1VYIA

Structure of the c-terminal domain of the polymerase cofactor of rabies virus: insights in function and evolution.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
WSATNEEDDLSVEAEIAHQIAESFSKKYKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Structure and Function of the C-Terminal Domain of the Polymerase Cofactor of Rabies Virus
pubmed doi rcsb
source organism rabies virus cvs-11
molecule tags Transferase
total genus 39
structure length 111
sequence length 111
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vyiA00
1VYIA 2WZLA 3OA1A
chains in the Genus database with same CATH superfamily
1GS9A 3PMRA 4LACB 1OKKD 4JKVA 1PV3A 2QUPA 3JRTA 4MVRA 4W8KA 2PFDA 4IGGA 4BJ6C 1WN0A 3POVA 4LDKA 2KYHA 1JAFA 1I4YA 1NFNA 1TWGA 2AU5A 4JE9A 3T6BA 4OIRF 3TQOA 2XRHA 4EBKA 2QTVA 2W4BA 4AE4B 2WVQA 3G4ZA 2VC9A 3RYLA 4WGZA 4JEBA 1A7DA 1FFHA 3CAXA 2C04A 4P6IC 4YT4A 4E7ZA 3ABLC 3MBGA 4I44A 1UFBA 3FMSA 2Q7RA 2W4MA 5JT4A 3AOUA 3RW0A 3DM5A 2HJMA 1JOGA 5COFA 4O7GA 3H2VA 3IQ5A 2YEVA 5E2QA 3S29A 4CSAC 2ZXOA 2LFFA 4XLNF 1VB5A 4JC7A 2WZLA 2R7WA 1Z6AA 4D4XA 5HSWA 1NBBA 3IQTA 1QQ3A 2A6HF 1Z5ZA 2G62A 1PD1A 3LLKA 3O10A 4NTFA 3ZWIA 3DI5A 1BZ4A 2P0NA 3C8GD 2J8WA 4O6YA 1FMWA 5B3SC 1S7ZA 2NUTB 2HMQA 4EBBA 1V74B 3G4XA 1ZHZA 2LP4A 1AEPA 1DOWA 4NTAA 2WL8A 4KNVA 3BEHA 2TMVP 5F28E 4LERA 5AC4A 1IZMA 3IEEA 1YVIA 4ULVA 4MTFA 4YL3A 3HLZA 3GM2A 3ZIBA 5BQHA 5L0DA 3S9OA 3PHF2 3KPHA 2KW3C 5BQGA 1BR2A 1Q0GA 2NPUA 3ZQVA 3U5SA 2X0CA 2HV6A 4JZAA 1RCPA 4HEAJ 2AWCA 1PCXA 5KYWB 1G8XA 2EIKC 2R25A 4MVUA 4OIOF 1VLSA 2EPKX 2IM8A 2LCHA 3EHNA 1FTSA 1XZQA 2A0UA 1V4AA 4G7ZF 4IARA 2VH3A 3W8HA 1AUEA 2DI3A 2VCAA 4MVMA 4P9FA 1OCRC 3SXZA 3SEOA 2HJ3A 2XLEA 5KYYA 3I5QA 5DQTA 1BR1A 4N6HA 1OW8A 2LK4A 2Q3TA 5F5FA 1K40A 4E17A 1RXQA 3K66A 4E0HA 1LE2A 4MQ9F 1OCCC 1JPJA 4RD9A 4AE4A 1E83A 1OQCA 2J7PA 5JRAA 3JYHA 5DS6A 4QI0A 3V5ZA 4O6MA 2R7TA 4IAQA 3GM3A 2D4UA 1J8MF 2R05A 3AGTA 3AG2C 5COGA 5L0CA 4CDAA 1I4ZA 3N24A 2EPOA 2R7OA 4CIPA 3NRHA 3AG3C 4JTAB 3NMKA 1YJGA 4PACA 5JP7A 4PJJA 3V5YA 4XQ1A 3OWTA 1YYJA 1ORSC 2NSFA 3M79A 4K0DA 5F5HA 4KI2A 4XWJA 3OA1A 3Q7LA 2P61A 2HMZA 5FZTA 4OD4A 3X2QC 1OR2A 2HV7A 4ZLCA 1CGME 2NUTA 4U5BE 1QZXA 3H65A 5CIVA 3NYJA 3C8GB 2FAPB 2HS5A 3JSZA 1XWJA 4U5EE 2J0XA 2OU6A 3E70C 2KSFA 3A9CA 1CGNA 2KC3A 2J9VA 3CSKA 3LEOA 1AVOB 5EGYA 1OW7A 5DLJA 3LS1A 4G7HF 4CS7A 2EINC 1NSGB 1ZZPA 4EHPA 2JD3A 4NC3A 3LEVA 3RIPA 1NU7D 4PFPA 4CJOA 3S27A 4YK5A 2Q4FA 5KYXB 1ORJA 3IQCA 1V55C 2HSBA 5DS4A 1YA9A 5KYWA 1B68A 1JRAA 3RH3A 2Q9CA 2Q00A 2G3VA 4N6CA 4CS9A 5A6BD 1GQAA 1JR8A 1MMNA 3LS0A 1FAPB 3GWLA 4M63A 5CI9A 3SXMA 4HFFB 2O9XA 2CYDA 2V26A 1M2VB 3W2VA 5K0IA 4WJ0A 1LI5A 4JRZA 3TOMA 2YL7A 2LD6A 3NMIA 3QW1A 5EHHA 4FX5A 2HSQA 2L81A 4KBLA 3U9JA 1K04A 4DRIB 3ITFA 1CPRA 1TQGA 4G0HA 2L9JA 3LLIA 3JRMO 4XTKA 3VRCA 2P1AA 3KKBA 4CDYA 1J8YF 1O87A 1OKKA 1EI7A 1H9TA 4OD5A 2R7UA 3SP1A 4K7BA 4LLCA 2QLAA 1SYQA 4CDVA 2WZGA 2M4EA 3B29A 3KMIA 2Z15A 1T6UA 2DYSC 1MMDA 3K1HA 4J7YA 3RFYA 1VMAA 2H7OA 2R02A 2B0HA 2R03A 1HW1A 3R2PA 2HZ8A 5A6KA 1CGOA 4YT8A 1SF8A 4DVZA 3HNLA 3RF3A 4Q5SF 4BEMJ 3DZAA 2KJGA 4PR9A 1A0BA 1U89A 2WZFA 2YZSA 4XEVA 1WASA 1OXBA 4H54A 4P9TA 2MHRA 3E9VA 5TJ5E 2PF4E 4DRHB 2ZPAA 3S90A 3FXHA 4LLEA 3SXYA 4AK9A 1C17M 3JT1A 3W4YA 3DE8A 2OQMA 4C3EA 1M57C 2ICWG 4U5DE 2AVKA 1N1CA 4Q7CA 4MVQA 3ATPA 2Y3HA 3PDMP 3B0VC 4I1OB 4HFKB 3C8GA 4E7SA 3K7DA 3U9MA 4U5CE 3EZHA 1DOVA 1ZYRF 4MTOA 1WATA 2XLMA 2HUJA 2XXAB 1LM3B 4U9DA 2OEVA 256BA 