1VYIA

Structure of the c-terminal domain of the polymerase cofactor of rabies virus: insights in function and evolution.
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
111
structure length
111
Chain Sequence
b'WSATNEEDDLSVEAEIAHQIAESFSKKYKFPSRSSGIFLYNFEQLKMNLDDIVKEAKNVPGVTRLAHDGSKIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE ALPHA SUBUNIT
publication title Structure and Function of the C-Terminal Domain of the Polymerase Cofactor of Rabies Virus
pubmed doi rcsb
source organism rabies virus cvs-11
molecule tags Transferase
total genus 39
structure length 111
sequence length 111
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-04-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.820 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1vyiA00
3OA1A 2WZLA 1VYIA
chains in the Genus database with same CATH superfamily
1J8MF 2L6HA 3UR3C 1OR2A 3JCUQ 4BJ6A 2W4MA 3CEXA 5KYWA 1OCZC 4XWJA 1YA7O 2XM4A 1ZZPA 3E70C 4CSAA 3JT1A 2IOQA 2NSGA 1Q0GA 2A68F 1R5ID 3HTKC 3ATPA 2GAQA 1YJGA 4MVZA 1LKXA 4G7OF 1G8XA 2XXAB 4G78A 2Y3BA 1J8YF 1GQAA 5KYUA 4EHPA 4MW3A 2J45A 3I5PA 4MVRA 1OW6A 3JRTA 4DOZA 1TWGA 4LLCA 5BQIA 3KPHA 1YDIA 2R7VA 3HNJA 2C03A 2Q4FA 3EFOA 3MYFA 1LIHA 4YL0A 3RF3A 3SP1A 2WVQA 2EIJC 2NPUA 3NMJA 2HMQA 4JKVA 4PJNA 2Q3TA 2QTVA 2KK1A 3T9OA 4XPYA 3FDQA 2XLEA 4XQ1A 1UFBA 3TD7A 3VM6A 4FWVA 2HV6A 1NG1A 3NG1A 2PF4E 1Y4CA 2PX0A 3VF0A 4BG0A 2ZXWC 3DAFA 2R25A 2R7XA 2NG1A 2OEVA 1RKEB 3C8GB 1M2OA 5FZTA 1I4YA 2ETSA 3JYYA 4Z9IA 1V74B 4IAOA 3V5YA 3UNGC 4RDAA 3NYMA 2XLMA 3B71A 3EGDB 2AWYA 1OKKA 4J7YA 4AE4A 4U5GA 3SNHA 4PK4A 3K7DA 1WN0A 4QDLA 3S0XA 1PD0A 4LDKA 2YL3A 3FMSA 1LPEA 1QVXA 3FXHA 2L7AA 2XL4A 3BEHA 4IAQA 2QUPA 4H54A 1E85A 2R7UA 2Y69C 2I15A 1HE1A 3OWTA 3DE9A 5E2QA 5T3WA 4CBEA 1AVOB 1XZQA 3C8GD 4KC9A 1FMWA 2EINC 5KYXB 2IXNA 1OCCC 4L6RA 5L3VA 1RXQA 2KYHA 4C7OA 3M4BA 1JOGA 2KNHA 2XL8A 1VB5A 3K1HA 1TKNA 2CW0F 2J0XA 2WL8A 3EQLF 3RIPA 3S27A 3IHUA 2R03A 1T9KA 2LD6A 1B68A 2WZGA 3QTHA 1AUEA 2YLDA 4WABA 3U8VA 1WATA 2A0UA 1MNEA 3EG9A 1VK5A 3EH1A 1VYKA 2HMZA 1KNYA 4Q7CA 5KYWB 2YWAA 5CI8A 4GQHA 2P0NA 2DYSC 2C04A 5A69A 3AGUA 1C03A 3ABMC 3AJMA 1QPUA 2XSEA 2EIKC 2BL2A 1MMGA 2OG2A 1SR2A 1A7EA 5KYUB 2GA0A 4E17A 3DKAA 3F47A 4MW8A 2M4EA 4B6IA 1M2VA 1ORJA 3LESA 2IXPA 5EK0A 3SEOA 2NUPA 3K6BA 3MLGA 4N6CA 3WAQA 4PJJA 1VTMP 4PFOA 1A41A 1S05A 1I5NA 2VH3A 2YL0A 3EFOB 3EZIA 1VLSA 3QVYA 3MFNA 4OIRF 4EWCA 3LAYA 3GM3A 2E87A 2H7OA 3C8ZA 2FGYA 1ZVZA 2HSBA 3WODF 3V5XA 3ZTZA 3PHF2 2R7WA 2R9RB 1NSGB 3QVZA 1T01A 1VYIA 2UUHA 3U0CA 1TWAA 2XS1A 4OINF 5A6KA 3N24A 3S84A 5DQZA 5E33A 3FAPB 2H7BA 4YL3A 3N2ZB 3ABLC 3TK0A 4EBBA 1E83A 4AE4B 4I44A 3ZQYA 3R2PA 5JUAA 4E7SA 1MQVA 1TFKB 4PJMA 5EHHA 1EA8A 1U6HA 4IJJA 3FVYA 5FCLA 3I5QA 4HFFB 4BEMJ 4U5BE 4A2NB 1ZW2A 5COFA 1MMAA 2W4BA 4MQ9F 5BQGA 4JJGA 3AQCA 3US6A 2ZD9A 2Q9BA 3IPMO 4WGYA 4JW1A 4JIOA 1D0XA 1MMNA 4LDQA 4BPMA 1FAPB 1OKKD 2Y3HA 3IQ5A 4C7OB 3DM9B 3RVYA 3G4XA 2LP4A 3LEVA 3C62A 1AEPA 4JZAA 2P1AA 4U5DE 3RFYA 3NYLA 3SXZA 2AVKA 4OIPF 4QI0A 2VASA 3M1CB 1D1AA 1ZHWA 3EG9B 1JAFA 5TJ5E 4DBRA 1RMVA 2EPOA 2OU6A 4JTDB 3LEOA 2IYLD 2FFHA 3NMIA 5CIVA 2G62A 3HNKA 1TWCA 4MTGA 1HMOA 2R7RA 5BUOA 2LQGA 1T6QA 3GORA 3M15A 4DVZA 3JTLO 3T6JA 3U5SA 3AG2C 2RSEB 4NTBA 3NRHA 3POVA 4DBQA 1HW2A 1D0YA 1WWPA 3LNMB 2YVKA 1G5ZA 3M4CA 4XPXA 4CX9A 1LM3B 1A7DA 3ZWIA 1M6TA 1M2VB 4MVMA 1A0BA 1SZIA 2NUPB 2DGJA 4ULVA 1JRAA 2J0WA 4Q5SF 3TOMA 2PFDA 4BJ5A 2HKVA 4JVSA 3ZC4A 1ST6A 2LFDA 3W8IA 4H4KC 1QZXA 4HE8D 