 2PP4A 2PF4E 1ZHYA 4XWJA 3NRHA 2WVNA 3W8HA 2PFDA 2ZXOA 4U5HA 4FWVA 1M57C 3W2WA 1D0YA 2EIKC 3LEVA 3UMKA 3F46A 5E33A 5KYYB 1ST6A 2Z15A 3UMIA 4X0RA 2R7XA 5B1AC 2YZSA 3ECSA 2W4BA 5DS6A 4CS9C 2IYLD 4H4KC 2IXNA 2Y69C 4RDAA 2IXOA 2WL8A 1D0ZA 2H7BA 3Q7LA 4ANJA 4QI2A 2Y3HA 2XSEA 3X2QC 2FGYA 3SZRA 1IZMA 4QI0A 3EH1A 2A6EF 4JURI 5DLJA 1RJ9A 1SZIA 2WZFA 4U5GA 1FMWA 3NYLA 3PMRA 1ZHXA 1QLEC 2P7VA 5EGYA 5T3TA 2Y3DA 3PHF2 3TD7A 2V3CC 1FTSA 5D92A 4BJ6A 3ITFA 4FX5A 3NDBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZL A;  3OA1 A;  1VYI A; 
#chains in the Genus database with same CATH topology
 5L0C A;  1LE2 A;  2OEV A;  4KI2 A;  4EBB A;  4L6R A;  1A7E A;  2CCY A;  1CPQ A;  3T6B A;  4BJ5 A;  5KYN A;  4JTC B;  1NSG B;  1EA8 A;  1NG1 A;  3TOL A;  4OIN F;  2R02 A;  4U5E E;  3S28 A;  2A6H F;  2QTV A;  2W45 A;  3IEE A;  4IJJ A;  3QTH A;  4HE8 D;  1G4U S;  1MMN A;  3H65 A;  2ZPA A;  2D4U A;  2LIG A;  2YLI A;  4CSA A;  3QZC A;  4XLN F;  3TK0 A;  2I15 A;  5KYU A;  2R7T A;  2VB6 A;  5B3I A;  3MBG A;  1L3P A;  2Q7R A;  3RYL A;  2CNW D;  2Y3G A;  1T6U A;  2G62 A;  3U8P A;  4NY3 A;  4C7O A;  2MWQ A;  3VF0 A;  1ZHZ A;  3K1H A;  3WG7 C;  2QLA A;  4D4X A;  2J9V A;  3MYF A;  2Q9B A;  2ZXP A;  2IXM A;  3QW0 A;  3NYJ A;  1CGO A;  4J32 B;  4JW1 A;  1ZZP A;  3S9O A;  4LDQ A;  4NTF A;  3V5X A;  1GM5 A;  2FFH A;  1YYX A;  5COF A;  3US6 A;  1V74 B;  3ZG1 A;  2WB7 A;  3TJ6 A;  1E83 A;  2OJQ A;  4CIP A;  1EI7 A;  2CDQ A;  3MX3 A;  1K05 A;  4MS2 A;  1SYQ A;  1ORY A;  2VC9 A;  3JTL O;  3IQ6 A;  2YLD A;  4OIO F;  3DE9 A;  1OXB A;  3AGT A;  3GEH A;  4D4N A;  1ORJ A;  3EG9 B;  3JRM O;  3ASN C;  2XL4 A;  2Q9A A;  4MVO A;  1Z5Z A;  3UMH A;  2NSG A;  3LS0 A;  3VM6 A;  4CS8 A;  3E9V A;  4JIO A;  2R7U A;  3RIP A;  1RKE A;  2BE5 F;  2MYS A;  2YEV A;  3IQ5 A;  4A2N B;  4CJG A;  3EJN A;  1N1C A;  4FES A;  2D5R B;  3KKB A;  1T6I A;  4I3M A;  4JC7 A;  1H7I A;  1RJ9 B;  4JJG A;  1LI5 A;  3QW1 A;  2R7O A;  4GYT A;  4I44 A;  2J9B A;  4BJ6 C;  4WGZ A;  2YKZ A;  1E2X A;  1U89 A;  4LAC B;  3KYI A;  4PFO A;  1BZ4 A;  3N24 A;  