2Q9AA 3ZC4A 5L3VA 3GANA 3H2UA 4IB4A 3TK0A 2IXNA 4UDVA 1Y4CA 1ZW3A 3DMDA 4BEJA 2HFIA 4C3BA 3C18A 2J9WA 4MVOA 3FOOA 5KYXA 3ECSA 4CS8A 1H9GA 2NSGA 5D91A 1M6TA 1TFOB 4K1OA 2IXOA 3ABKC 2XSEA 2YKZA 3TOLA 3FVYA 4PK4A 2L6HA 4JVSA 2GAQA 1XZPA 2L6FA 3NYLA 2EPMX 4MW3A 4JW1A 2L6GA 3KYIA 1YLMA 1HE1A 1LKXA 3DD7A 4N4WA 5BQIA 1M2VA 1E85A 1TFKB 3EGDB 4DBRA 1TWHA 2I8BA 4ZLDA 4XPWA 4RBNA 1LIHA 3JYYA 4E0IA 2VASA 3L0IA 4ONSA 3ZVRA 3C7JA 2C03A 1RJ9B 3B9QA 4G78A 4I3MA 4ER9A 2A6EF 2PX0A 1L3PA 3O39A 1NU9C 3PCVA 5E33A 1Z63A 1GGQA 1QKRA 3FDQA 5KYUB 4YT2A 3EQLF 2W9YA 2QNLA 3DWWA 2OKUA 2J9BA 5AC5A 3AG4C 3U3FA 1D0ZA 1E86A 1S05A 4JTCB 1D0XA 1HY5A 1FNTc 1VTMP 1YYXA 2F22A 2XS1A 1RKEB 4JURI 5A6AA 2GDCA 2A0BA 4KC9A 5GPGB 1YA7O 2CNWD 2IXPA 3GEHA 4U5HA 2XLHA 3ZG1A 4ANJA 4PJNA 2EPNA 3L34A 4PJLA 4BJ5A 1D0YA 1CPQA 4CS9C 3UNGC 2ZD9A 2QY9A 1EKYA 1VYKA 2WB7A 4DOZA 2R7VA 4RDAA 1MNEA 2OOCA 3QMKA 3S28A 2AP3A 2ETSA 1U0BB 3AJMA 2VCBA 3DE9A 4Z9JA 3UMHA 4QI2A 2XM4A 1I5NA 2ZXRA 4MNDA 3VAYA 3EPVA 1BDJB 1FFTC 1E2XA 4FESA 4XEKA 3EG9B 2LIGA 4CBEA 5CI8A 2Y69C 1Y6DA 2XL8A 4Q4ZF 3ASOC 3DXJF 3QTHA 2XXAA 3HJCA 1HMDA 3LNMB 3GEEA 3MYIA 4JEAA 3W8IA 2D5RB 3BRJA 1Q0FA 4I1MA 5DQZA 1ORYA 1OXKA 2A1DD 2IXMA 1T6IA 2PNOA 3EZIA 2H8AA 3KYJA 1FMVA 3N0TA 4YL0A 1PD0A 1Q0KA 5B1AC 2YL3A 1TWAA 3U0CA 4PJMA 3FHDA 3V5XA 2UUIA 2P6VA 1OCOC 2R7RA 1V54C 4J7TA 2YVKA 3TD7A 2YLDA 3A11A 3G50A 4JTDB 2OG2A 4KNWA 1T9KA 1YARO 2JX0A 3HNIA 4MVSA 3NDBB 4AL0A 3QZCA 3LJBA 3VM6A 3RQFA 4JJGA 5JS5A 1SR2A 2YLIA 3F47A 3M4CA 1JPNA 3NYMA 5FCLA 1YDIA 3EGDA 4DXWA 5A6BA 3JTLO 1BR4A 2OJED 1WWPA 1W2WA 3K6BA 1TR2A 3L8IA 2M64A 2VB6A 3RQGA 1Z7Qc 4C7OB 3QW0A 1R5ID 1RJ9A 2CDQA 3N2ZB 1MNDA 3X1OA 3TJ6A 1YZCA 1IW7F 1VK5A 3DKAA 3LNRA 1BBHA 3T6JA 5L0IA 1D1CA 1Z3IX 2XS8A 2H7BA 5KYUA 2J45A 4OIQF 2XL6A 3V7OA 4EWCA 5COMA 2IBFA 1T01A 3EH1A 4CX9A 4DBQA 2VCCA 2LSEA 2XLOA 3L1MA 5L0HA 3JCUQ 4YN0B 4YT5A 3IPMO 3RVYA 3K1IA 4J30B 1RKEA 3AG1C 1MQVA 3DJNB 3T6GB 4CS8C 3U8PA 2Y3BA 2KQ9A 2YWAA 3SYNA 2ASRA 4L6RA 3C62A 3US6A 5L0FA 2I15A 1JMWA 1VYIA 1ZU5A 5B3IA 4MW8A 4NTBA 1G4US 1NG1A 2KK1A 3GEIA 1QSPA 3GODA 4LDQA 4DRJB 1UG7A 4PFOA 3KL4A 2MYSA 5BUOA 1NFOA 1WOLA 1LPEA 4JJFA 1LVKA 2EPLX 4NCQA 4XLPF 4EUKB 4IRUA 2FGYA 2Q9BA 1LS1A 4FAPB 4BPMA 3EG9A 3RVZA 2OCCC 3AGUA 3FAPB 3SNHA 3EHMA 4BG0A 4EIYA 2PBEA 3GM1A 4FWVA 1G4WR 4U9EA 2DB4A 3LESA 3WAQA 3AQCA 4WGYA 5EK0A 4JCHA 3I4UA 4AX2A 1SMYF 3VYWA 2E87A 2B0JA 2X51A 1ZHXA 3RKOF 3ZTZA 2IOQA 3U2LA 4GEHA 1GM5A 4G7OF 1Q0DA 5L0GA 2NG1A 2J0WA 1HMOA 4BJ5C 3TULA 4IJJA 3S84A 1KU2A 5E3AA 2Y3GA 3FOPA 4JIOA 1VOMA 1NLXA 1KNYA 1RKCA 3JZ0A 2P7VA 2EIMC 2XM0A 4U5FE 3T9OA 1OW6A 3S0XA 1APCA 4C7OA 4R32A 1TKNA 3KH2A 3B0UX 3MYFA 1YAUO 1LI7A 3Q6NA 4IAOA 4U5GA 3TJ5A 2XLDA 1TWCA 1ST6A 5HV9A 1ZW2A 1NZEA 4BJ6A 3J06A 4Z9HA 2NUPB 4BJTA 1WGWA 4NY3A 3MX3A 5JUAA 2YL1A 1O3UA 3VF0A 2R7SA 2WVNA 3SZRA 5T3WA 2GFHA 3R7CA 3O55A 2EIJC 3MLGA 2HKVA 1C02A 4LDRA 4D4NA 2R9RB 3NKEA 2H7VC 2BC5A 1O5HA 3WG7C 3ZTMA 5AGFA 3EFOB 4F4BA 2R7XA 3DJUB 3O6XA 2CCYA 1QVXA 5A6JA 3HNKA 4H4KC 4N06A 3EJNA 3M4BA 5E3CA 1MMGA 2CNWA 3NG1A 2DYRC 4CSAA 3K33A 2UUHA 3B0PA 3L8JA 3ZSUA 4GYTA 4JCZA 4AL1A 2RSEB 3LUTB 1EA8A 4GQHA 4X0RA 3WHNA 1L7CA 3ZDLA 1SZIA 4A4AA 3WODF 1M56C 1YZAA 3DAGA 3EGXB 3HKKA 5T1DB 4MVZA 3W2WA 4C3DA 4B6IA 1EQ1A 3C8ZA 4XPXA 4BJ1A 4XEFA 4YWQA 1HE9A 2Y3DA 2DGJA 3DAFA 3LAYA 2J7PD 3ZQYA 2PX3A 3HNJA 4XPYA 1RMVA 3QVYA 3F46A 3UGPA 1F1MA 2KGOA 1ZHYA 2FFHA 2J46A 2L7AA 4CIHA 1C03A 3M15A 1OCZC 3Q7GA 3NMJA 3K1IC 