2YHSA 4K0DA 4YJWA 2WVNA 3X1OA 3U3FA 2Q9AA 4DRIB 2D5RB 5F5FA 1KU2A 2A69F 2ZXPA 4IRUA 5L0IA 3SXYA 1HMDA 1ZHYA 2KW3C 4YT5A 1TFOB 2JPUA 3QZCA 5JSLA 3RYLA 1Z63A 3GANA 3R7CA 4MTFA 4U5EE 2RD9A 1LE2A 5A6AA 2JX0A 1NFOA 2H7VC 4K7BA 5L3QA 1Q0KA 1EI7A 4CDVA 2D4UA 3TULA 4XEKA 5JVEA 2EPMX 3W2VA 1M57C 4P9TA 2DI3A 2NUTA 1QKRA 3W8HA 5L0HA 1OW8A 2QE9A 3U3BA 4Q4ZF 4IB4A 1WASA 2OOCA 3EJNA 1Q0DA 4NQFA 3ZQVA 4ER9A 1LS1A 3QW0A 4LERA 3KYJA 1Z7Qc 4C3BA 3OEOA 5JLIA 3EHMA 4ZLCA 3HNLA 2YLGA 3DXJF 3ASNC 3FOOA 5D91A 1DOVA 3O39A 3ECSA 3ITFA 2DB4A 4MTOA 4UDVA 2G3KA 5B1BC 1XZPA 2OQMA 5COGA 1D1BA 4AL0A 2VB6A 3DAGA 3I4UA 1YA9A 1ZHZA 2WZLA 4N06A 4NTFA 3SXMA 4R32A 4YN0B 3WHNA 4GEHA 1RJ9A 3DWWA 4D4NA 2Y3GA 1OCRC 3FOPA 1K05A 2XLWA 3CSKA 1H7IA 4PR9A 1SMYF 2MHRA 2OJQA 2WB7A 3IQTA 1D1CA 1W2WA 4WGZA 4MS2A 5L0DA 2Q9CA 3J06A 5DQTA 2XM0A 2PNOA 4O6MA 3TOLA 2XRHA 2Z15A 3O6XA 1HY5A 4O6YA 2ZXRA 2J46A 1WTYA 3UMHA 4DXWA 3HLZA 4OIQF 3KL4A 2YZSA 3GM2A 3GWLA 5F28E 4CDYA 3S90A 3K1IC 3C7JA 1S7ZA 4CIHA 4OIOF 1BBHA 3DJUB 5JP7A 1ZHTA 3DM5A 4JE9A 3PCVA 1HE9A 2AU5A 2XLDA 1CGNA 1YZCA 2VCBA 1H9TA 1Y6DA 2XLVA 2V3CC 4E18A 2M64A 2EILC 5D92A 3B0VC 2ASRA 2L6FA 2XL6A 2YRFA 1E84A 1EKYA 3NKDA 4BEJA 1UG7A 5JRAA 1XWJA 4YT2A 2KC3A 2TMVP 4LDRA 3TQOA 3U2MA 2DYRC 1VLTA 2EPNA 1Z6AA 2A1DD 3RW0A 3TJ6A 1Z3IX 2CNWA 2L81A 1OXKA 4C3EA 4BJ1A 1OR3A 3JYHA 2YQYA 3L8JA 4J32B 5A6BA 4XPWA 2H8AA 3IQCA 3A9CA 4E7ZA 2NUTB 5KYYA 2Q7RA 5GPGB 1SYQA 1T6UA 3AG4C 3EZHA 5K0IA 3ABKC 4JTAB 2WZFA 3EH2A 4QI2A 4JRZA 3VRCA 2EIMC 3B9QA 2KJGA 2W45A 5T3TA 1DOWA 2ZXOA 4E0IA 2ZPAA 1EQ1A 5AC4A 3EGXA 5L0FA 4ZLDA 3CQZA 1LS4A 4RD9A 1G4WR 1TQGA 2J9WA 4Z9JA 3S9OA 3T4RA 2W9YA 2IM8A 3KMIA 1YLMA 4MNDA 3WG7C 2R7OA 3H65A 3PDMP 4JCHA 3W4YA 1PD1A 2IXOA 4KNWA 3H2VA 1RJ9B 3Q6MA 1T6IA 4I3MA 1GGQA 1FFTC 1BZ4A 2LK4A 4K1OA 5B3IA 2X51A 5E3CA 2B0JA 3NMKA 1Z23A 1JPJA 1WOLA 4YK5A 4CS9C 2IXMA 3MX3A 3GEIA 2J7PA 3RH3A 4XLNF 4P9FA 3TJ5A 4PACA 1ORYA 2OEXA 3U9JA 4J7TA 4HEAJ 1L3PA 4W8KA 1Z5ZA 1CGOA 3NYJA 4JTCB 1ZU5A 2CGEA 5JS5A 1C02A 4J30B 2R7SA 2A6HF 1QSPA 1YARO 4XTKA 5AGFA 4FX5A 2HV7A 1E86A 2IBFA 2PP4A 1KTMA 1ZHXA 2J9BA 4CIPA 1FFHA 2HFIA 2J9VA 2YLIA 3MYIA 4N4WA 5AC5A 3UGPA 1K40A 4EKWA 1T5OA 4E0HA 1FR0A 1LI7A 4HFKB 1C17M 3LS0A 4IARA 5T1DB 3GEHA 3JZ0A 3X2QC 4U5FE 4MVSA 3ZTMA 4EUKB 1OQCA 2HJMA 4X0RA 5DLJA 3W2WA 2GWWA 2YEVA 4JCZA 3UMKA 2OJED 2UUIA 4PJLA 1OW7A 3HJCA 3DE8A 4N6HA 1MMDA 3AQBA 5COMA 4AL1A 1HW1A 3C63A 3Q7GA 1O87A 2MWQA 3RKOF 4DRHB 2NSFA 4IGGA 5DS5A 4KNVA 3G50A 2I8BA 4G0HA 4D4XA 4NTAA 1Q0FA 2XS8A 1NBBA 1ORSC 4ONSA 4ANJA 5KYYB 3F46A 3MBGA 1YYXA 2P6VA 1APCA 2MYSA 3NKEA 3SZRA 2GFHA 2OKUA 3JRMO 4BJTA 4CDAA 3KH2A 4O7GA 2VC9A 4O79A 4CS7A 3S28A 4JEAA 2CNWD 3O55A 3U8PA 1V54C 3EPVA 5L0GA 3EGXB 3T6BA 4KBLA 1IW7F 1H6GA 5A6BD 3UGOA 1GS9A 3LNRA 4EBKA 3Q7LA 3QW1A 3SXKA 2Y39A 4CS9A 1IZMA 1BDJB 5DVWA 3RQEA 3ZSUA 1BR2A 3Q6NA 3M79A 4YT4A 3EHNA 3KYIA 4JURI 4W8PA 1V4AA 3ASOC 4IWBA 5B3SC 2KGOA 4AK9A 2QLAA 3ZVRA 3LLIA 4LACB 3V7OA 1NLXA 1YYJA 2A6EF 3ZG1A 1LE4A 3SYNA 4YWQA 1RCPA 2HS5A 3K66A 2YKZA 3AOUA 1PCXA 5JT4A 1QQ3A 3DZAA 5HV9A 1SF8A 3L1MA 2Q00A 2CYDA 4DRJB 1NZEA 4O6NA 3S29A 3V5ZA 1BR1A 5IY5C 3CZ6A 3RQGA 1FTSA 1ZU4A 2KQ9A 4U5HA 4RBNA 3L8IA 2QNLA 3C18A 3VYWA 4F4BA 3AGTA 3AG3C 4I1OB 2J7PD 3VAYA 2EPLX 4JJFA 1CGME 3O10A 1FNTc 2P7VA 3IEEA 3UMIA 4YT8A 2GDCA 4CS8C 2HSQA 1RKCA 3QMKA 4YL1A 3AG1C 3GEEA 2B0HA 4EIYA 4DJ9A 1U0BB 2FAPB 2HUJA 3JSZA 4GYTA 4XEFA 4XEVA 2VCAA 5DS6A 3IQ6A 5L0CA 2F22A 2Y3DA 4JEBA 4WJ0A 1FMVA 4MVUA 4I1MA 1BR4A 1ZW3A 