1MMD A;  4IAR A;  4E7S A;  3SXZ A;  3ZTZ A;  4EIY A;  2A0B A;  4YL0 A;  3S27 A;  3AG4 C;  5L3V A;  1QPU A;  4PJM A;  2ZXW C;  1TR2 A;  2ETS A;  2HJ3 A;  4EUK B;  3HKK A;  4KNV A;  3L8J A;  1MQV A;  5F5F A;  1TWG A;  1FAP B;  3KH2 A;  3S84 A;  3FDQ A;  1A7V A;  3FOO A;  1D1A A;  4MVQ A;  1ZHW A;  1NU7 D;  2P61 A;  4JCH A;  2HMZ A;  3IQC A;  4NCQ A;  1Q0K A;  3RW0 A;  3VYW A;  5DVW A;  1S7Z A;  2H7O A;  1H9T A;  2VCA A;  4JJF A;  2KK1 A;  1VOM A;  3HNL A;  3B0P A;  4IB4 A;  1BDJ B;  1LVK A;  3ABL C;  3KPH A;  4MND A;  2J45 A;  1WOL A;  2QE9 A;  5COG A;  2EPM X;  3EZI A;  2L7A A;  3LAY A;  3NMJ A;  3DAG A;  1VLT A;  1OW7 A;  2CNW A;  3M79 A;  1LM3 B;  5DQT A;  2YVK A;  2XS1 A;  4EKW A;  5KYU B;  4OIQ F;  2FAP B;  1KTM A;  3L0I A;  3AGU A;  4P9F A;  5HSW A;  1H9G A;  2XLE A;  3LS1 A;  2EIM C;  4AL1 A;  4C7O B;  1Y4C A;  2R05 A;  4G78 A;  1D1B A;  4DOZ A;  1HMD A;  3EGX B;  2QY9 A;  3M4B A;  4N4W A;  2GDC A;  2R7Q A;  1GS9 A;  3RFY A;  1LKX A;  1EKY A;  1OQC A;  2XLH A;  3PCV A;  3Q6N A;  5JRA A;  2GFH A;  3QVZ A;  1APC A;  2TMV P;  5BQH A;  1YZA A;  1IW7 F;  4CS8 C;  2M4E A;  3EG9 A;  2HSQ A;  4YL3 A;  1NLX A;  2J0W A;  1JRA A;  3NKE A;  4K1O A;  2P0N A;  2KNH A;  2R25 A;  4KBL A;  2CW0 F;  3WHN A;  3EH2 A;  3J06 A;  1ZYR F;  2V26 A;  1BBH A;  4XLP F;  4PFP A;  5B1B C;  3EZH A;  1SR2 A;  3JYY A;  3U9M A;  1RKE B;  3I4U A;  3ZTM A;  5JS5 A;  3SXM A;  5AC4 A;  5JLI A;  3NMK A;  2YLG A;  4RBN A;  3TOM A;  2P6V A;  4C3E A;  2O9X A;  2I8B A;  4DVZ A;  1JPN A;  1M2V A;  2ASR A;  3K66 A;  4GQH A;  4MW3 A;  5FZT A;  3NG1 A;  4IWB A;  4CDV A;  2YL3 A;  2J7P D;  1J8Y F;  4F4B A;  5JSL A;  4YT2 A;  4MTO A;  5BQG A;  4EHP A;  3AOU A;  1TWC A;  2L9J A;  3UNG C;  4E7Z A;  1XWJ A;  2KJG A;  2YL1 A;  3E70 C;  3HNJ A;  4DVY P;  2AWC A;  1TQG A;  2Q3T A;  5CI9 A;  4XPW A;  1ZU4 A;  2MHR A;  3JRT A;  2CGE A;  2X51 A;  4P6I C;  3DI5 A;  4BJ1 A;  3NYM A;  4XEK A;  3OA1 A;  2QNL A;  1ZHT A;  2J0X A;  1OCZ C;  2W9Y A;  2YQY A;  4NTA A;  4W8K A;  2UUH A;  1A0B A;  2Q00 A;  3ABM C;  3FVY A;  3LNR