4MTGA 3UR3C 4ULWA 5IY5C 2YLGA 3U8VA 1HW2A 1WTYA 3C63A 3U2MA 4W8PA 4O6NA 4Z9IA 2CW0F 2LFDA 5DVWA 1E84A 2WVOA 3EH2A 5KYNA 3Q6MA 1LS4A 2OJQA 2ZXWC 3AQBA 3IQ6A 3OEOA 1H6GA 1T6QA 2BE5F 1OR3A 2BL2A 2PP4A 5L3QA 2A68F 5T3TA 3ABMC 1H7IA 5JSLA 3M1CB 2Y39A 1U6HA 4QDLA 5B1BC 2V3CC 3I5PA 5A69A 2A69F 4OINF 4MS2A 4EBJA 1A7VA 5JLIA 1ZHWA 1KTMA 1D1BA 2J9UA 1D1AA 4WABA 1G5ZA 2QE9A 2ZXPA 2NUPA 4NQFA 1FR0A 4DVYP 3B71A 5L0JA 5DS5A 1K05A 3JSEO 2EILC 4HE8D 1QPUA 2YL0A 4DJ9A 1A7EA 1ZU4A 1ZVZA 2LQGA 1M2OA 2GWWA 2XLWA 3CEXA 1MMAA 5JVEA 4YL1A 3IHUA 1T5OA 3EFOA 3CZ6A 3QVZA 4CJGA 4E18A 2OEXA 3MFNA 3RQEA 1QLEC 2W45A 3T4RA 3UGOA 4YJWA 2R7QA 1ZHTA 3FAJA 3CQZA 4J32B 1R4TA 3UMIA 2AWYA 2IYLD 3SXKA 4IWBA 1Q0MA 3ASNC 2XL4A 2CGEA 3DM9B 4OIPF 2KNHA 4EKWA 2RD9A 1VLTA 1LE4A 2XLVA 3HTKC 4O79A 2G3KA 2GA0A 3NKDA 4A2NB 3GWNA 2YQYA 5D92A 2JPUA 2MWQA 3GORA 2YHSA 3EGXA 3UMKA 1A41A 5KYYB 2YRFA 1Z23A 3U3BA
chains in the Genus database with same CATH topology
3PMRA 4LACB 1OKKD 3JRTA 4W8KA 4BJ6C 2PFDA 3POVA 3FDQA 4G7HF 1TWGA 3T6BA 4OIRF 2XRHA 2QTVA 2W4BA 4AE4B 2WVQA 3RYLA 1FFHA 2C04A 4P6IC 4YT4A 4E7ZA 3ABLC 4I44A 2W4MA 3DM5A 4O7GA 5E2QA 2YEVA 4CSAC 2ZXOA 4XLNF 2R7WA 2WZLA 1Z6AA 5HSWA 2A6HF 1Z5ZA 2G62A 1PD1A 3LLKA 4O6YA 1FMWA 5B3SC 1S7ZA 2NUTB 4EBBA 1ZHZA 2WL8A 4KNVA 4LERA 1IZMA 3IEEA 3PHF2 3HLZA 3ZIBA 2KW3C 1BR2A 2HV6A 4JZAA 4HEAJ 1PCXA 5KYWB 1G8XA 2EIKC 4OIOF 3EHNA 1FTSA 4G7ZF 2VH3A 3W8HA 1OCRC 3SEOA 5KYYA 3I5QA 5DQTA 1BR1A 2Q3TA 5F5FA 3K66A 4MQ9F 1OCCC 1JPJA 4RD9A 4AE4A 2J7PA 3JYHA 5DS6A 4QI0A 4O6MA 2R7TA 1J8MF 3AG2C 3N24A 2R7OA 3NRHA 3AG3C 4PJJA 3OWTA 4K0DA 5F5HA 4KI2A 4XWJA 3OA1A 3Q7LA 4OD4A 3X2QC 2HV7A 4ZLCA 2NUTA 4U5BE 1QZXA 3H65A 3NYJA 3JSZA 4U5EE 2J0XA 3E70C 2J9VA 3CSKA 5EGYA 5DLJA 3LS1A 4CS7A 2EINC 2JD3A 3LEVA 3RIPA 1NU7D 4PFPA 3S27A 5KYXB 1V55C 5DS4A 5KYWA 3RH3A 2Q9CA 2G3VA 4CS9A 1MMNA 3LS0A 4M63A 5CI9A 4HFFB 2O9XA 2V26A 1M2VB 3W2VA 4WJ0A 5EHHA 4FX5A 2L81A 4KBLA 3ITFA 4G0HA 2L9JA 3LLIA 4XTKA 3KKBA 1J8YF 1O87A 1OKKA 4OD5A 2R7UA 3SP1A 4K7BA 4LLCA 2WZGA 2M4EA 3KMIA 2Z15A 2DYSC 1MMDA 3K1HA 3RFYA 1VMAA 2H7OA 4YT8A 1SF8A 4DVZA 4Q5SF 3DZAA 2KJGA 2WZFA 2YZSA 3E9VA 2PF4E 2ZPAA 4LLEA 4AK9A 3JT1A 4C3EA 1M57C 4U5DE 1N1CA 4Q7CA 2Y3HA 3B0VC 4I1OB 4HFKB 4E7SA 3K7DA 4U5CE 3EZHA 1ZYRF 2XXAB 2Q9AA 3ZC4A 5L3VA 3GANA 2IXNA 4BEJA 3DMDA 4C3BA 2J9WA 5KYXA 3ECSA 4CS8A 5D91A 2IXOA 3ABKC 2XSEA 3FVYA 4PK4A 4JVSA 3NYLA 4JW1A 1LKXA 3DD7A 1M2VA 3EGDB 4DBRA 1TWHA 2I8BA 4ZLDA 4RBNA 2VASA 3L0IA 3ZVRA 2C03A 1RJ9B 3B9QA 4I3MA 2A6EF 2PX0A 3O39A 1NU9C 5E33A 1Z63A 5KYUB 4YT2A 3EQLF 2W9YA 3AG4C 1D0ZA 1D0XA 4JURI 4KC9A 2CNWD 2IXPA 4U5HA 3ZG1A 4ANJA 4PJNA 4PJLA 3L34A 4BJ5A 1D0YA 4CS9C 3UNGC 2QY9A 1VYKA 2WB7A 4DOZA 2R7VA 4RDAA 1MNEA 3QMKA 3S28A 3UMHA 4QI2A 2ZXRA 4MNDA 3VAYA 3EPVA 1FFTC 4FESA 3EG9B 4CBEA 5CI8A 2Y69C 4Q4ZF 3ASOC 3DXJF 2XXAA 3HJCA 3W8IA 2D5RB 4I1MA 5DQZA 2A1DD 3S29A 2IXMA 3EZIA 1FMVA 3N0TA 1PD0A 5B1AC 1TWAA 4PJMA 3FHDA 2P6VA 1OCOC 2R7RA 1V54C 3TD7A 4KNWA 2OG2A 3NDBB 3QZCA 3LJBA 4JJGA 3F47A 1JPNA 3NYMA 5FCLA 3EGDA 1BR4A 1W2WA 3K6BA 1TR2A 2VB6A 4C7OB 1RJ9A 2CDQA 3N2ZB 1MNDA 3X1OA 3T6JA 1IW7F 1VK5A 3LNRA 1D1CA 1Z3IX 5KYUA 2H7BA 4OIQF 2J45A 3V7OA 4EWCA 3EH1A 4DBQA 2LSEA 3JCUQ 4YN0B 4YT5A 4J30B 3AG1C 3DJNB 4CS8C 2Y3BA 2KQ9A 3SYNA 1VYIA 1ZU5A 1NG1A 3GODA 4PFOA 3KL4A 2MYSA 5BUOA 4JJFA 1LVKA 4XLPF 4IRUA 2FGYA 2Q9BA 1LS1A 3EG9A 2OCCC 3SNHA 3EHMA 4BG0A 4FWVA 3LESA 3AQCA 4JCHA 3I4UA 4AX2A 1SMYF 3VYWA 2E87A 2B0JA 2X51A 1ZHXA 3RKOF 