2WVOA 2ICWG 5KYNA 4NC3A 3DJNB 1OCOC 2P61A 4FAPB 1K04A 4CJOA 4U5CE 3L34A 1YAUO 4G7ZF 1O5HA 5E3AA 1N1CA 5DS4A 3K33A 3U2LA 4P6IC 3BRJA 1G4US 3G4ZA 5EGYA 3CAXA 3RQFA 1VMAA 4BJ6C 4G7HF 3U9MA 2L9JA 3GWNA 4U9DA 3FAJA 2YL1A 3T6GB 2XXAA 2R7TA 3DD7A 1WGWA 4DVYP 2AWCA 4C3DA 2BC5A 3LUTB 4EBJA 4NCQA 5A6JA 4KI2A 1V55C 2LCHA 3HNIA 5HSWA 1L7CA 2J9UA 4M63A 4CSAC 1NU7D 2O9XA 1GM5A 1OXBA 3PMRA 2A0BA 1H9GA 1VOMA 1I4ZA 5CI9A 5BQHA 3E9VA 1NU9C 4Z9HA 3ZIBA 2KSFA 1Q0MA 4MVOA 4BJ5C 1QLEC 2PX3A 1TWHA 1R4TA 3LS1A 1A7VA 1LI5A 1D0ZA 2HZ8A 2EPKX 4ULWA 2HJ3A 4AX2A 4OD4A 2J8WA 2XLHA 1MNDA 3DMDA 1NFNA 1RKEA 3C8GA 1YVIA 2BE5F 2QY9A 2VCCA 4OD5A 2G3VA 2L6GA 3B29A 3ZDLA 3H2UA 3EGDA 4A4AA 4NY3A 2CCYA 5F5HA 1TR2A 3HKKA 1E2XA 3GODA 3A11A 4LLEA 5B1AC 3RVZA 3K1IA 1JMWA 3N0TA 1LVKA 1F1MA 3LLKA 1CPRA 1ZYRF 2XLOA 2YL7A 2X0CA 2CDQA 4XLPF 4MVQA 3B0UX 2JD3A 2PBEA 1JR8A 3FHDA 4FESA 4CS8A 4U9EA 2V26A 4CJGA 1M56C 2LSEA 1U89A 2R7QA 1JPNA 1YZAA 3GM1A 5L0JA 5KYXA 3KKBA 256BA 4JC7A 3NDBB 3JSEO 3OA1A 1CPQA 1PV3A 2AP3A 3B0PA 3DI5A 2LFFA 2R05A 1O3UA 3L0IA 3LJBA 4PFPA 2OCCC 2R02A 2LIGA
chains in the Genus database with same CATH topology
1J8MF 3UR3C 3JCUQ 4BJ6A 2W4MA 5KYWA 1OCZC 4XWJA 3E70C 4CSAA 3JT1A 2IOQA 2A68F 3HTKC 1LKXA 4G7OF 1G8XA 2XXAB 2Y3BA 1J8YF 5KYUA 2J45A 3I5PA 3JRTA 4DOZA 1TWGA 4LLCA 2R7VA 2C03A 3EFOA 4YWQA 3SP1A 2WVQA 2EIJC 4PJNA 2Q3TA 2QTVA 3FDQA 3TD7A 4FWVA 2HV6A 1NG1A 3NG1A 2PF4E 4BG0A 2PX0A 2ZXWC 3DAFA 2R7XA 2NG1A 1M2OA 4IAOA 3UNGC 4RDAA 3NYMA 3EGDB 4AE4A 1OKKA 4U5GA 3SNHA 4PK4A 3K7DA 4QDLA 3S0XA 1PD0A 2XL4A 2R7UA 2Y69C 3OWTA 5E2QA 4CBEA 5T3WA 4KC9A 1FMWA 2EINC 5KYXB 2IXNA 1OCCC 5L3VA 4C7OA 2KNHA 3K1HA 1TKNA 2CW0F 2J0XA 2WL8A 3EQLF 3RIPA 3S27A 2WZGA 3EG9A 1MNEA 1VK5A 3EH1A 1VYKA 5KYWB 4Q7CA 5CI8A 2DYSC 2C04A 3ABMC 2XSEA 2EIKC 1MMGA 2OG2A 5KYUB 3F47A 2M4EA 4B6IA 1M2VA 3LESA 2IXPA 3SEOA 2NUPA 3K6BA 3MLGA 4PJJA 4PFOA 2VH3A 3EFOB 3EZIA 4OIRF 4EWCA 3LAYA 2E87A 2H7OA 2FGYA 3WODF 2R7WA 3PHF2 1VYIA 1TWAA 4OINF 3N24A 5DQZA 5E33A 2H7BA 4EBBA 3N2ZB 3ABLC 4AE4B 4I44A 4E7SA 4PJMA 5EHHA 4IJJA 3FVYA 5FCLA 3I5QA 4HFFB 4U5BE 4A2NB 1MMAA 4MQ9F 4JJGA 3AQCA 2Q9BA 4JW1A 1D0XA 1MMNA 1OKKD 2Y3HA 4C7OB 3DM9B 3LEVA 4JZAA 4U5DE 3RFYA 3NYLA 4OIPF 4QI0A 2VASA 3M1CB 1D1AA 1ZHWA 3EG9B 4DBRA 2IYLD 2FFHA 2G62A 1TWCA 2R7RA 5BUOA 4DVZA 3T6JA 3AG2C 3NRHA 3POVA 4DBQA 1D0YA 1M2VB 1SZIA 2NUPB 2DGJA 2J0WA 4Q5SF 4BJ5A 2PFDA 4JVSA 3ZC4A 1ST6A 3W8IA 4H4KC 1QZXA 4HE8D 2YHSA 4K0DA 4YJWA 2WVNA 3X1OA 2Q9AA 2D5RB 5F5FA 1KU2A 2A69F 2ZXPA 4IRUA 1ZHYA 2KW3C 4YT5A 3QZCA 1Z63A 3RYLA 3GANA 4U5EE 2H7VC 4K7BA 5L3QA 3W2VA 1M57C 2NUTA 3W8HA 4Q4ZF 3EJNA 1LS1A 4LERA 4C3BA 3OEOA 3EHMA 4ZLCA 3DXJF 3ASNC 5D91A 3O39A 3ECSA 3ITFA 2G3KA 5B1BC 1D1BA 2VB6A 3DAGA 3I4UA 1ZHZA 2WZLA 4N06A 4YN0B 4GEHA 1RJ9A 2Y3GA 1OCRC 3CSKA 1SMYF 2WB7A 1D1CA 1W2WA 2Q9CA 5DQTA 4O6MA 2XRHA 2Z15A 3O6XA 4O6YA 2ZXRA 2J46A 3UMHA 4OIQF 3HLZA 3KL4A 2YZSA 4OIOF 3K1IC 4CIHA 1S7ZA 3DJUB 1ZHTA 3DM5A 2V3CC 5D92A 2EILC 3B0VC 3NKDA 4BEJA 4YT2A 2DYRC 1Z6AA 2A1DD 1Z3IX 2CNWA 2L81A 4C3EA 4BJ1A 3JYHA 4J32B 4E7ZA 2NUTB 5KYYA 3AG4C 3EZHA 3ABKC 2WZFA 3EH2A 4QI2A 2EIMC 3B9QA 2KJGA 2W45A 5T3TA 2ZXOA 2ZPAA 4ZLDA 3EGXA 3CQZA 4RD9A 3T4RA 2J9WA 2W9YA 3KMIA 4MNDA 3WG7C 2R7OA 3H65A 4JCHA 1PD1A 2IXOA 4KNWA 1RJ9B 3Q6MA 4I3MA 1FFTC 2X51A 5E3CA 2B0JA 1Z23A 1JPJA 4CS9C 2IXMA 3MX3A 2J7PA 3RH3A 4XLNF 4HEAJ 4W8KA 1Z5ZA 3NYJA 1ZU5A 2CGEA 4J30B 2R7SA 2A6HF 4XTKA 4FX5A 2HV7A 2PP4A 1ZHXA 1FFHA 2J9VA 3UGPA 4HFKB 3LS0A 5T1DB 3X2QC 4U5FE 4X0RA 