A;  1WGW A;  5E3A A;  1BR4 A;  4EBK A;  2WVQ A;  4R32 A;  2KYH A;  1ZU5 A;  3AQC A;  4OD5 A;  1YAR O;  4PAC A;  5A6J A;  5FCL A;  1WN0 A;  3H2V A;  1RMV A;  5A6B A;  4Z9J A;  1QVX A;  2AU5 A;  3EHM A;  3T6G B;  3TQO A;  1E86 A;  1D0X A;  4YJW A;  1S05 A;  1HW1 A;  5DS5 A;  4XQ1 A;  1VTM P;  4GEH A;  3JZ0 A;  4I1O B;  2X0C A;  1Q0D A;  4IGG A;  4YK5 A;  2DB4 A;  3K1I A;  1HE9 A;  1OCO C;  2H7V C;  1W2W A;  1LPE A;  2DYS C;  1NFO A;  2L6H A;  3W8I A;  3POV A;  3WOD F;  3RKO F;  3LES A;  3EGX A;  3HLZ A;  3OEO A;  3U2L A;  2C04 A;  3ZSU A;  3I5P A;  1TFK B;  1A7D A;  2R7W A;  2NG1 A;  3RQE A;  3T6J A;  2OKU A;  2YHS A;  1O3U A;  5E3C A;  3U2M A;  1SF8 A;  1QKR A;  2GWW A;  4LLE A;  3SNH A;  1NFN A;  1C17 M;  4DBR A;  1C03 A;  1I4Y A;  1YA7 O;  4U9E A;  2YL7 A;  3X1O A;  2HV6 A;  1L7C A;  4DRH B;  256B A;  3C62 A;  2E87 A;  2RSE B;  1Z23 A;  2XM0 A;  5DQZ A;  4BG0 A;  4BJT A;  1F1M A;  3O6X A;  4XEF A;  3CQZ A;  3U3F A;  5BUO A;  2R9R B;  3CEX A;  3MFN A;  3OWT A;  3DD7 A;  3M1C B;  3T4R A;  2KW3 C;  3O10 A;  3I5Q A;  4HFF B;  1AEP A;  2HKV A;  3JCU Q;  1OCC C;  3GM3 A;  4U5B E;  5TJ5 E;  4FAP B;  4LLC A;  4G7H F;  3S29 A;  4EWC A;  2QUP A;  4DBQ A;  2JPU A;  2JX0 A;  4K7B A;  2XLM A;  2XLO A;  3ZWI A;  4UDV A;  1OR3 A;  3O55 A;  2PX3 A;  3B0V C;  2GA0 A;  2NPU A;  2B0H A;  5JUA A;  2R7S A;  3C8G D;  4P9T A;  4KC9 A;  4AK9 A;  4U9D A;  5JVE A;  5KYX B;  4YN0 B;  4DRI B;  3DKA A;  1Z6A A;  1M2V B;  1WTY A;  3ZQV A;  4E18 A;  2LFF A;  1YA9 A;  2LK4 A;  4LER A;  2YWA A;  4BJ5 C;  1TWA A;  4JRZ A;  1U6H A;  4YT5 A;  4HFK B;  2OCC C;  3A9C A;  2WVO A;  1OKK D;  2BL2 A;  2IM8 A;  4MVZ A;  1DOW A;  4NC3 A;  3C18 A;  2ZXR A;  4CDY A;  2W4M A;  2NUP A;  4O79 A;  3JYH A;  4O6M A;  1MMA A;  4U5C E;  4MVU A;  3NKD A;  4BPM A;  3UGP A;  4B6I A;  1BR1 A;  2C03 A;  1YJG A;  3G4Z A;  1JOG A;  4CSA C;  4JVS A;  4YL1 A;  4EBJ A;  1VYI A;  2EIJ C;  3LJB A;  2Y3B A;  1KNY A;  1Y6D A;  3SP1 A;  3FXH A;  2XM4 A;  4ULV A;  2XXA A;  2EPN A;  3U0C A;  1UFB A;  1CGN A;  1YZC A;  3MYI A;  3QVY A;  