4G7OF 2IOQA 4GEHA 2NG1A 2J0WA 4BJ5C 4IJJA 1KU2A 5E3AA 2Y3GA 1VOMA 2P7VA 2EIMC 4U5FE 3S0XA 4C7OA 1TKNA 3KH2A 3B0UX 3Q6NA 4IAOA 4U5GA 1TWCA 1ST6A 4BJ6A 1NZEA 2NUPB 4BJTA 1WGWA 4NY3A 3MX3A 2R7SA 2WVNA 3SZRA 5T3WA 2GFHA 2EIJC 3MLGA 3NKEA 2H7VC 4F4BA 1O5HA 3WG7C 2R7XA 3EFOB 3DJUB 3O6XA 4H4KC 4N06A 3EJNA 5E3CA 1MMGA 2CNWA 3NG1A 2DYRC 4CSAA 3K33A 3B0PA 3ZSUA 4GYTA 4X0RA 1SZIA 3WODF 1M56C 3DAGA 3EGXB 5T1DB 3W2WA 4C3DA 4B6IA 4BJ1A 4YWQA 2Y3DA 2DGJA 3DAFA 3LAYA 2J7PD 2PX3A 3F46A 3UGPA 2KGOA 1ZHYA 2FFHA 2J46A 4CIHA 1OCZC 3Q7GA 3K1IC 3UR3C 4ULWA 5IY5C 4O6NA 2CW0F 5DVWA 2WVOA 3EH2A 5KYNA 3Q6MA 2ZXWC 3AQBA 3OEOA 2BE5F 2PP4A 5L3QA 2A68F 5T3TA 3ABMC 3M1CB 2Y39A 4QDLA 5B1BC 2V3CC 3I5PA 2A69F 4OINF 1ZHWA 1D1BA 2J9UA 1D1AA 2ZXPA 2NUPA 4DVYP 5DS5A 2EILC 4HE8D 1ZU4A 1M2OA 1MMAA 3EFOA 3CZ6A 3UGOA 1QLEC 2W45A 3T4RA 4YJWA 2R7QA 1ZHTA 3FAJA 3CQZA 4J32B 3UMIA 2IYLD 4OIPF 4IWBA 3ASNC 2XL4A 2CGEA 3DM9B 2KNHA 3HTKC 4O79A 2G3KA 3NKDA 4A2NB 5D92A 2MWQA 3UMKA 2YHSA 3EGXA 5KYYB 1Z23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VYI A;  2WZL A;  3OA1 A; 
#chains in the Genus database with same CATH topology
 1GS9 A;  3PMR A;  4LAC B;  1OKK D;  4JKV A;  1PV3 A;  2QUP A;  3JRT A;  4MVR A;  4W8K A;  2PFD A;  4IGG A;  4BJ6 C;  1WN0 A;  3POV A;  4LDK A;  2KYH A;  1JAF A;  1I4Y A;  1NFN A;  1TWG A;  2AU5 A;  4JE9 A;  3T6B A;  4OIR F;  3TQO A;  2XRH A;  4EBK A;  2QTV A;  2W4B A;  4AE4 B;  2WVQ A;  3G4Z A;  2VC9 A;  3RYL A;  4WGZ A;  4JEB A;  1A7D A;  1FFH A;  3CAX A;  2C04 A;  4P6I C;  4YT4 A;  4E7Z A;  3ABL C;  3MBG A;  4I44 A;  1UFB A;  3FMS A;  2Q7R A;  2W4M A;  5JT4 A;  3AOU A;  3RW0 A;  3DM5 A;  2HJM A;  1JOG A;  5COF A;  4O7G A;  3H2V A;  3IQ5 A;  2YEV A;  5E2Q A;  3S29 A;  4CSA C;  2ZXO A;  2LFF A;  4XLN F;  1VB5 A;  4JC7 A;  2WZL A;  2R7W A;  1Z6A A;  4D4X A;  5HSW A;  1NBB A;  3IQT A;  1QQ3 A;  2A6H F;  1Z5Z A;  2G62 A;  1PD1 A;  3LLK A;  3O10 A;  4NTF A;  3ZWI A;  3DI5 A;  1BZ4 A;  2P0N A;  3C8G D;  2J8W A;  4O6Y A;  1FMW A;  5B3S C;  1S7Z A;  2NUT B;  2HMQ A;  4EBB A;  1V74 B;  3G4X A;  1ZHZ A;  2LP4 A;  1AEP A;  1DOW A;  4NTA A;  2WL8 A;  4KNV A;  3BEH A;  2TMV P;  5F28 E;  4LER A;  5AC4 A;  1IZM A;  3IEE A;  1YVI A;  4ULV A;  4MTF A;  4YL3 A;  3HLZ A;  3GM2 A;  3ZIB A;  5BQH A;  5L0D A;  3S9O A;  3PHF 2;  3KPH A;  2KW3 C;  5BQG A;  1BR2 A;  1Q0G A;  2NPU A;  3ZQV A;  3U5S A;  2X0C A;  2HV6 A;  4JZA A;  1RCP A;  4HEA J;  2AWC A;  1PCX A;  5KYW B;  1G8X A;  2EIK C;  2R25 A;  4MVU A;  4OIO F;  1VLS A;  2EPK X;  2IM8 A;  2LCH A;  3EHN A;  1FTS A;  1XZQ A;  2A0U A;  1V4A A;  4G7Z F;  4IAR A;  2VH3 A;  3W8H A;  1AUE A;  2DI3 A;  2VCA A;  4MVM A;  4P9F A;  1OCR C;  3SXZ A;  3SEO A;  2HJ3 A;  2XLE A;  5KYY A;  3I5Q A;  5DQT A;  1BR1 A;  4N6H A;  1OW8 A;  2LK4 A;  2Q3T A;  5F5F A;  1K40 A;  4E17 A;  1RXQ A;  3K66 A;  4E0H A;  1LE2 A;  4MQ9 F;  1OCC C;  1JPJ A;  4RD9 A;  4AE4 A;  1E83 A;  1OQC A;  2J7P A;  5JRA A;  3JYH A;  5DS6 A;  4QI0 A;  3V5Z A;  4O6M A;  2R7T A;  4IAQ A;  3GM3 A;  2D4U A;  1J8M F;  2R05 A;  3AGT A;  3AG2 C;  5COG A;  5L0C A;  4CDA A;  1I4Z A;  3N24 A;  2EPO A;  2R7O A;  4CIP A;  3NRH A;  3AG3 C;  4JTA B;  3NMK A;  1YJG A;  4PAC A;  5JP7 A;  4PJJ A;  3V5Y A;  4XQ1 A;  3OWT A;  1YYJ A;  1ORS C;  2NSF A;  3M79 A;  4K0D A;  5F5H A;  4KI2 A;  4XWJ A;  3OA1 A;  3Q7L A;  2P61 A;  2HMZ A;  5FZT A;  4OD4 A;  3X2Q C;  1OR2 A;  2HV7 A;  4ZLC A;  1CGM E;  2NUT A;  