5DLJA 3W2WA 2YEVA 3UMKA 4PJLA 3HJCA 1MMDA 3AQBA 3Q7GA 1O87A 2MWQA 3RKOF 5DS5A 4KNVA 2I8BA 4G0HA 4ANJA 5KYYB 3F46A 3NKEA 2P6VA 2MYSA 3SZRA 2GFHA 4BJTA 3KH2A 4O7GA 4O79A 4CS7A 3S28A 2CNWD 1V54C 3EPVA 3EGXB 3T6BA 4KBLA 1IW7F 3UGOA 3LNRA 3Q7LA 2Y39A 4CS9A 1IZMA 5DVWA 3ZSUA 1BR2A 3Q6NA 4YT4A 3EHNA 4JURI 3ASOC 4IWBA 5B3SC 2KGOA 4AK9A 3ZVRA 3LLIA 4LACB 3V7OA 2A6EF 3ZG1A 3SYNA 3K66A 1PCXA 3DZAA 1SF8A 1NZEA 4O6NA 3S29A 1BR1A 5IY5C 3CZ6A 1FTSA 1ZU4A 2KQ9A 4U5HA 4RBNA 3VYWA 4F4BA 3AG3C 4I1OB 2J7PD 3VAYA 4JJFA 2P7VA 3IEEA 3UMIA 4YT8A 4CS8C 3QMKA 3AG1C 3JSZA 4GYTA 5DS6A 2Y3DA 4WJ0A 1FMVA 4I1MA 1BR4A 2WVOA 5KYNA 3DJNB 1OCOC 4U5CE 3L34A 4G7ZF 1O5HA 5E3AA 1N1CA 5DS4A 3K33A 4P6IC 5EGYA 4G7HF 1VMAA 4BJ6C 2XXAA 2L9JA 3FAJA 2R7TA 3DD7A 1WGWA 4DVYP 4C3DA 4KI2A 1V55C 4CSAC 5HSWA 2J9UA 4M63A 1NU7D 2O9XA 3PMRA 5CI9A 1VOMA 3E9VA 1NU9C 3ZIBA 4BJ5C 1QLEC 2PX3A 1TWHA 3LS1A 4ULWA 1D0ZA 4AX2A 4OD4A 1MNDA 3DMDA 2BE5F 2QY9A 4OD5A 2G3VA 3EGDA 4NY3A 5F5HA 1TR2A 4LLEA 5B1AC 3GODA 3N0TA 1LVKA 3LLKA 1ZYRF 4XLPF 2CDQA 3B0UX 2JD3A 3FHDA 4FESA 4CS8A 2V26A 1M56C 2LSEA 2R7QA 1JPNA 5KYXA 3KKBA 3NDBB 3OA1A 3B0PA 3L0IA 3LJBA 4PFPA 2OCCC 2W4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OA1 A;  2WZL A;  1VYI A; 
#chains in the Genus database with same CATH topology
 1J8M F;  2L6H A;  3UR3 C;  1OR2 A;  3JCU Q;  4BJ6 A;  2W4M A;  3CEX A;  5KYW A;  1OCZ C;  4XWJ A;  1YA7 O;  2XM4 A;  1ZZP A;  3E70 C;  4CSA A;  3JT1 A;  2IOQ A;  2NSG A;  1Q0G A;  2A68 F;  1R5I D;  3HTK C;  3ATP A;  2GAQ A;  1YJG A;  4MVZ A;  1LKX A;  4G7O F;  1G8X A;  2XXA B;  4G78 A;  2Y3B A;  1J8Y F;  1GQA A;  5KYU A;  4EHP A;  4MW3 A;  2J45 A;  3I5P A;  4MVR A;  1OW6 A;  3JRT A;  4DOZ A;  1TWG A;  4LLC A;  5BQI A;  3KPH A;  1YDI A;  2R7V A;  3HNJ A;  2C03 A;  2Q4F A;  3EFO A;  3MYF A;  1LIH A;  4YL0 A;  3RF3 A;  3SP1 A;  2WVQ A;  2EIJ C;  2NPU A;  3NMJ A;  2HMQ A;  4JKV A;  4PJN A;  2Q3T A;  2QTV A;  2KK1 A;  3T9O A;  4XPY A;  3FDQ A;  2XLE A;  4XQ1 A;  1UFB A;  3TD7 A;  3VM6 A;  4FWV A;  2HV6 A;  1NG1 A;  3NG1 A;  2PF4 E;  1Y4C A;  2PX0 A;  3VF0 A;  4BG0 A;  2ZXW C;  3DAF A;  2R25 A;  2R7X A;  2NG1 A;  2OEV A;  1RKE B;  3C8G B;  1M2O A;  5FZT A;  1I4Y A;  2ETS A;  3JYY A;  4Z9I A;  1V74 B;  4IAO A;  3V5Y A;  3UNG C;  4RDA A;  3NYM A;  2XLM A;  3B71 A;  3EGD B;  2AWY A;  1OKK A;  4J7Y A;  4AE4 A;  4U5G A;  3SNH A;  4PK4 A;  3K7D A;  1WN0 A;  4QDL A;  3S0X A;  1PD0 A;  4LDK A;  2YL3 A;  3FMS A;  1LPE A;  1QVX A;  3FXH A;  2L7A A;  2XL4 A;  3BEH A;  4IAQ A;  2QUP A;  4H54 A;  1E85 A;  2R7U A;  2Y69 C;  2I15 A;  1HE1 A;  3OWT A;  3DE9 A;  5E2Q A;  5T3W A;  4CBE A;  1AVO B;  1XZQ A;  3C8G D;  4KC9 A;  1FMW A;  2EIN C;  5KYX B;  2IXN A;  1OCC C;  4L6R A;  5L3V A;  1RXQ A;  2KYH A;  4C7O A;  3M4B A;  1JOG A;  2KNH A;  2XL8 A;  1VB5 A;  3K1H A;  1TKN A;  2CW0 F;  2J0X A;  2WL8 A;  3EQL F;  3RIP A;  3S27 A;  3IHU A;  2R03 A;  1T9K A;  2LD6 A;  1B68 A;  2WZG A;  3QTH A;  1AUE A;  2YLD A;  4WAB A;  3U8V A;  1WAT A;  2A0U A;  1MNE A;  3EG9 A;  1VK5 A;  3EH1 A;  1VYK A;  2HMZ A;  1KNY A;  4Q7C A;  5KYW B;  2YWA A;  5CI8 A;  4GQH A;  2P0N A;  2DYS C;  2C04 A;  5A69 A;  3AGU A;  1C03 A;  3ABM C;  3AJM A;  1QPU A;  2XSE A;  2EIK C;  2BL2 A;  1MMG A;  2OG2 A;  1SR2 A;  1A7E A;  5KYU B;  2GA0 A;  4E17 A;  3DKA A;  3F47 A;  4MW8 A;  2M4E A;  4B6I A;  1M2V A;  1ORJ A;  3LES A;  2IXP A;  5EK0 A;  3SEO A;  2NUP A;  3K6B A;  3MLG A;  4N6C A;  3WAQ A;  4PJJ A;  1VTM P;  