3U5S A;  3RVZ A;  5L0F A;  1D1C A;  2LSE A;  1JAF A;  1EQ1 A;  4CS7 A;  1RKC A;  4JTA B;  1FNT c;  3NMI A;  1DOV A;  1HY5 A;  3AG1 C;  3SEO A;  1ZW2 A;  2AWY A;  1FFH A;  3W2V A;  4C3B A;  5E2Q A;  5HV9 A;  3HJC A;  2G3V A;  1WAT A;  2OQM A;  2LD6 A;  3BEH A;  4N6C A;  3RVY A;  3ASO C;  3GOR A;  4JKV A;  4O6Y A;  4XPY A;  3Q6M A;  2Q9C A;  2ICW G;  4OIR F;  2HMQ A;  2LQG A;  3DZA A;  4JCZ A;  3G50 A;  1M56 C;  1V4A A;  3GM2 A;  1T01 A;  1RCP A;  2OOC A;  2WZL A;  4IAQ A;  1FFT C;  3LNM B;  3VRC A;  3DE8 A;  2J8W A;  4YT4 A;  4O6N A;  1TKN A;  2J46 A;  2DYR C;  3DMD A;  2NSF A;  3GEE A;  4HEA J;  2OG2 A;  2WZG A;  4MTG A;  2VAS A;  2XL6 A;  3RQF A;  1AUE A;  2HSB A;  2KC3 A;  3CSK A;  3V7O A;  5KYW A;  1M6T A;  3C8G A;  4J30 B;  3L8I A;  2M64 A;  1YAU O;  3W4Y A;  1PCX A;  5KYX A;  1NU9 C;  5AC5 A;  3K33 A;  4CIH A;  1O5H A;  3JSZ A;  3LEO A;  3DM5 A;  4M63 A;  1OXK A;  4OD4 A;  3V5Z A;  4DXW A;  5B3S C;  4G7Z F;  4IAO A;  3AG2 C;  3SXY A;  4AE4 A;  1UG7 A;  1VMA A;  4N06 A;  1PD1 A;  1OKK A;  2A0U A;  2KGO A;  5A69 A;  5K0I A;  4Q4Z F;  2AP3 A;  1Q0F A;  3ZIB A;  3CAX A;  3GAN A;  4RD9 A;  5F5H A;  2HFI A;  2A68 F;  4C3D A;  2B0J A;  1LS1 A;  2NUP B;  4XTK A;  3N0T A;  1V55 C;  4Q7C A;  5A6K A;  2R7V A;  2JD3 A;  3B29 A;  4Q5S F;  2VH3 A;  1J8M F;  1CGM E;  3EGD A;  3EFO A;  1H6G A;  3B0U X;  1Z63 A;  3T9O A;  4U5F E;  1Z3I X;  3DXJ F;  4BEM J;  4ZLC A;  3B9Q A;  3WAQ A;  1AVO B;  3K6B A;  3R2P A;  2HJM A;  2L6F A;  1FMV A;  4DJ9 A;  2YRF A;  3B71 A;  2XLV A;  3L34 A;  1I5N A;  2OJE D;  1VLS A;  4I1M A;  2NUT A;  4BEJ A;  5IY5 C;  2XXA B;  3HNI A;  1OW6 A;  4QDL A;  1M2O A;  4CBE A;  3FHD A;  1CPR A;  3FAJ A;  5T3W A;  4MW8 A;  3GM1 A;  1HE1 A;  1B68 A;  4XEV A;  1KU2 A;  1LE4 A;  2EPL X;  5DS4 A;  5L0J A;  4ONS A;  2PBE A;  2PX0 A;  1MNE A;  1OCR C;  1NZE A;  3QMK A;  2L81 A;  4PK4 A;  3GWN A;  2PNO A;  3ZC4 A;  3HTK C;  3FMS A;  5JP7 A;  1YVI A;  2EPK X;  4JE9 A;  4NTB A;  1YYJ A;  3R7C A;  4K0D A;  2OEX A;  3DWW A;  1Q0G A;  1R4T A;  1TWH A;  3CZ6 A;  3LUT B;  4WAB