1VYJA

Structural and biochemical studies of human pcna complexes provide the basis for association with cdk/cyclin and rationale for inhibitor design
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
257
structure length
257
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Studies of Human Proliferating Cell Nuclear Antigen Complexes Provide a Rationale for Cyclin Association and Inhibitor Design
pubmed doi rcsb
molecule keywords PROLIFERATING CELL NUCLEAR ANTIGEN
molecule tags Dna binding protein
source organism Homo sapiens
total genus 64
structure length 257
sequence length 257
chains with identical sequence C, E, G, I, K
ec nomenclature
pdb deposition date 2004-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 1vyjA00
3GPMA 5IWDA 3U61F 2ZVWA 5JNED 3G65B 2HIIB 2IO4B 5E0VA 1W60A 2IX2A 4TR6A 1B77A 3FDSD 1RXZA 3VKXA 1RWZA 1PLQA 1UD9A 1IZ4A 2IX2C 2Z0LA 3GGRA 1ISQA 1T6LA 5E0UA 3I2MX 5HACA 3U60F 3FDSC 2ZVVA 1VYMA 2HIKA 3AIZA 2ZVMA 1UL1A 3WGWA 1GE8A 5DAIA 4RJFA 4ZTDA 4HK1A 1RXMA 2NTIA 1U7BA 3K4XA 3A1JA 3AIZC 3P87A 3V61B 5A6DA 3A1JC 1SXJF 2IZOB 5CFKA 2ZVLA 1YYPA 3F1WA 1AXCA 2AVTA 3IFVA 4L60A 3AIXB 2AWAA 5AUJA 3GGRC 3G65A 2HIIA 2IO4A 1B8HA 5IXAA 2HIKC 3A2FB 1DMLA 2IX2B 3G65C 5DA7A 3V62B 2OD8A 5B7OA 5H0TA 3TBLA 4D2GA 2NTIC 4CS5A 3P83A 1U76A 3GPNA 3P91A 3GGRB 3V60B 2IJXA 2HIKB 1VYJA 3U5ZF 5IY4A 3HI8A 2NTIB 3A1JB 3LX1A 2HIIC 4YHRA 1IZ5A 5E0TA 3AIXA 1PLRA 2IZOC 2ZVKA 3LX2A 1CZDA 3HSLX 4L6PA
chains in the Genus database with same CATH superfamily
3GPMA 5IWDA 3U61F 2ZVWA 5JNED 3G65B 2HIIB 2IO4B 5E0VA 1W60A 2IX2A 4TR6A 1B77A 3FDSD 1RXZA 3VKXA 1RWZA 1PLQA 1UD9A 1IZ4A 2IX2C 2Z0LA 3GGRA 1ISQA 1T6LA 5E0UA 3I2MX 5HACA 3U60F 3FDSC 2ZVVA 1VYMA 2HIKA 3AIZA 2ZVMA 1UL1A 3WGWA 1GE8A 5DAIA 4RJFA 4ZTDA 4HK1A 1RXMA 2NTIA 1U7BA 3K4XA 3A1JA 3AIZC 3P87A 3V61B 5A6DA 3A1JC 1SXJF 2IZOB 5CFKA 2ZVLA 1YYPA 3F1WA 1AXCA 2AVTA 3IFVA 4L60A 3AIXB 2AWAA 5AUJA 3GGRC 3G65A 2HIIA 2IO4A 1B8HA 5IXAA 2HIKC 3A2FB 1DMLA 2IX2B 3G65C 5DA7A 3V62B 2OD8A 5B7OA 5H0TA 3TBLA 4D2GA 2NTIC 4CS5A 3P83A 1U76A 3GPNA 3P91A 3GGRB 3V60B 2IJXA 2HIKB 1VYJA 3U5ZF 5IY4A 3HI8A 2NTIB 3A1JB 3LX1A 2HIIC 4YHRA 1IZ5A 5E0TA 3AIXA 1PLRA 2IZOC 2ZVKA 3LX2A 1CZDA 3HSLX 4L6PA