4PFO A;  1A41 A;  1S05 A;  1I5N A;  2VH3 A;  2YL0 A;  3EFO B;  3EZI A;  1VLS A;  3QVY A;  3MFN A;  4OIR F;  4EWC A;  3LAY A;  3GM3 A;  2E87 A;  2H7O A;  3C8Z A;  2FGY A;  1ZVZ A;  2HSB A;  3WOD F;  3V5X A;  3ZTZ A;  3PHF 2;  2R7W A;  2R9R B;  1NSG B;  3QVZ A;  1T01 A;  1VYI A;  2UUH A;  3U0C A;  1TWA A;  2XS1 A;  4OIN F;  5A6K A;  3N24 A;  3S84 A;  5DQZ A;  5E33 A;  3FAP B;  2H7B A;  4YL3 A;  3N2Z B;  3ABL C;  3TK0 A;  4EBB A;  1E83 A;  4AE4 B;  4I44 A;  3ZQY A;  3R2P A;  5JUA A;  4E7S A;  1MQV A;  1TFK B;  4PJM A;  5EHH A;  1EA8 A;  1U6H A;  4IJJ A;  3FVY A;  5FCL A;  3I5Q A;  4HFF B;  4BEM J;  4U5B E;  4A2N B;  1ZW2 A;  5COF A;  1MMA A;  2W4B A;  4MQ9 F;  5BQG A;  4JJG A;  3AQC A;  3US6 A;  2ZD9 A;  2Q9B A;  3IPM O;  4WGY A;  4JW1 A;  4JIO A;  1D0X A;  1MMN A;  4LDQ A;  4BPM A;  1FAP B;  1OKK D;  2Y3H A;  3IQ5 A;  4C7O B;  3DM9 B;  3RVY A;  3G4X A;  2LP4 A;  3LEV A;  3C62 A;  1AEP A;  4JZA A;  2P1A A;  4U5D E;  3RFY A;  3NYL A;  3SXZ A;  2AVK A;  4OIP F;  4QI0 A;  2VAS A;  3M1C B;  1D1A A;  1ZHW A;  3EG9 B;  1JAF A;  5TJ5 E;  4DBR A;  1RMV A;  2EPO A;  2OU6 A;  4JTD B;  3LEO A;  2IYL D;  2FFH A;  3NMI A;  5CIV A;  2G62 A;  3HNK A;  1TWC A;  4MTG A;  1HMO A;  2R7R A;  5BUO A;  2LQG A;  1T6Q A;  3GOR A;  3M15 A;  4DVZ A;  3JTL O;  3T6J A;  3U5S A;  3AG2 C;  2RSE B;  4NTB A;  3NRH A;  3POV A;  4DBQ A;  1HW2 A;  1D0Y A;  1WWP A;  3LNM B;  2YVK A;  1G5Z A;  3M4C A;  4XPX A;  4CX9 A;  1LM3 B;  1A7D A;  3ZWI A;  1M6T A;  1M2V B;  4MVM A;  1A0B A;  1SZI A;  2NUP B;  2DGJ A;  4ULV A;  1JRA A;  2J0W A;  4Q5S F;  3TOM A;  2PFD A;  4BJ5 A;  2HKV A;  4JVS A;  3ZC4 A;  1ST6 A;  2LFD A;  3W8I A;  4H4K C;  1QZX A;  4HE8 D;  2YHS A;  4K0D A;  4YJW A;  2WVN A;  3X1O A;  3U3F A;  2Q9A A;  4DRI B;  2D5R B;  5F5F A;  1KU2 A;  2A69 F;  2ZXP A;  4IRU A;  5L0I A;  3SXY A;  1HMD A;  1ZHY A;  2KW3 C;  4YT5 A;  1TFO B;  2JPU A;  3QZC A;  5JSL A;  3RYL A;  1Z63 A;  3GAN A;  3R7C A;  4MTF A;  4U5E E;  2RD9 A;  1LE2 A;  5A6A A;  2JX0 A;  1NFO A;  2H7V C;  4K7B A;  5L3Q A;  1Q0K A;  1EI7 A;  4CDV A;  2D4U A;  3TUL A;  4XEK A;  5JVE A;  2EPM X;  3W2V A;  1M57 C;  4P9T A;  2DI3 A;  2NUT A;  1QKR A;  3W8H A;  5L0H A;  1OW8 A;  2QE9 A;  3U3B A;  4Q4Z F;  4IB4 A;  1WAS A;  2OOC A;  3EJN A;  1Q0D A;  4NQF A;  3ZQV A;  4ER9 A;  1LS1 A;  3QW0 A;  4LER A;  3KYJ A;  1Z7Q c;  4C3B A;  3OEO A;  5JLI A;  3EHM A;  4ZLC A;  3HNL A;  2YLG A;  3DXJ F;  3ASN C;  3FOO A;  5D91 A;  1DOV A;  3O39 A;  3ECS A;  3ITF A;  2DB4 A;  4MTO A;  4UDV A;  2G3K A;  5B1B C;  1XZP A;  2OQM A;  5COG A;  1D1B A;  4AL0 A;  2VB6 A;  3DAG A;  3I4U A;  1YA9 A;  1ZHZ A;  2WZL A;  4N06 A;  4NTF A;  3SXM A;  4R32 A;  4YN0 B;  3WHN A;  4GEH A;  1RJ9 A;  3DWW A;  4D4N A;  2Y3G A;  1OCR C;  3FOP A;  1K05 A;  2XLW A;  3CSK A;  1H7I A;  4PR9 A;  1SMY F;  2MHR A;  2OJQ A;  2WB7 A;  3IQT A;  1D1C A;  1W2W A;  4WGZ A;  4MS2 A;  5L0D A;  2Q9C A;  3J06 A;  5DQT A;  2XM0 A;  2PNO A;  4O6M A;  3TOL A;  2XRH A;  2Z15 A;  3O6X A;  1HY5 A;  4O6Y A;  2ZXR A;  2J46 A;  1WTY A;  3UMH A;  4DXW A;  3HLZ A;  4OIQ F;  3KL4 A;  2YZS A;  3GM2 A;  3GWL A;  5F28 E;  4CDY A;  3S90 A;  3K1I C;  3C7J A;  1S7Z A;  4CIH A;  4OIO F;  1BBH A;  3DJU B;  5JP7 A;  1ZHT A;  3DM5 A;  4JE9 A;  3PCV A;  1HE9 A;  2AU5 A;  2XLD A;  1CGN A;  1YZC A;  2VCB A;  1H9T A;  1Y6D A;  2XLV A;  2V3C C;  4E18 A;  2M64 A;  2EIL C;  5D92 A;  3B0V C;  2ASR A;  2L6F A;  2XL6 A;  2YRF A;  1E84 A;  1EKY