4U5B E;  1QZX A;  3H65 A;  5CIV A;  3NYJ A;  3C8G B;  2FAP B;  2HS5 A;  3JSZ A;  1XWJ A;  4U5E E;  2J0X A;  2OU6 A;  3E70 C;  2KSF A;  3A9C A;  1CGN A;  2KC3 A;  2J9V A;  3CSK A;  3LEO A;  1AVO B;  5EGY A;  1OW7 A;  5DLJ A;  3LS1 A;  4G7H F;  4CS7 A;  2EIN C;  1NSG B;  1ZZP A;  4EHP A;  2JD3 A;  4NC3 A;  3LEV A;  3RIP A;  1NU7 D;  4PFP A;  4CJO A;  3S27 A;  4YK5 A;  2Q4F A;  5KYX B;  1ORJ A;  3IQC A;  1V55 C;  2HSB A;  5DS4 A;  1YA9 A;  5KYW A;  1B68 A;  1JRA A;  3RH3 A;  2Q9C A;  2Q00 A;  2G3V A;  4N6C A;  4CS9 A;  5A6B D;  1GQA A;  1JR8 A;  1MMN A;  3LS0 A;  1FAP B;  3GWL A;  4M63 A;  5CI9 A;  3SXM A;  4HFF B;  2O9X A;  2CYD A;  2V26 A;  1M2V B;  3W2V A;  5K0I A;  4WJ0 A;  1LI5 A;  4JRZ A;  3TOM A;  2YL7 A;  2LD6 A;  3NMI A;  3QW1 A;  5EHH A;  4FX5 A;  2HSQ A;  2L81 A;  4KBL A;  3U9J A;  1K04 A;  4DRI B;  3ITF A;  1CPR A;  1TQG A;  4G0H A;  2L9J A;  3LLI A;  3JRM O;  4XTK A;  3VRC A;  2P1A A;  3KKB A;  4CDY A;  1J8Y F;  1O87 A;  1OKK A;  1EI7 A;  1H9T A;  4OD5 A;  2R7U A;  3SP1 A;  4K7B A;  4LLC A;  2QLA A;  1SYQ A;  4CDV A;  2WZG A;  2M4E A;  3B29 A;  3KMI A;  2Z15 A;  1T6U A;  2DYS C;  1MMD A;  3K1H A;  4J7Y A;  3RFY A;  1VMA A;  2H7O A;  2R02 A;  2B0H A;  2R03 A;  1HW1 A;  3R2P A;  2HZ8 A;  5A6K A;  1CGO A;  4YT8 A;  1SF8 A;  4DVZ A;  3HNL A;  3RF3 A;  4Q5S F;  4BEM J;  3DZA A;  2KJG A;  4PR9 A;  1A0B A;  1U89 A;  2WZF A;  2YZS A;  4XEV A;  1WAS A;  1OXB A;  4H54 A;  4P9T A;  2MHR A;  3E9V A;  5TJ5 E;  2PF4 E;  4DRH B;  2ZPA A;  3S90 A;  3FXH A;  4LLE A;  3SXY A;  4AK9 A;  1C17 M;  3JT1 A;  3W4Y A;  3DE8 A;  2OQM A;  4C3E A;  1M57 C;  2ICW G;  4U5D E;  2AVK A;  1N1C A;  4Q7C A;  4MVQ A;  3ATP A;  2Y3H A;  3PDM P;  3B0V C;  4I1O B;  4HFK B;  3C8G A;  4E7S A;  3K7D A;  3U9M A;  4U5C E;  3EZH A;  1DOV A;  1ZYR F;  4MTO A;  1WAT A;  2XLM A;  2HUJ A;  2XXA B;  1LM3 B;  4U9D A;  2OEV A;  256B A;  2Q9A A;  3ZC4 A;  5L3V A;  3GAN A;  3H2U A;  4IB4 A;  3TK0 A;  2IXN A;  4UDV A;  1Y4C A;  1ZW3 A;  3DMD A;  4BEJ A;  2HFI A;  4C3B A;  3C18 A;  2J9W A;  4MVO A;  3FOO A;  5KYX A;  3ECS A;  4CS8 A;  1H9G A;  2NSG A;  5D91 A;  1M6T A;  1TFO B;  4K1O A;  2IXO A;  3ABK C;  2XSE A;  2YKZ A;  3TOL A;  3FVY A;  4PK4 A;  2L6H A;  4JVS A;  2GAQ A;  1XZP A;  2L6F A;  3NYL A;  2EPM X;  4MW3 A;  4JW1 A;  2L6G A;  3KYI A;  1YLM A;  1HE1 A;  1LKX A;  3DD7 A;  4N4W A;  5BQI A;  1M2V A;  1E85 A;  1TFK B;  3EGD B;  4DBR A;  1TWH A;  2I8B A;  4ZLD A;  4XPW A;  4RBN A;  1LIH A;  3JYY A;  4E0I A;  2VAS A;  3L0I A;  4ONS A;  3ZVR A;  3C7J A;  2C03 A;  1RJ9 B;  3B9Q A;  4G78 A;  4I3M A;  4ER9 A;  2A6E F;  2PX0 A;  1L3P A;  3O39 A;  1NU9 C;  3PCV A;  5E33 A;  1Z63 A;  1GGQ A;  1QKR A;  3FDQ A;  5KYU B;  4YT2 A;  3EQL F;  2W9Y A;  2QNL A;  3DWW A;  2OKU A;  2J9B A;  5AC5 A;  3AG4 C;  3U3F A;  1D0Z A;  1E86 A;  1S05 A;  4JTC B;  1D0X A;  1HY5 A;  1FNT c;  1VTM P;  1YYX A;  2F22 A;  2XS1 A;  1RKE B;  4JUR I;  5A6A A;  2GDC A;  2A0B A;  4KC9 A;  5GPG B;  1YA7 O;  2CNW D;  2IXP A;  3GEH A;  4U5H A;  2XLH A;  3ZG1 A;  4ANJ A;  4PJN A;  2EPN A;  3L34 A;  4PJL A;  4BJ5 A;  1D0Y A;  1CPQ A;  4CS9 C;  3UNG C;  2ZD9 A;  2QY9 A;  1EKY A;  1VYK A;  2WB7 A;  4DOZ A;  2R7V A;  4RDA A;  1MNE A;  2OOC A;  3QMK A;  3S28 A;  2AP3 A;  2ETS A;  1U0B B;  3AJM A;  2VCB A;  3DE9 A;  4Z9J A;  3UMH A;  4QI2 A;  2XM4 A;  1I5N A;  2ZXR A;  4MND A;  3VAY A;  3EPV A;  1BDJ B;  1FFT C;  1E2X A;  4FES A;  4XEK