1VYNA

Structure and nucleic acid binding of the drosophila argonaute2 paz domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
117
structure length
117
Chain Sequence
AMPMIEYLERFSLKAKINNTTNLDYSRRFLEPFLRGINVVYTPPQSFQSAPRVYRVNGLSRAPASSETFEHDGKKVTIASYFHSRNYPLKFPQLHCLNVGSSIKSILLPIELCSIEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARGONAUTE2
publication title Structure and nucleic-acid binding of the Drosophila Argonaute 2 PAZ domain.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Nucleic acid binding
total genus 21
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2004-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 1vynA00
4NGDA 4Z4CA 4NGCA 1R4KA 4W5NA 5KI6A 4Z4EA 4Z4FA 2FFLA 4NHAA 4F3TA 4KREA 4NGBA 4OLAA 4W5TA 2XFMA 3O7VX 5JS1A 4W5OA 3MJ0A 3QIRA 1R6ZA 1T2SA 4NGFA 1VYNA 2QVWA 4W5RA 1SI3A 4Z4IA 4KRFA 5T7BA 1SI2A 3O6EX 4NH3A 5JS2A 4Z4HA 4NGGA 4W5QA 4OLBA 3O7XA 4NH5A 2L5DA 2L5CA 4NH6A 1T2RA 4Z4GA 3O3IX
chains in the Genus database with same CATH superfamily
4NGDA 4Z4CA 4NGCA 1R4KA 4W5NA 5KI6A 3DLBA 4Z4EA 4Z4FA 2FFLA 4NHAA 4F3TA 1Z26A 4KREA 3DA5A 4NGBA 4OLAA 4W5TA 2XFMA 3O7VX 2DB9A 5JS1A 4W5OA 3MJ0A 3QIRA 1R6ZA 1T2SA 4NGFA 1VYNA 2QVWA 4W5RA 3DLHA 1SI3A 4Z4IA 4KRFA 5T7BA 3HVRA 1SI2A 3HM9A 2BZEA 3O6EX 3HJFA 4NH3A 1U04A 5JS2A 4Z4HA 4L1PA 1Z25A 3F73A 3HK2A 3HO1A 4W5QA 4OLBA 4NGGA 3U1UA 3O7XA 4NH5A 2L5DA 2L5CA 4NH6A 1T2RA 4L1UA 4Z4GA 3O3IX
chains in the Genus database with same CATH topology
4NGDA 4Z4CA 4NGCA 1R4KA 4W5NA 5KI6A 3DLBA 4Z4EA 4Z4FA 2FFLA 4NHAA 4F3TA 1Z26A 4KREA 3DA5A 4NGBA 4OLAA 4W5TA 2XFMA 3O7VX 2DB9A 5JS1A 4W5OA 3MJ0A 3QIRA 1R6ZA 1T2SA 4NGFA 1VYNA 2QVWA 4W5RA 3DLHA 1SI3A 4Z4IA 4KRFA 5T7BA 3HVRA 1SI2A 3HM9A 2BZEA 3O6EX 3HJFA 4NH3A 1U04A 5JS2A 4Z4HA 4L1PA 1Z25A 3F73A 3HK2A 3HO1A 4W5QA 4OLBA 4NGGA 3U1UA 3O7XA 4NH5A 2L5DA 2L5CA 4NH6A 1T2RA 4L1UA 4Z4GA 3O3IX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGD A;  4Z4C A;  4NGC A;  1R4K A;  4W5N A;  5KI6 A;  4Z4E A;  4Z4F A;  2FFL A;  4NHA A;  4F3T A;  4KRE A;  4NGB A;  4OLA A;  4W5T A;  2XFM A;  3O7V X;  5JS1 A;  4W5O A;  3MJ0 A;  3QIR A;  1R6Z A;  1T2S A;  4NGF A;  1VYN A;  2QVW A;  4W5R A;  1SI3 A;  4Z4I A;  4KRF A;  5T7B A;  1SI2 A;  3O6E X;  4NH3 A;  5JS2 A;  4Z4H A;  4NGG A;  4W5Q A;  4OLB A;  3O7X A;  4NH5 A;  2L5D A;  2L5C A;  4NH6 A;  1T2R A;  4Z4G A;  3O3I X; 
#chains in the Genus database with same CATH topology
 4NGD A;  4Z4C A;  4NGC A;  1R4K A;  4W5N A;  5KI6 A;  3DLB A;  4Z4E A;  4Z4F A;  2FFL A;  4NHA A;  4F3T A;  1Z26 A;  4KRE A;  3DA5 A;  4NGB A;  4OLA A;  4W5T A;  2XFM A;  3O7V X;  2DB9 A;  5JS1 A;  4W5O A;  3MJ0 A;  3QIR A;  1R6Z A;  1T2S A;  4NGF A;  1VYN A;  2QVW A;  4W5R A;  3DLH A;  1SI3 A;  4Z4I A;  4KRF A;  5T7B A;  3HVR A;  1SI2 A;  3HM9 A;  2BZE A;  3O6E X;  3HJF A;  4NH3 A;  1U04 A;  5JS2 A;  4Z4H A;  4L1P A;  1Z25 A;  3F73 A;  3HK2 A;  3HO1 A;  4W5Q A;  4OLB A;  4NGG A;  3U1U A;  3O7X A;  4NH5 A;  2L5D A;  2L5C A;  4NH6 A;  1T2R A;  4L1U A;  4Z4G A;  3O3I X; 
#chains in the Genus database with same CATH homology
 4NGD A;  4Z4C A;  4NGC A;  1R4K A;  4W5N A;  5KI6 A;  3DLB A;  4Z4E A;  4Z4F A;  2FFL A;  4NHA A;  4F3T A;  1Z26 A;  4KRE A;  3DA5 A;  4NGB A;  4OLA A;  4W5T A;  2XFM A;  3O7V X;  2DB9 A;  5JS1 A;  4W5O A;  3MJ0 A;  3QIR A;  1R6Z A;  1T2S A;  4NGF A;  1VYN A;  2QVW A;  4W5R A;  3DLH A;  1SI3 A;  4Z4I A;  4KRF A;  5T7B A;  3HVR A;  1SI2 A;  3HM9 A;  2BZE A;  3O6E X;  3HJF A;  4NH3 A;  1U04 A;  5JS2 A;  4Z4H A;  4L1P A;  1Z25 A;  3F73 A;  3HK2 A;  3HO1 A;  4W5Q A;  4OLB A;  4NGG A;  3U1U A;  3O7X A;  4NH5 A;  2L5D A;  2L5C A;  4NH6 A;  1T2R A;  4L1U A;  4Z4G A;  3O3I X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...