A;  3NKD A;  4BEJ A;  1UG7 A;  5JRA A;  1XWJ A;  4YT2 A;  2KC3 A;  2TMV P;  4LDR A;  3TQO A;  3U2M A;  2DYR C;  1VLT A;  2EPN A;  1Z6A A;  2A1D D;  3RW0 A;  3TJ6 A;  1Z3I X;  2CNW A;  2L81 A;  1OXK A;  4C3E A;  4BJ1 A;  1OR3 A;  3JYH A;  2YQY A;  3L8J A;  4J32 B;  5A6B A;  4XPW A;  2H8A A;  3IQC A;  3A9C A;  4E7Z A;  2NUT B;  5KYY A;  2Q7R A;  5GPG B;  1SYQ A;  1T6U A;  3AG4 C;  3EZH A;  5K0I A;  3ABK C;  4JTA B;  2WZF A;  3EH2 A;  4QI2 A;  4JRZ A;  3VRC A;  2EIM C;  3B9Q A;  2KJG A;  2W45 A;  5T3T A;  1DOW A;  2ZXO A;  4E0I A;  2ZPA A;  1EQ1 A;  5AC4 A;  3EGX A;  5L0F A;  4ZLD A;  3CQZ A;  1LS4 A;  4RD9 A;  1G4W R;  1TQG A;  2J9W A;  4Z9J A;  3S9O A;  3T4R A;  2W9Y A;  2IM8 A;  3KMI A;  1YLM A;  4MND A;  3WG7 C;  2R7O A;  3H65 A;  3PDM P;  4JCH A;  3W4Y A;  1PD1 A;  2IXO A;  4KNW A;  3H2V A;  1RJ9 B;  3Q6M A;  1T6I A;  4I3M A;  1GGQ A;  1FFT C;  1BZ4 A;  2LK4 A;  4K1O A;  5B3I A;  2X51 A;  5E3C A;  2B0J A;  3NMK A;  1Z23 A;  1JPJ A;  1WOL A;  4YK5 A;  4CS9 C;  2IXM A;  3MX3 A;  3GEI A;  2J7P A;  3RH3 A;  4XLN F;  4P9F A;  3TJ5 A;  4PAC A;  1ORY A;  2OEX A;  3U9J A;  4J7T A;  4HEA J;  1L3P A;  4W8K A;  1Z5Z A;  1CGO A;  3NYJ A;  4JTC B;  1ZU5 A;  2CGE A;  5JS5 A;  1C02 A;  4J30 B;  2R7S A;  2A6H F;  1QSP A;  1YAR O;  4XTK A;  5AGF A;  4FX5 A;  2HV7 A;  1E86 A;  2IBF A;  2PP4 A;  1KTM A;  1ZHX A;  2J9B A;  4CIP A;  1FFH A;  2HFI A;  2J9V A;  2YLI A;  3MYI A;  4N4W A;  5AC5 A;  3UGP A;  1K40 A;  4EKW A;  1T5O A;  4E0H A;  1FR0 A;  1LI7 A;  4HFK B;  1C17 M;  3LS0 A;  4IAR A;  5T1D B;  3GEH A;  3JZ0 A;  3X2Q C;  4U5F E;  4MVS A;  3ZTM A;  4EUK B;  1OQC A;  2HJM A;  4X0R A;  5DLJ A;  3W2W A;  2GWW A;  2YEV A;  4JCZ A;  3UMK A;  2OJE D;  2UUI A;  4PJL A;  1OW7 A;  3HJC A;  3DE8 A;  4N6H A;  1MMD A;  3AQB A;  5COM A;  4AL1 A;  1HW1 A;  3C63 A;  3Q7G A;  1O87 A;  2MWQ A;  3RKO F;  4DRH B;  2NSF A;  4IGG A;  5DS5 A;  4KNV A;  3G50 A;  2I8B A;  4G0H A;  4D4X A;  4NTA A;  1Q0F A;  2XS8 A;  1NBB A;  1ORS C;  4ONS A;  4ANJ A;  5KYY B;  3F46 A;  3MBG A;  1YYX A;  2P6V A;  1APC A;  2MYS A;  3NKE A;  3SZR A;  2GFH A;  2OKU A;  3JRM O;  4BJT A;  4CDA A;  3KH2 A;  4O7G A;  2VC9 A;  4O79 A;  4CS7 A;  3S28 A;  4JEA A;  2CNW D;  3O55 A;  3U8P A;  1V54 C;  3EPV A;  5L0G A;  3EGX B;  3T6B A;  4KBL A;  1IW7 F;  1H6G A;  5A6B D;  3UGO A;  1GS9 A;  3LNR A;  4EBK A;  3Q7L A;  3QW1 A;  3SXK A;  2Y39 A;  4CS9 A;  1IZM A;  1BDJ B;  5DVW A;  3RQE A;  3ZSU A;  1BR2 A;  3Q6N A;  3M79 A;  4YT4 A;  3EHN A;  3KYI A;  4JUR I;  4W8P A;  1V4A A;  3ASO C;  4IWB A;  5B3S C;  2KGO A;  4AK9 A;  2QLA A;  3ZVR A;  3LLI A;  4LAC B;  3V7O A;  1NLX A;  1YYJ A;  2A6E F;  3ZG1 A;  1LE4 A;  3SYN A;  4YWQ A;  1RCP A;  2HS5 A;  3K66 A;  2YKZ A;  3AOU A;  1PCX A;  5JT4 A;  1QQ3 A;  3DZA A;  5HV9 A;  1SF8 A;  3L1M A;  2Q00 A;  2CYD A;  4DRJ B;  1NZE A;  4O6N A;  3S29 A;  3V5Z A;  1BR1 A;  5IY5 C;  3CZ6 A;  3RQG A;  1FTS A;  1ZU4 A;  2KQ9 A;  4U5H A;  4RBN A;  3L8I A;  2QNL A;  3C18 A;  3VYW A;  4F4B A;  3AGT A;  3AG3 C;  4I1O B;  2J7P D;  3VAY A;  2EPL X;  4JJF A;  1CGM E;  3O10 A;  1FNT c;  2P7V A;  3IEE A;  3UMI A;  4YT8 A;  2GDC A;  4CS8 C;  2HSQ A;  1RKC A;  3QMK A;  4YL1 A;  3AG1 C;  3GEE A;  2B0H A;  4EIY A;  4DJ9 A;  1U0B B;  2FAP B;  2HUJ A;  3JSZ A;  4GYT A;  4XEF A;  4XEV A;  2VCA A;  5DS6 A;  3IQ6 A;  5L0C A;  2F22 A;  2Y3D A;  4JEB A;  4WJ0 A;  1FMV A;  4MVU A;  4I1M A;  1BR4 A;  1ZW3 A;  2WVO A;  2ICW G;  5KYN A;  4NC3 