chains in the Genus database with same CATH topology
3GPMA 5IWDA 3U61F 2ZVWA 5JNED 3G65B 2HIIB 2IO4B 5E0VA 1W60A 2IX2A 4TR6A 1B77A 3FDSD 1RXZA 3VKXA 1RWZA 1PLQA 1UD9A 1IZ4A 2IX2C 2Z0LA 3GGRA 1ISQA 1T6LA 5E0UA 3I2MX 5HACA 3U60F 3FDSC 2ZVVA 1VYMA 2HIKA 3AIZA 2ZVMA 1UL1A 3WGWA 1GE8A 5DAIA 4RJFA 4ZTDA 4HK1A 1RXMA 2NTIA 1U7BA 3K4XA 3A1JA 3AIZC 3P87A 3V61B 5A6DA 3A1JC 1SXJF 2IZOB 5CFKA 2ZVLA 1YYPA 3F1WA 1AXCA 2AVTA 3IFVA 4L60A 3AIXB 2AWAA 5AUJA 3GGRC 3G65A 2HIIA 2IO4A 1B8HA 5IXAA 2HIKC 3A2FB 1DMLA 2IX2B 3G65C 5DA7A 3V62B 2OD8A 5B7OA 5H0TA 3TBLA 4D2GA 2NTIC 4CS5A 3P83A 1U76A 3GPNA 3P91A 3GGRB 3V60B 2IJXA 2HIKB 1VYJA 3U5ZF 5IY4A 3HI8A 2NTIB 3A1JB 3LX1A 2HIIC 4YHRA 1IZ5A 5E0TA 3AIXA 1PLRA 2IZOC 2ZVKA 3LX2A 1CZDA 3HSLX 4L6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPM A;  5IWD A;  3U61 F;  2ZVW A;  5JNE D;  3G65 B;  2HII B;  2IO4 B;  5E0V A;  1W60 A;  2IX2 A;  4TR6 A;  1B77 A;  3FDS D;  1RXZ A;  3VKX A;  1RWZ A;  1PLQ A;  1UD9 A;  1IZ4 A;  2IX2 C;  2Z0L A;  3GGR A;  1ISQ A;  1T6L A;  5E0U A;  3I2M X;  5HAC A;  3U60 F;  3FDS C;  2ZVV A;  1VYM A;  2HIK A;  3AIZ A;  2ZVM A;  1UL1 A;  3WGW A;  1GE8 A;  5DAI A;  4RJF A;  4ZTD A;  4HK1 A;  1RXM A;  2NTI A;  1U7B A;  3K4X A;  3A1J A;  3AIZ C;  3P87 A;  3V61 B;  5A6D A;  3A1J C;  1SXJ F;  2IZO B;  5CFK A;  2ZVL A;  1YYP A;  3F1W A;  1AXC A;  2AVT A;  3IFV A;  4L60 A;  3AIX B;  2AWA A;  5AUJ A;  3GGR C;  3G65 A;  2HII A;  2IO4 A;  1B8H A;  5IXA A;  2HIK C;  3A2F B;  1DML A;  2IX2 B;  3G65 C;  5DA7 A;  3V62 B;  2OD8 A;  5B7O A;  5H0T A;  3TBL A;  4D2G A;  2NTI C;  4CS5 A;  3P83 A;  1U76 A;  3GPN A;  3P91 A;  3GGR B;  3V60 B;  2IJX A;  2HIK B;  1VYJ A;  3U5Z F;  5IY4 A;  3HI8 A;  2NTI B;  3A1J B;  3LX1 A;  2HII C;  4YHR A;  1IZ5 A;  5E0T A;  3AIX A;  1PLR A;  2IZO C;  2ZVK A;  3LX2 A;  1CZD A;  3HSL X;  4L6P A; 
#chains in the Genus database with same CATH topology