A;  1WWP A;  2IOQ A;  4MVS A;  5T1D B;  3LLK A;  3H2U A;  4U5D E;  4CX9 A;  1TFO B;  3GEI A;  4PJJ A;  2L6G A;  2LFD A;  2A69 F;  5F28 E;  4MTF A;  2EIL C;  3DJN B;  5KYY A;  2VCC A;  2DGJ A;  1OR2 A;  3RF3 A;  2HV7 A;  1MMG A;  3AQB A;  5EHH A;  3AJM A;  4ULW A;  1K40 A;  2RD9 A;  5KYW B;  3C8G B;  4YWQ A;  3DJU B;  1ORS C;  3KL4 A;  4IRU A;  3RH3 A;  1U0B B;  3ZVR A;  4WJ0 A;  3JSE O;  3K7D A;  2J7P A;  4JEB A;  3ABK C;  3BRJ A;  1JPJ A;  4KNW A;  4MQ9 F;  5L3Q A;  1ZVZ A;  1O87 A;  1ZW3 A;  1XZP A;  2XS8 A;  3O39 A;  4G0H A;  4AE4 B;  2G3K A;  4XPX A;  3EHN A;  2HZ8 A;  3IQT A;  2R7R A;  3ZQY A;  5BQI A;  4AL0 A;  4CS9 A;  3AG3 C;  4CDA A;  1NBB A;  1V54 C;  1PD0 A;  2LP4 A;  2XRH A;  3DM9 B;  4LDR A;  4JZA A;  5EK0 A;  2XLD A;  3UR3 C;  3UGO A;  2R03 A;  1SMY F;  3LLI A;  4N6H A;  2XL8 A;  3SYN A;  4AX2 A;  2HS5 A;  2IXP A;  2F22 A;  5CI8 A;  5D91 A;  1T9K A;  1LS4 A;  3EQL F;  1R5I D;  3S90 A;  4OIP F;  2HUJ A;  2OU6 A;  3VAY A;  3PDM P;  3U9J A;  4MVM A;  2YL0 A;  3EFO B;  3EGD B;  3GWL A;  3K1I C;  4PJN A;  4Z9I A;  1QZX A;  2KSF A;  3IPM O;  1GQA A;  2A1D D;  1JMW A;  2Y39 A;  2J9U A;  3MLG A;  3N2Z B;  3RQG A;  3U3B A;  4YT8 A;  3M15 A;  1E85 A;  3C7J A;  3U8V A;  4PJL A;  3GOD A;  3Q7G A;  1VK5 A;  2VCB A;  2NUT B;  2J9W A;  1GGQ A;  3TJ5 A;  1C02 A;  3F47 A;  3EPV A;  4O7G A;  3JT1 A;  2ZD9 A;  3KMI A;  3A11 A;  2GAQ A;  1QQ3 A;  3DAF A;  4LDK A;  3ATP A;  3S0X A;  5L0I A;  1VYK A;  3C63 A;  4ER9 A;  1BR2 A;  1MND A;  3KYJ A;  1G8X A;  1OW8 A;  2IBF A;  4G7O F;  4WGY A;  1HMO A;  2KQ9 A;  3ZDL A;  4ZLD A;  2EIN C;  2BC5 A;  2PP4 A;  5A6B D;  2PF4 E;  1ZHY A;  1YLM A;  4PR9 A;  4XWJ A;  3NRH A;  2WVN A;  4W8P A;  3W8H A;  4Z9H A;  5GPG B;  4A4A A;  1A41 A;  4MVR A;  1Z7Q c;  4JTD B;  4E0I A;  3L1M A;  2PFD A;  2ZXO A;  4U5H A;  1HW2 A;  4FWV A;  1G5Z A;  1M57 C;  3W2W A;  1D0Y A;  3FOP A;  2EIK C;  3LEV A;  3UMK A;  1FR0 A;  1VB5 A;  1E84 A;  3SXK A;  1Q0M A;  1QSP A;  2Q4F A;  3F46 A;  5E33 A;  5KYY B;  1ST6 A;  1YDI A;  2DI3 A;  2Z15 A;  3C8Z A;  1WAS A;  