A;  3DJN B;  1OCO C;  2P61 A;  4FAP B;  1K04 A;  4CJO A;  4U5C E;  3L34 A;  1YAU O;  4G7Z F;  1O5H A;  5E3A A;  1N1C A;  5DS4 A;  3K33 A;  3U2L A;  4P6I C;  3BRJ A;  1G4U S;  3G4Z A;  5EGY A;  3CAX A;  3RQF A;  1VMA A;  4BJ6 C;  4G7H F;  3U9M A;  2L9J A;  3GWN A;  4U9D A;  3FAJ A;  2YL1 A;  3T6G B;  2XXA A;  2R7T A;  3DD7 A;  1WGW A;  4DVY P;  2AWC A;  4C3D A;  2BC5 A;  3LUT B;  4EBJ A;  4NCQ A;  5A6J A;  4KI2 A;  1V55 C;  2LCH A;  3HNI A;  5HSW A;  1L7C A;  2J9U A;  4M63 A;  4CSA C;  1NU7 D;  2O9X A;  1GM5 A;  1OXB A;  3PMR A;  2A0B A;  1H9G A;  1VOM A;  1I4Z A;  5CI9 A;  5BQH A;  3E9V A;  1NU9 C;  4Z9H A;  3ZIB A;  2KSF A;  1Q0M A;  4MVO A;  4BJ5 C;  1QLE C;  2PX3 A;  1TWH A;  1R4T A;  3LS1 A;  1A7V A;  1LI5 A;  1D0Z A;  2HZ8 A;  2EPK X;  4ULW A;  2HJ3 A;  4AX2 A;  4OD4 A;  2J8W A;  2XLH A;  1MND A;  3DMD A;  1NFN A;  1RKE A;  3C8G A;  1YVI A;  2BE5 F;  2QY9 A;  2VCC A;  4OD5 A;  2G3V A;  2L6G A;  3B29 A;  3ZDL A;  3H2U A;  3EGD A;  4A4A A;  4NY3 A;  2CCY A;  5F5H A;  1TR2 A;  3HKK A;  1E2X A;  3GOD A;  3A11 A;  4LLE A;  5B1A C;  3RVZ A;  3K1I A;  1JMW A;  3N0T A;  1LVK A;  1F1M A;  3LLK A;  1CPR A;  1ZYR F;  2XLO A;  2YL7 A;  2X0C A;  2CDQ A;  4XLP F;  4MVQ A;  3B0U X;  2JD3 A;  2PBE A;  1JR8 A;  3FHD A;  4FES A;  4CS8 A;  4U9E A;  2V26 A;  4CJG A;  1M56 C;  2LSE A;  1U89 A;  2R7Q A;  1JPN A;  1YZA A;  3GM1 A;  5L0J A;  5KYX A;  3KKB A;  256B A;  4JC7 A;  3NDB B;  3JSE O;  3OA1 A;  1CPQ A;  1PV3 A;  2AP3 A;  3B0P A;  3DI5 A;  2LFF A;  2R05 A;  1O3U A;  3L0I A;  3LJB A;  4PFP A;  2OCC C;  2R02 A;  2LIG A; 
#chains in the Genus database with same CATH homology
 1J8M F;  3UR3 C;  3JCU Q;  4BJ6 A;  2W4M A;  5KYW A;  1OCZ C;  4XWJ A;  3E70 C;  4CSA A;  3JT1 A;  2IOQ A;  2A68 F;  3HTK C;  1LKX A;  4G7O F;  1G8X A;  2XXA B;  2Y3B A;  1J8Y F;  5KYU A;  2J45 A;  3I5P A;  3JRT A;  4DOZ A;  1TWG A;  4LLC A;  2R7V A;  2C03 A;  3EFO A;  4YWQ A;  3SP1 A;  2WVQ A;  2EIJ C;  4PJN A;  2Q3T A;  2QTV A;  3FDQ A;  3TD7 A;  4FWV A;  2HV6 A;  1NG1 A;  3NG1 A;  2PF4 E;  4BG0 A;  2PX0 A;  2ZXW C;  3DAF A;  2R7X A;  2NG1 A;  1M2O A;  4IAO A;  3UNG C;  4RDA A;  3NYM A;  3EGD B;  4AE4 A;  1OKK A;  4U5G A;  3SNH A;  4PK4 A;  3K7D A;  4QDL A;  3S0X A;  1PD0 A;  2XL4 A;  2R7U A;  2Y69 C;  3OWT A;  5E2Q A;  4CBE A;  5T3W A;  4KC9 A;  1FMW A;  2EIN C;  5KYX B;  2IXN A;  1OCC C;  5L3V A;  4C7O A;  2KNH A;  3K1H A;  1TKN A;  2CW0 F;  2J0X A;  2WL8 A;  3EQL F;  3RIP A;  3S27 A;  2WZG A;  3EG9 A;  1MNE A;  1VK5 A;  3EH1 A;  1VYK A;  5KYW B;  4Q7C A;  5CI8 A;  2DYS C;  2C04 A;  3ABM C;  2XSE A;  2EIK C;  1MMG A;  2OG2 A;  5KYU B;  3F47 A;  2M4E A;  4B6I A;  1M2V A;  3LES A;  2IXP A;  3SEO A;  2NUP A;  3K6B A;  3MLG A;  4PJJ A;  4PFO A;  2VH3 A;  3EFO B;  3EZI A;  4OIR F;  4EWC A;  3LAY A;  2E87 A;  2H7O A;  2FGY A;  3WOD F;  2R7W A;  3PHF 2;  1VYI A;  1TWA A;  4OIN F;  3N24 A;  5DQZ A;  5E33 A;  2H7B A;  4EBB A;  3N2Z B;  3ABL C;  4AE4 B;  4I44 A;  4E7S A;  4PJM A;  5EHH A;  4IJJ A;  3FVY A;  5FCL A;  3I5Q A;  4HFF B;  4U5B E;  4A2N B;  1MMA A;  4MQ9 F;  4JJG A;  3AQC A;  2Q9B A;  4JW1 A;  1D0X A;  1MMN A;  1OKK D;  2Y3H A;  4C7O B;  3DM9 B;  3LEV A;  4JZA A;  4U5D E;  3RFY A;  3NYL A;  4OIP F;  4QI0 A;  2VAS A;  3M1C B;  1D1A A;  1ZHW A;  3EG9 B;  4DBR A;  2IYL D;  2FFH A;  2G62 A;  1TWC A;  2R7R A;  5BUO A;  4DVZ A;  3T6J A;  3AG2 C;  3NRH A;  3POV A;  4DBQ A;  1D0Y A;  1M2V B;  1SZI A;  2NUP B;  2DGJ A;  