A;  3EG9 B;  2LIG A;  4CBE A;  5CI8 A;  2Y69 C;  1Y6D A;  2XL8 A;  4Q4Z F;  3ASO C;  3DXJ F;  3QTH A;  2XXA A;  3HJC A;  1HMD A;  3LNM B;  3GEE A;  3MYI A;  4JEA A;  3W8I A;  2D5R B;  3BRJ A;  1Q0F A;  4I1M A;  5DQZ A;  1ORY A;  1OXK A;  2A1D D;  2IXM A;  1T6I A;  2PNO A;  3EZI A;  2H8A A;  3KYJ A;  1FMV A;  3N0T A;  4YL0 A;  1PD0 A;  1Q0K A;  5B1A C;  2YL3 A;  1TWA A;  3U0C A;  4PJM A;  3FHD A;  3V5X A;  2UUI A;  2P6V A;  1OCO C;  2R7R A;  1V54 C;  4J7T A;  2YVK A;  3TD7 A;  2YLD A;  3A11 A;  3G50 A;  4JTD B;  2OG2 A;  4KNW A;  1T9K A;  1YAR O;  2JX0 A;  3HNI A;  4MVS A;  3NDB B;  4AL0 A;  3QZC A;  3LJB A;  3VM6 A;  3RQF A;  4JJG A;  5JS5 A;  1SR2 A;  2YLI A;  3F47 A;  3M4C A;  1JPN A;  3NYM A;  5FCL A;  1YDI A;  3EGD A;  4DXW A;  5A6B A;  3JTL O;  1BR4 A;  2OJE D;  1WWP A;  1W2W A;  3K6B A;  1TR2 A;  3L8I A;  2M64 A;  2VB6 A;  3RQG A;  1Z7Q c;  4C7O B;  3QW0 A;  1R5I D;  1RJ9 A;  2CDQ A;  3N2Z B;  1MND A;  3X1O A;  3TJ6 A;  1YZC A;  1IW7 F;  1VK5 A;  3DKA A;  3LNR A;  1BBH A;  3T6J A;  5L0I A;  1D1C A;  1Z3I X;  2XS8 A;  2H7B A;  5KYU A;  2J45 A;  4OIQ F;  2XL6 A;  3V7O A;  4EWC A;  5COM A;  2IBF A;  1T01 A;  3EH1 A;  4CX9 A;  4DBQ A;  2VCC A;  2LSE A;  2XLO A;  3L1M A;  5L0H A;  3JCU Q;  4YN0 B;  4YT5 A;  3IPM O;  3RVY A;  3K1I A;  4J30 B;  1RKE A;  3AG1 C;  1MQV A;  3DJN B;  3T6G B;  4CS8 C;  3U8P A;  2Y3B A;  2KQ9 A;  2YWA A;  3SYN A;  2ASR A;  4L6R A;  3C62 A;  3US6 A;  5L0F A;  2I15 A;  1JMW A;  1VYI A;  1ZU5 A;  5B3I A;  4MW8 A;  4NTB A;  1G4U S;  1NG1 A;  2KK1 A;  3GEI A;  1QSP A;  3GOD A;  4LDQ A;  4DRJ B;  1UG7 A;  4PFO A;  3KL4 A;  2MYS A;  5BUO A;  1NFO A;  1WOL A;  1LPE A;  4JJF A;  1LVK A;  2EPL X;  4NCQ A;  4XLP F;  4EUK B;  4IRU A;  2FGY A;  2Q9B A;  1LS1 A;  4FAP B;  4BPM A;  3EG9 A;  3RVZ A;  2OCC C;  3AGU A;  3FAP B;  3SNH A;  3EHM A;  4BG0 A;  4EIY A;  2PBE A;  3GM1 A;  4FWV A;  1G4W R;  4U9E A;  2DB4 A;  3LES A;  3WAQ A;  3AQC A;  4WGY A;  5EK0 A;  4JCH A;  3I4U A;  4AX2 A;  1SMY F;  3VYW A;  2E87 A;  2B0J A;  2X51 A;  1ZHX A;  3RKO F;  3ZTZ A;  2IOQ A;  3U2L A;  4GEH A;  1GM5 A;  4G7O F;  1Q0D A;  5L0G A;  2NG1 A;  2J0W A;  1HMO A;  4BJ5 C;  3TUL A;  4IJJ A;  3S84 A;  1KU2 A;  5E3A A;  2Y3G A;  3FOP A;  4JIO A;  1VOM A;  1NLX A;  1KNY A;  1RKC A;  3JZ0 A;  2P7V A;  2EIM C;  2XM0 A;  4U5F E;  3T9O A;  1OW6 A;  3S0X A;  1APC A;  4C7O A;  4R32 A;  1TKN A;  3KH2 A;  3B0U X;  3MYF A;  1YAU O;  1LI7 A;  3Q6N A;  4IAO A;  4U5G A;  3TJ5 A;  2XLD A;  1TWC A;  1ST6 A;  5HV9 A;  1ZW2 A;  1NZE A;  4BJ6 A;  3J06 A;  4Z9H A;  2NUP B;  4BJT A;  1WGW A;  4NY3 A;  3MX3 A;  5JUA A;  2YL1 A;  1O3U A;  3VF0 A;  2R7S A;  2WVN A;  3SZR A;  5T3W A;  2GFH A;  3R7C A;  3O55 A;  2EIJ C;  3MLG A;  2HKV A;  1C02 A;  4LDR A;  4D4N A;  2R9R B;  3NKE A;  2H7V C;  2BC5 A;  1O5H A;  3WG7 C;  3ZTM A;  5AGF A;  3EFO B;  4F4B A;  2R7X A;  3DJU B;  3O6X A;  2CCY A;  1QVX A;  5A6J A;  3HNK A;  4H4K C;  4N06 A;  3EJN A;  3M4B A;  5E3C A;  1MMG A;  2CNW A;  3NG1 A;  2DYR C;  4CSA A;  3K33 A;  2UUH A;  3B0P A;  3L8J A;  3ZSU A;  4GYT A;  4JCZ A;  4AL1 A;  2RSE B;  3LUT B;  1EA8 A;  4GQH A;  4X0R A;  3WHN A;  1L7C A;  3ZDL A;  1SZI A;  4A4A A;  3WOD F;  1M56 C;  1YZA A;  3DAG A;  3EGX B;  3HKK A;  5T1D B;  4MVZ A;  3W2W A;  4C3D A;  4B6I A;  1EQ1 A;  3C8Z A;  4XPX A;  4BJ1 A;  4XEF A;  4YWQ A;  1HE9 A;  2Y3D A;  2DGJ A;  3DAF A;  3LAY A;  2J7P D;  3ZQY A;  2PX3 A;  