4J7T A;  3UMI A;  2LCH A;  5JT4 A;  4X0R A;  5L0H A;  2R7X A;  5B1A C;  2YZS A;  3ECS A;  2W4B A;  1G4W R;  4E0H A;  5DS6 A;  4CS9 C;  3V5Y A;  5COM A;  5AGF A;  2IYL D;  4H4K C;  2IXN A;  2Y69 C;  2XLW A;  1RXQ A;  3FAP B;  4RDA A;  2IXO A;  2WL8 A;  3IHU A;  1D0Z A;  2H7B A;  3G4X A;  3Q7L A;  4ANJ A;  4CJO A;  5A6A A;  4QI2 A;  2Y3H A;  4JEA A;  2XSE A;  3X2Q C;  2FGY A;  3SZR A;  5CIV A;  2AVK A;  1IZM A;  3HNK A;  4QI0 A;  3EH1 A;  2A6E F;  4J7Y A;  4JUR I;  3M4C A;  1XZQ A;  2CYD A;  1T5O A;  5DLJ A;  1RJ9 A;  1SZI A;  2H8A A;  2WZF A;  4U5G A;  1FMW A;  3NYL A;  1LIH A;  5L0D A;  3PMR A;  1PV3 A;  1ZHX A;  2P1A A;  1T6Q A;  3TUL A;  1I4Z A;  1QLE C;  1LI7 A;  5L0G A;  2P7V A;  5EGY A;  5T3T A;  2Y3D A;  3PHF 2;  1JR8 A;  3TD7 A;  4NQF A;  1FTS A;  4DRJ B;  5D92 A;  2V3C C;  4BJ6 A;  3ITF A;  1K04 A;  2EPO A;  4FX5 A;  2UUI A;  4E17 A;  3NDB B;  4H54 A; 
#chains in the Genus database with same CATH homology
 4KI2 A;  4EBB A;  3T6B A;  4BJ5 A;  5KYN A;  1NG1 A;  4OIN F;  4U5E E;  3S28 A;  2A6H F;  2QTV A;  2W45 A;  3IEE A;  4IJJ A;  4HE8 D;  1MMN A;  3H65 A;  2ZPA A;  4CSA A;  3QZC A;  4XLN F;  5KYU A;  2R7T A;  2VB6 A;  3RYL A;  2CNW D;  2Y3G A;  2G62 A;  4C7O A;  4NY3 A;  2MWQ A;  1ZHZ A;  3K1H A;  3WG7 C;  2J9V A;  2Q9B A;  2ZXP A;  2IXM A;  4J32 B;  3NYJ A;  4JW1 A;  2FFH A;  3ZG1 A;  2WB7 A;  2CDQ A;  3MX3 A;  4OIO F;  3EG9 B;  3ASN C;  2XL4 A;  2Q9A A;  1Z5Z A;  3UMH A;  3LS0 A;  4CS8 A;  3E9V A;  2R7U A;  3RIP A;  2YEV A;  2BE5 F;  2MYS A;  4A2N B;  3EJN A;  1N1C A;  4FES A;  2D5R B;  3KKB A;  4I3M A;  1RJ9 B;  4JJG A;  4BJ6 C;  2R7O A;  4GYT A;  4I44 A;  4LAC B;  4PFO A;  3N24 A;  1MMD A;  4E7S A;  3S27 A;  3AG4 C;  5L3V A;  4PJM A;  2ZXW C;  1TR2 A;  4KNV A;  5F5F A;  1TWG A;  3KH2 A;  3FDQ A;  1D1A A;  1ZHW A;  1NU7 D;  4JCH A;  3VYW A;  5DVW A;  1S7Z A;  2H7O A;  4JJF A;  1VOM A;  3B0P A;  1LVK A;  3ABL C;  4MND A;  2J45 A;  3EZI A;  3LAY A;  3DAG A;  2CNW A;  5DQT A;  5KYU B;  4OIQ F;  3L0I A;  5HSW A;  3LS1 A;  2EIM C;  4C7O B;  1D1B A;  4DOZ A;  3EGX