2J0W A;  4Q5S F;  4BJ5 A;  2PFD A;  4JVS A;  3ZC4 A;  1ST6 A;  3W8I A;  4H4K C;  1QZX A;  4HE8 D;  2YHS A;  4K0D A;  4YJW A;  2WVN A;  3X1O A;  2Q9A A;  2D5R B;  5F5F A;  1KU2 A;  2A69 F;  2ZXP A;  4IRU A;  1ZHY A;  2KW3 C;  4YT5 A;  3QZC A;  1Z63 A;  3RYL A;  3GAN A;  4U5E E;  2H7V C;  4K7B A;  5L3Q A;  3W2V A;  1M57 C;  2NUT A;  3W8H A;  4Q4Z F;  3EJN A;  1LS1 A;  4LER A;  4C3B A;  3OEO A;  3EHM A;  4ZLC A;  3DXJ F;  3ASN C;  5D91 A;  3O39 A;  3ECS A;  3ITF A;  2G3K A;  5B1B C;  1D1B A;  2VB6 A;  3DAG A;  3I4U A;  1ZHZ A;  2WZL A;  4N06 A;  4YN0 B;  4GEH A;  1RJ9 A;  2Y3G A;  1OCR C;  3CSK A;  1SMY F;  2WB7 A;  1D1C A;  1W2W A;  2Q9C A;  5DQT A;  4O6M A;  2XRH A;  2Z15 A;  3O6X A;  4O6Y A;  2ZXR A;  2J46 A;  3UMH A;  4OIQ F;  3HLZ A;  3KL4 A;  2YZS A;  4OIO F;  3K1I C;  4CIH A;  1S7Z A;  3DJU B;  1ZHT A;  3DM5 A;  2V3C C;  5D92 A;  2EIL C;  3B0V C;  3NKD A;  4BEJ A;  4YT2 A;  2DYR C;  1Z6A A;  2A1D D;  1Z3I X;  2CNW A;  2L81 A;  4C3E A;  4BJ1 A;  3JYH A;  4J32 B;  4E7Z A;  2NUT B;  5KYY A;  3AG4 C;  3EZH A;  3ABK C;  2WZF A;  3EH2 A;  4QI2 A;  2EIM C;  3B9Q A;  2KJG A;  2W45 A;  5T3T A;  2ZXO A;  2ZPA A;  4ZLD A;  3EGX A;  3CQZ A;  4RD9 A;  3T4R A;  2J9W A;  2W9Y A;  3KMI A;  4MND A;  3WG7 C;  2R7O A;  3H65 A;  4JCH A;  1PD1 A;  2IXO A;  4KNW A;  1RJ9 B;  3Q6M A;  4I3M A;  1FFT C;  2X51 A;  5E3C A;  2B0J A;  1Z23 A;  1JPJ A;  4CS9 C;  2IXM A;  3MX3 A;  2J7P A;  3RH3 A;  4XLN F;  4HEA J;  4W8K A;  1Z5Z A;  3NYJ A;  1ZU5 A;  2CGE A;  4J30 B;  2R7S A;  2A6H F;  4XTK A;  4FX5 A;  2HV7 A;  2PP4 A;  1ZHX A;  1FFH A;  2J9V A;  3UGP A;  4HFK B;  3LS0 A;  5T1D B;  3X2Q C;  4U5F E;  4X0R A;  5DLJ A;  3W2W A;  2YEV A;  3UMK A;  4PJL A;  3HJC A;  1MMD A;  3AQB A;  3Q7G A;  1O87 A;  2MWQ A;  3RKO F;  5DS5 A;  4KNV A;  2I8B A;  4G0H A;  4ANJ A;  5KYY B;  3F46 A;  3NKE A;  2P6V A;  2MYS A;  3SZR A;  2GFH A;  4BJT A;  3KH2 A;  4O7G A;  4O79 A;  4CS7 A;  3S28 A;  2CNW D;  1V54 C;  3EPV A;  3EGX B;  3T6B A;  4KBL A;  1IW7 F;  3UGO A;  3LNR A;  3Q7L A;  2Y39 A;  4CS9 A;  1IZM A;  5DVW A;  3ZSU A;  1BR2 A;  3Q6N A;  4YT4 A;  3EHN A;  4JUR I;  3ASO C;  4IWB A;  5B3S C;  2KGO A;  4AK9 A;  3ZVR A;  3LLI A;  4LAC B;  3V7O A;  2A6E F;  3ZG1 A;  3SYN A;  3K66 A;  1PCX A;  3DZA A;  1SF8 A;  1NZE A;  4O6N A;  3S29 A;  1BR1 A;  5IY5 C;  3CZ6 A;  1FTS A;  1ZU4 A;  2KQ9 A;  4U5H A;  4RBN A;  3VYW A;  4F4B A;  3AG3 C;  4I1O B;  2J7P D;  3VAY A;  4JJF A;  2P7V A;  3IEE A;  3UMI A;  4YT8 A;  4CS8 C;  3QMK A;  3AG1 C;  3JSZ A;  4GYT A;  5DS6 A;  2Y3D A;  4WJ0 A;  1FMV A;  4I1M A;  1BR4 A;  2WVO A;  5KYN A;  3DJN B;  1OCO C;  4U5C E;  3L34 A;  4G7Z F;  1O5H A;  5E3A A;  1N1C A;  5DS4 A;  3K33 A;  4P6I C;  5EGY A;  4G7H F;  1VMA A;  4BJ6 C;  2XXA A;  2L9J A;  3FAJ A;  2R7T A;  3DD7 A;  1WGW A;  4DVY P;  4C3D A;  4KI2 A;  1V55 C;  4CSA C;  5HSW A;  2J9U A;  4M63 A;  1NU7 D;  2O9X A;  3PMR A;  5CI9 A;  1VOM A;  3E9V A;  1NU9 C;  3ZIB A;  4BJ5 C;  1QLE C;  2PX3 A;  1TWH A;  3LS1 A;  4ULW A;  1D0Z A;  4AX2 A;  4OD4 A;  1MND A;  3DMD A;  2BE5 F;  2QY9 A;  4OD5 A;  2G3V A;  3EGD A;  4NY3 A;  5F5H A;  1TR2 A;  4LLE A;  5B1A C;  3GOD A;  3N0T A;  1LVK A;  3LLK A;  1ZYR F;  4XLP F;  2CDQ A;  3B0U X;  2JD3 A;  3FHD A;  4FES A;  4CS8 A;  2V26 A;  1M56 C;  2LSE A;  2R7Q A;  1JPN A;  5KYX A;  3KKB A;  3NDB B;  3OA1 A;  3B0P A;  3L0I A;  3LJB A;  4PFP A;  2OCC C;  2W4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...