 3GPM A;  5IWD A;  3U61 F;  2ZVW A;  5JNE D;  3G65 B;  2HII B;  2IO4 B;  5E0V A;  1W60 A;  2IX2 A;  4TR6 A;  1B77 A;  3FDS D;  1RXZ A;  3VKX A;  1RWZ A;  1PLQ A;  1UD9 A;  1IZ4 A;  2IX2 C;  2Z0L A;  3GGR A;  1ISQ A;  1T6L A;  5E0U A;  3I2M X;  5HAC A;  3U60 F;  3FDS C;  2ZVV A;  1VYM A;  2HIK A;  3AIZ A;  2ZVM A;  1UL1 A;  3WGW A;  1GE8 A;  5DAI A;  4RJF A;  4ZTD A;  4HK1 A;  1RXM A;  2NTI A;  1U7B A;  3K4X A;  3A1J A;  3AIZ C;  3P87 A;  3V61 B;  5A6D A;  3A1J C;  1SXJ F;  2IZO B;  5CFK A;  2ZVL A;  1YYP A;  3F1W A;  1AXC A;  2AVT A;  3IFV A;  4L60 A;  3AIX B;  2AWA A;  5AUJ A;  3GGR C;  3G65 A;  2HII A;  2IO4 A;  1B8H A;  5IXA A;  2HIK C;  3A2F B;  1DML A;  2IX2 B;  3G65 C;  5DA7 A;  3V62 B;  2OD8 A;  5B7O A;  5H0T A;  3TBL A;  4D2G A;  2NTI C;  4CS5 A;  3P83 A;  1U76 A;  3GPN A;  3P91 A;  3GGR B;  3V60 B;  2IJX A;  2HIK B;  1VYJ A;  3U5Z F;  5IY4 A;  3HI8 A;  2NTI B;  3A1J B;  3LX1 A;  2HII C;  4YHR A;  1IZ5 A;  5E0T A;  3AIX A;  1PLR A;  2IZO C;  2ZVK A;  3LX2 A;  1CZD A;  3HSL X;  4L6P A; 
#chains in the Genus database with same CATH homology
 3GPM A;  5IWD A;  3U61 F;  2ZVW A;  5JNE D;  3G65 B;  2HII B;  2IO4 B;  5E0V A;  1W60 A;  2IX2 A;  4TR6 A;  1B77 A;  3FDS D;  1RXZ A;  3VKX A;  1RWZ A;  1PLQ A;  1UD9 A;  1IZ4 A;  2IX2 C;  2Z0L A;  3GGR A;  1ISQ A;  1T6L A;  5E0U A;  3I2M X;  5HAC A;  3U60 F;  3FDS C;  2ZVV A;  1VYM A;  2HIK A;  3AIZ A;  2ZVM A;  1UL1 A;  3WGW A;  1GE8 A;  5DAI A;  4RJF A;  4ZTD A;  4HK1 A;  1RXM A;  2NTI A;  1U7B A;  3K4X A;  3A1J A;  3AIZ C;  3P87 A;  3V61 B;  5A6D A;  3A1J C;  1SXJ F;  2IZO B;  5CFK A;  2ZVL A;  1YYP A;  3F1W A;  1AXC A;  2AVT A;  3IFV A;  4L60 A;  3AIX B;  2AWA A;  5AUJ A;  3GGR C;  3G65 A;  2HII A;  2IO4 A;  1B8H A;  5IXA A;  2HIK C;  3A2F B;  1DML A;  2IX2 B;  3G65 C;  5DA7 A;  3V62 B;  2OD8 A;  5B7O A;  5H0T A;  3TBL A;  4D2G A;  2NTI C;  4CS5 A;  3P83 A;  1U76 A;  3GPN A;  3P91 A;  3GGR B;  3V60 B;  2IJX A;  2HIK B;  1VYJ A;  3U5Z F;  5IY4 A;  3HI8 A;  2NTI B;  3A1J B;  3LX1 A;  2HII C;  4YHR A;  1IZ5 A;  5E0T A;  3AIX A;  1PLR A;  2IZO C;  2ZVK A;  3LX2 A;  1CZD A;  3HSL X;  4L6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...