B;  2QY9 A;  2R7Q A;  3RFY A;  1LKX A;  3Q6N A;  2GFH A;  1IW7 F;  4CS8 C;  2M4E A;  3EG9 A;  2J0W A;  3NKE A;  2KNH A;  4KBL A;  2CW0 F;  3EH2 A;  1ZYR F;  2V26 A;  4PFP A;  5B1B C;  3EZH A;  3I4U A;  4RBN A;  4C3E A;  2P6V A;  2O9X A;  2I8B A;  1JPN A;  1M2V A;  3K66 A;  3NG1 A;  4IWB A;  2J7P D;  1J8Y F;  4F4B A;  4YT2 A;  1TWC A;  2L9J A;  3UNG C;  4E7Z A;  2KJG A;  3E70 C;  4DVY P;  2Q3T A;  5CI9 A;  4BJ1 A;  1ZU4 A;  3JRT A;  4XLP F;  2CGE A;  2X51 A;  4P6I C;  3NYM A;  3OA1 A;  1ZHT A;  2J0X A;  1OCZ C;  2W9Y A;  4W8K A;  3FVY A;  3ABM C;  3LNR A;  1WGW A;  5E3A A;  1BR4 A;  2WVQ A;  1ZU5 A;  3AQC A;  4OD5 A;  5FCL A;  3EHM A;  1D0X A;  4YJW A;  5DS5 A;  4GEH A;  4I1O B;  1OCO C;  2H7V C;  1W2W A;  2DYS C;  3W8I A;  3POV A;  3WOD F;  3RKO F;  3LES A;  3EGX A;  3HLZ A;  3OEO A;  2C04 A;  3ZSU A;  3I5P A;  2R7W A;  2NG1 A;  3T6J A;  2YHS A;  5E3C A;  1SF8 A;  4LLE A;  3SNH A;  4DBR A;  3X1O A;  2HV6 A;  2E87 A;  1Z23 A;  5DQZ A;  4BG0 A;  4BJT A;  3O6X A;  3CQZ A;  5BUO A;  3OWT A;  3DD7 A;  3M1C B;  3T4R A;  2KW3 C;  4HFF B;  3I5Q A;  3JCU Q;  4U5B E;  1OCC C;  4G7H F;  4LLC A;  3S29 A;  4EWC A;  4DBQ A;  4K7B A;  3B0V C;  2PX3 A;  2R7S A;  4KC9 A;  4AK9 A;  5KYX B;  4YN0 B;  1Z6A A;  1M2V B;  4LER A;  4BJ5 C;  1TWA A;  4YT5 A;  4HFK B;  2OCC C;  2WVO A;  1OKK D;  2ZXR A;  2W4M A;  2NUP A;  4O79 A;  3JYH A;  4O6M A;  1MMA A;  4U5C E;  3NKD A;  3UGP A;  4B6I A;  1BR1 A;  2C03 A;  4CSA C;  4JVS A;  1VYI A;  2EIJ C;  3LJB A;  2Y3B A;  3SP1 A;  2XXA A;  1D1C A;  2LSE A;  4CS7 A;  3AG1 C;  3SEO A;  1FFH A;  3W2V A;  4C3B A;  5E2Q A;  3HJC A;  2G3V A;  3ASO C;  4O6Y A;  3Q6M A;  2Q9C A;  4OIR F;  3DZA A;  1M56 C;  2WZL A;  1FFT C;  4YT4 A;  4O6N A;  1TKN A;  2J46 A;  2DYR C;  3DMD A;  4HEA J;  2OG2 A;  2WZG A;  2VAS A;  3CSK A;  3V7O A;  5KYW A;  4J30 B;  1PCX A;  5KYX A;  1NU9 C;  3K33 A;  4CIH A;  1O5H A;  3JSZ A;  4M63 A;  3DM5 A;  4G7Z F;  4OD4 A;  5B3S C;  4IAO A;  3AG2 C;  4AE4 A;  1VMA A;  4N06 A;  1PD1 A;  1OKK A;  2KGO A;  4Q4Z F;  3ZIB A;  3GAN A;  4RD9 A;  