3HNJ A;  4XPY A;  1RMV A;  3QVY A;  3F46 A;  3UGP A;  1F1M A;  2KGO A;  1ZHY A;  2FFH A;  2J46 A;  2L7A A;  4CIH A;  1C03 A;  3M15 A;  1OCZ C;  3Q7G A;  3NMJ A;  3K1I C;  4MTG A;  3UR3 C;  4ULW A;  5IY5 C;  2YLG A;  3U8V A;  1HW2 A;  1WTY A;  3C63 A;  3U2M A;  4W8P A;  4O6N A;  4Z9I A;  2CW0 F;  2LFD A;  5DVW A;  1E84 A;  2WVO A;  3EH2 A;  5KYN A;  3Q6M A;  1LS4 A;  2OJQ A;  2ZXW C;  3AQB A;  3IQ6 A;  3OEO A;  1H6G A;  1T6Q A;  2BE5 F;  1OR3 A;  2BL2 A;  2PP4 A;  5L3Q A;  2A68 F;  5T3T A;  3ABM C;  1H7I A;  5JSL A;  3M1C B;  2Y39 A;  1U6H A;  4QDL A;  5B1B C;  2V3C C;  3I5P A;  5A69 A;  2A69 F;  4OIN F;  4MS2 A;  4EBJ A;  1A7V A;  5JLI A;  1ZHW A;  1KTM A;  1D1B A;  2J9U A;  1D1A A;  4WAB A;  1G5Z A;  2QE9 A;  2ZXP A;  2NUP A;  4NQF A;  1FR0 A;  4DVY P;  3B71 A;  5L0J A;  5DS5 A;  1K05 A;  3JSE O;  2EIL C;  4HE8 D;  1QPU A;  2YL0 A;  4DJ9 A;  1A7E A;  1ZU4 A;  1ZVZ A;  2LQG A;  1M2O A;  2GWW A;  2XLW A;  3CEX A;  1MMA A;  5JVE A;  4YL1 A;  3IHU A;  1T5O A;  3EFO A;  3CZ6 A;  3QVZ A;  4CJG A;  4E18 A;  2OEX A;  3MFN A;  3RQE A;  1QLE C;  2W45 A;  3T4R A;  3UGO A;  4YJW A;  2R7Q A;  1ZHT A;  3FAJ A;  3CQZ A;  4J32 B;  1R4T A;  3UMI A;  2AWY A;  2IYL D;  3SXK A;  4IWB A;  1Q0M A;  3ASN C;  2XL4 A;  2CGE A;  3DM9 B;  4OIP F;  2KNH A;  4EKW A;  2RD9 A;  1VLT A;  1LE4 A;  2XLV A;  3HTK C;  4O79 A;  2G3K A;  2GA0 A;  3NKD A;  4A2N B;  3GWN A;  2YQY A;  5D92 A;  2JPU A;  2MWQ A;  3GOR A;  2YHS A;  3EGX A;  3UMK A;  1A41 A;  5KYY B;  2YRF A;  1Z23 A;  3U3B A; 
#chains in the Genus database with same CATH homology
 3PMR A;  4LAC B;  1OKK D;  3JRT A;  4W8K A;  4BJ6 C;  2PFD A;  3POV A;  3FDQ A;  4G7H F;  1TWG A;  3T6B A;  4OIR F;  2XRH A;  2QTV A;  2W4B A;  4AE4 B;  2WVQ A;  3RYL A;  1FFH A;  2C04 A;  4P6I C;  4YT4 A;  4E7Z A;  3ABL C;  4I44 A;  2W4M A;  3DM5 A;  4O7G A;  5E2Q A;  2YEV A;  4CSA C;  2ZXO A;  4XLN F;  2R7W A;  2WZL A;  1Z6A A;  5HSW A;  2A6H F;  1Z5Z A;  2G62 A;  1PD1 A;  3LLK A;  4O6Y A;  1FMW A;  5B3S C;  1S7Z A;  2NUT B;  4EBB A;  1ZHZ A;  2WL8 A;  4KNV A;  4LER A;  1IZM A;  3IEE A;  3PHF 2;  3HLZ A;  3ZIB A;  2KW3 C;  1BR2 A;  2HV6 A;  4JZA A;  4HEA J;  1PCX A;  5KYW B;  1G8X A;  2EIK C;  4OIO F;  3EHN A;  1FTS A;  4G7Z F;  2VH3 A;  3W8H A;  1OCR C;  3SEO A;  5KYY A;  3I5Q A;  5DQT A;  1BR1 A;  2Q3T A;  5F5F A;  3K66 A;  4MQ9 F;  1OCC C;  1JPJ A;  4RD9 A;  4AE4 A;  2J7P A;  3JYH A;  5DS6 A;  4QI0 A;  4O6M A;  2R7T A;  1J8M F;  3AG2 C;  3N24 A;  2R7O A;  3NRH A;  3AG3 C;  4PJJ A;  3OWT A;  4K0D A;  5F5H A;  4KI2 A;  4XWJ A;  3OA1 A;  3Q7L A;  4OD4 A;  3X2Q C;  2HV7 A;  4ZLC A;  2NUT A;  4U5B E;  1QZX A;  3H65 A;  3NYJ A;  3JSZ A;  4U5E E;  2J0X A;  3E70 C;  2J9V A;  3CSK A;  5EGY A;  5DLJ A;  3LS1 A;  4CS7 A;  2EIN C;  2JD3 A;  3LEV A;  3RIP A;  1NU7 D;  4PFP A;  3S27 A;  5KYX B;  1V55 C;  5DS4 A;  5KYW A;  3RH3 A;  2Q9C A;  2G3V A;  4CS9 A;  1MMN A;  3LS0 A;  4M63 A;  5CI9 A;  4HFF B;  2O9X A;  2V26 A;  1M2V B;  3W2V A;  4WJ0 A;  5EHH A;  4FX5 A;  2L81 A;  4KBL A;  3ITF A;  4G0H A;  2L9J A;  3LLI A;  4XTK A;  3KKB A;  1J8Y F;  1O87 A;  1OKK A;  4OD5 A;  2R7U A;  3SP1 A;  4K7B A;  4LLC A;  2WZG A;  2M4E A;  3KMI A;  2Z15 A;  2DYS C;  1MMD A;  3K1H A;  3RFY A;  1VMA A;  2H7O A;  4YT8 A;  1SF8 A;  4DVZ A;  4Q5S F;  3DZA A;  2KJG A;  2WZF A;  2YZS A;  3E9V A;  2PF4 E;  2ZPA A;  4LLE A;  4AK9 A;  3JT1 A;  4C3E A;  1M57 C;  4U5D E;  1N1C A;  