5F5H A;  2A68 F;  4C3D A;  2B0J A;  1LS1 A;  2NUP B;  4XTK A;  3N0T A;  1V55 C;  4Q7C A;  2R7V A;  2JD3 A;  4Q5S F;  2VH3 A;  1J8M F;  3EGD A;  3EFO A;  3B0U X;  1Z63 A;  4U5F E;  1Z3I X;  3DXJ F;  4ZLC A;  3B9Q A;  3K6B A;  1FMV A;  3L34 A;  4BEJ A;  4I1M A;  5IY5 C;  2NUT A;  2XXA B;  4QDL A;  1M2O A;  4CBE A;  3FHD A;  3FAJ A;  5T3W A;  1KU2 A;  5DS4 A;  2PX0 A;  1MNE A;  1OCR C;  1NZE A;  3QMK A;  2L81 A;  4PK4 A;  3ZC4 A;  3HTK C;  4K0D A;  1TWH A;  3CZ6 A;  2IOQ A;  5T1D B;  3LLK A;  4U5D E;  4PJJ A;  2A69 F;  2EIL C;  3DJN B;  5KYY A;  2DGJ A;  2HV7 A;  1MMG A;  3AQB A;  5EHH A;  4ULW A;  5KYW B;  4YWQ A;  3DJU B;  3KL4 A;  4IRU A;  3RH3 A;  3ZVR A;  4WJ0 A;  3K7D A;  2J7P A;  3ABK C;  4KNW A;  1JPJ A;  4MQ9 F;  5L3Q A;  1O87 A;  3O39 A;  4G0H A;  4AE4 B;  2G3K A;  3EHN A;  2R7R A;  4CS9 A;  3AG3 C;  1V54 C;  2XRH A;  1PD0 A;  3DM9 B;  4JZA A;  4DVZ A;  3UR3 C;  3UGO A;  1SMY F;  3LLI A;  3SYN A;  4AX2 A;  2IXP A;  5CI8 A;  5D91 A;  3EQL F;  4OIP F;  3VAY A;  3EGD B;  3EFO B;  3K1I C;  4PJN A;  1QZX A;  3N2Z B;  2A1D D;  3MLG A;  2Y39 A;  2J9U A;  4YT8 A;  4PJL A;  3GOD A;  3Q7G A;  1VK5 A;  2NUT B;  2J9W A;  3F47 A;  3EPV A;  4O7G A;  3JT1 A;  3KMI A;  3DAF A;  3S0X A;  1VYK A;  1BR2 A;  1MND A;  1G8X A;  4G7O F;  2KQ9 A;  4ZLD A;  2EIN C;  2PP4 A;  2PF4 E;  1ZHY A;  4XWJ A;  3NRH A;  2WVN A;  3W8H A;  2PFD A;  2ZXO A;  4U5H A;  4FWV A;  1M57 C;  3W2W A;  1D0Y A;  2EIK C;  3LEV A;  3UMK A;  3F46 A;  5E33 A;  5KYY B;  1ST6 A;  2Z15 A;  3UMI A;  4X0R A;  2R7X A;  5B1A C;  2YZS A;  3ECS A;  2W4B A;  5DS6 A;  4CS9 C;  2IYL D;  4H4K C;  2IXN A;  2Y69 C;  4RDA A;  2IXO A;  2WL8 A;  1D0Z A;  2H7B A;  3Q7L A;  4ANJ A;  4QI2 A;  2Y3H A;  2XSE A;  3X2Q C;  2FGY A;  3SZR A;  1IZM A;  4QI0 A;  3EH1 A;  2A6E F;  4JUR I;  5DLJ A;  1RJ9 A;  1SZI A;  2WZF A;  4U5G A;  1FMW A;  3NYL A;  3PMR A;  1ZHX A;  1QLE C;  2P7V A;  5EGY A;  5T3T A;  2Y3D A;  3PHF 2;  3TD7 A;  2V3C C;  1FTS A;  5D92 A;  4BJ6 A;  3ITF A;  4FX5 A;  3NDB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...