4Q7C A;  2Y3H A;  3B0V C;  4I1O B;  4HFK B;  4E7S A;  3K7D A;  4U5C E;  3EZH A;  1ZYR F;  2XXA B;  2Q9A A;  3ZC4 A;  5L3V A;  3GAN A;  2IXN A;  4BEJ A;  3DMD A;  4C3B A;  2J9W A;  5KYX A;  3ECS A;  4CS8 A;  5D91 A;  2IXO A;  3ABK C;  2XSE A;  3FVY A;  4PK4 A;  4JVS A;  3NYL A;  4JW1 A;  1LKX A;  3DD7 A;  1M2V A;  3EGD B;  4DBR A;  1TWH A;  2I8B A;  4ZLD A;  4RBN A;  2VAS A;  3L0I A;  3ZVR A;  2C03 A;  1RJ9 B;  3B9Q A;  4I3M A;  2A6E F;  2PX0 A;  3O39 A;  1NU9 C;  5E33 A;  1Z63 A;  5KYU B;  4YT2 A;  3EQL F;  2W9Y A;  3AG4 C;  1D0Z A;  1D0X A;  4JUR I;  4KC9 A;  2CNW D;  2IXP A;  4U5H A;  3ZG1 A;  4ANJ A;  4PJN A;  4PJL A;  3L34 A;  4BJ5 A;  1D0Y A;  4CS9 C;  3UNG C;  2QY9 A;  1VYK A;  2WB7 A;  4DOZ A;  2R7V A;  4RDA A;  1MNE A;  3QMK A;  3S28 A;  3UMH A;  4QI2 A;  2ZXR A;  4MND A;  3VAY A;  3EPV A;  1FFT C;  4FES A;  3EG9 B;  4CBE A;  5CI8 A;  2Y69 C;  4Q4Z F;  3ASO C;  3DXJ F;  2XXA A;  3HJC A;  3W8I A;  2D5R B;  4I1M A;  5DQZ A;  2A1D D;  3S29 A;  2IXM A;  3EZI A;  1FMV A;  3N0T A;  1PD0 A;  5B1A C;  1TWA A;  4PJM A;  3FHD A;  2P6V A;  1OCO C;  2R7R A;  1V54 C;  3TD7 A;  4KNW A;  2OG2 A;  3NDB B;  3QZC A;  3LJB A;  4JJG A;  3F47 A;  1JPN A;  3NYM A;  5FCL A;  3EGD A;  1BR4 A;  1W2W A;  3K6B A;  1TR2 A;  2VB6 A;  4C7O B;  1RJ9 A;  2CDQ A;  3N2Z B;  1MND A;  3X1O A;  3T6J A;  1IW7 F;  1VK5 A;  3LNR A;  1D1C A;  1Z3I X;  5KYU A;  2H7B A;  4OIQ F;  2J45 A;  3V7O A;  4EWC A;  3EH1 A;  4DBQ A;  2LSE A;  3JCU Q;  4YN0 B;  4YT5 A;  4J30 B;  3AG1 C;  3DJN B;  4CS8 C;  2Y3B A;  2KQ9 A;  3SYN A;  1VYI A;  1ZU5 A;  1NG1 A;  3GOD A;  4PFO A;  3KL4 A;  2MYS A;  5BUO A;  4JJF A;  1LVK A;  4XLP F;  4IRU A;  2FGY A;  2Q9B A;  1LS1 A;  3EG9 A;  2OCC C;  3SNH A;  3EHM A;  4BG0 A;  4FWV A;  3LES A;  3AQC A;  4JCH A;  3I4U A;  4AX2 A;  1SMY F;  3VYW A;  2E87 A;  2B0J A;  2X51 A;  1ZHX A;  3RKO F;  4G7O F;  2IOQ A;  4GEH A;  2NG1 A;  2J0W A;  4BJ5 C;  4IJJ A;  1KU2 A;  5E3A A;  2Y3G A;  1VOM A;  2P7V A;  2EIM C;  4U5F E;  3S0X A;  4C7O A;  1TKN A;  3KH2 A;  3B0U X;  3Q6N A;  4IAO A;  4U5G A;  1TWC A;  1ST6 A;  4BJ6 A;  1NZE A;  2NUP B;  4BJT A;  1WGW A;  4NY3 A;  3MX3 A;  2R7S A;  2WVN A;  3SZR A;  5T3W A;  2GFH A;  2EIJ C;  3MLG A;  3NKE A;  2H7V C;  4F4B A;  1O5H A;  3WG7 C;  2R7X A;  3EFO B;  3DJU B;  3O6X A;  4H4K C;  4N06 A;  3EJN A;  5E3C A;  1MMG A;  2CNW A;  3NG1 A;  2DYR C;  4CSA A;  3K33 A;  3B0P A;  3ZSU A;  4GYT A;  4X0R A;  1SZI A;  3WOD F;  1M56 C;  3DAG A;  3EGX B;  5T1D B;  3W2W A;  4C3D A;  4B6I A;  4BJ1 A;  4YWQ A;  2Y3D A;  2DGJ A;  3DAF A;  3LAY A;  2J7P D;  2PX3 A;  3F46 A;  3UGP A;  2KGO A;  1ZHY A;  2FFH A;  2J46 A;  4CIH A;  1OCZ C;  3Q7G A;  3K1I C;  3UR3 C;  4ULW A;  5IY5 C;  4O6N A;  2CW0 F;  5DVW A;  2WVO A;  3EH2 A;  5KYN A;  3Q6M A;  2ZXW C;  3AQB A;  3OEO A;  2BE5 F;  2PP4 A;  5L3Q A;  2A68 F;  5T3T A;  3ABM C;  3M1C B;  2Y39 A;  4QDL A;  5B1B C;  2V3C C;  3I5P A;  2A69 F;  4OIN F;  1ZHW A;  1D1B A;  2J9U A;  1D1A A;  2ZXP A;  2NUP A;  4DVY P;  5DS5 A;  2EIL C;  4HE8 D;  1ZU4 A;  1M2O A;  1MMA A;  3EFO A;  3CZ6 A;  3UGO A;  1QLE C;  2W45 A;  3T4R A;  4YJW A;  2R7Q A;  1ZHT A;  3FAJ A;  3CQZ A;  4J32 B;  3UMI A;  2IYL D;  4OIP F;  4IWB A;  3ASN C;  2XL4 A;  2CGE A;  3DM9 B;  2KNH A;  3HTK C;  4O79 A;  2G3K A;  3NKD A;  4A2N B;  5D92 A;  2MWQ A;  3UMK A;  2YHS A;  3EGX A;  5KYY B;  1Z23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...