1VYOA

Crystal structure of avidin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
121
structure length
121
Chain Sequence
b'KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AVIDIN
publication title Binding Properties of Haba-Type Azo Derivatives to Avidin and Avidin-Related Protein 4.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Glycoprotein
total genus 29
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1vyoA00
4Z28A 2QCBA 3VGWA 2RTPB 1RXJA 2IZFB 1NQNA 1RSUB 3PK2A 1NC9A 2RTHB 1HQQA 2OF8A 4Y59A 1VWIB 1VWMB 1SWAA 2MF6A 2Y3EA 2RTIB 1LCVA 4Z27A 3RDSA 4CPIA 1AVEA 2RTCB 1NQMA 1N9MA 1LCZA 2A5BA 1LELA 4JO6A 5IRAA 3RDXA 1SWHA 1SWFA 1STPA 1HY2A 4CPHB 2RTBB 2RTNB 3VHMA 5B5GA 1VWQB 2C4IA 2JGSA 4GGZA 1SLGB 3SZIA 2FHLA 1SWLA 4JHQA 1SWSA 4GJSA 2IZAA 2BC3A 2IZBA 3MM0A 2OF9A 5L3YA 1MOYA 2RTFB 1SWGA 1STSB 2RTLA 4EKVA 1Y53X 1SRFA 1KL3A 1SLFB 2FHNX 1RSTB 3SZJA 1SWKA 1RXHA 5CHKA 3RDUA 4GGRA 2IZIA 3T6LA 3WZQA 1LCWA 1VWGB 1Y52X 1SRJA 1VWPB 2GH7A 2UYWA 4CPEA 4Z2VA 1HXLA 2RTDB 3T2WA 1LUQA 1N9YA 2IZHB 3T6FA 1SWBA 1I9HA 4BJ8A 1HXZA 2A5CA 2IZGB 2C1QA 2RTJA 3WYPA 4Z6JA 1PTSA 1VYOA 2UZ2A 4Y5DA 1DF8A 2RTMA 3WZPA 1SWNA 3RE5A 2Y32A 5IRWA 4DNEA 1VWKB 4JNJA 5F2BA 5K68A 1LDOA 1VWFB 2OFBA 2F01A 4YVBA 1SRIA 1SWUA 1VWOB 2IZLB 4IRWA 4GDAA 3VHIA 1VWJB 4GGTA 1N7YA 1SWCA 2WPUA 4Z2PA 1VWHB 1Y55X 2OFAA 1SLDB 3VHHA 5K67A 1VWAB 1WBIA 3MG5A 1KL5A 5IRUA 3RDQA 1VWCB 3RE6A 1SRGA 3RDOA 3WYQA 1SWDA 3WZOA 2IZEB 1VWDB 1VWNB 1VWEB 3T2XA 1SWJA 1KL4A 1VWBB 1N43A 2IZKA 1SWRA 1MM9A 3EW1A 1IJ8A 1SWEA 4CPFA 1N4JA 1SWPA 2IZDB 1NDJA 4GJVA 1SLEB 2ZSCA 1MK5A 1VWLB 3RDMA 4I60A 4BX7A 2C1SA 2RTAA 2A8GA 2RTQB 5JD2A 1RXKA 2CAMA 4GD9A 4BX5A 1AVDA 1STRB 1LDQA 4BX7B 5B5FA 1SWQA 1NBXA 4BBOA 1SRHA 1SWOA 1KFFA 4BX5B 4CPHA 4BX6A 1SREA 1SWTA 4Z2OA 2RTRB 2Y3FA 3SZHA 3RY1A 3WZNA 3EW2A 2RTKA 4U46A 5CSEA 1RAVA 4BX6B 4OKAA 2RTEB 4BCSA 2AVIA 2RTGB 1VWRB 3RY2A 1MEPA 2RTOB 2IZJA 2G5LA 3FDCA 3X00A 2IZCB
chains in the Genus database with same CATH superfamily
1W6FA 3CBCA 3NX1A 2RTPB 4O3YA 3Q34A 3FYFA 3C77X 1RSUB 1BEBA 1NC9A 2MWHA 2OFMX 2RTHB 4U8UM 4NLIA 3EYCA 3D97A 1VWIB 3FA7A 5D4AA 3CQNA 2MF6A 2A3FX 3RDSA 3WJBA 1E2TA 1SXYA 2OL8O 4WFUA 4ZJ0A 1DV9A 1LCZA 1FE3A 2ALLX 3S5XA 5IRAA 1LIFA 2FGSA 3VG3A 2DM5A 1EALA 2RTNB 3VHMA 4Y0PA 4O3WA 1ALBA 4GNWA 1VWQB 2Q2MA 2LBVA 4HFOA 4I3DA 3BS2A 2KTSA 3KQ0A 4GRJA 2IZAA 3V8UA 2HZQA 3ZW1A 3APWA 3MM0A 1MX7A 1GT5A 2OY1O 1OEKA 2RA6A 1OSPO 5LJHA 3FA9A 3GE2A 5AJCA 3S26A 4ZR2A 3ZW1B 1A57A 1SWGA 2RTLA 3BX8A 4R0BA 2W2BA 5FAZA 3VPJE 4ZHCA 4MVEA 2PI3O 3HOLA 3ZW0A 2R56A 2E4JA 1UREA 3F8AA 1RXHA 4L1NA 2A2UA 4XMDA 4YKOA 3RDUA 3T6LA 3TZSA 4YFQA 1Y52X 3SOTA 1SRJA 3ZW0B 1HXLA 4COTA 4I3CA 2HYSA 4U8UN 3ELXA 4L3RA 2GTLO 2IZHB 3T6FA 1YWDA 1I9HA 3VE2A 1B0OA 2K23A 2Z4IA 1FELA 3B2KA 3HTYA 2AT5X 4IB9A 1LIEA 1GT3A 3FEPA 3P6DA 5AEOA 3I17A 1IFCA 2AT6X 1VYOA 4TJZA 4Y5DA 1DF8A 2W2FA 4YDAA 1B56A 5HBSA 3U9PC 1SWNA 3WZPA 1KZWA 3FEKA 4I95A 5H9NA 1O1VA 4IMOA 3FELA 4JNJA 4OMWA 4YFPA 4ALBA 3ZUOA 1JJXA 2RCQA 1AVGI 1N0SA 1IKJA 4JGLA 1AB0A 4YKMA 2L5PA 2KD2A 1E5PA 1ZNKA 4EEJA 4INNA 1OBUA 2IZLB 1TOUA 2BHVA 2FRSA 1QY2A 2MJIA 4GDZA 1G5WA 4GZVA 1JYJA 2MM3A 4LZUA 2OFRX 1CBIA 5D48A 4U3QA 4TKBA 3NPOA 1Y55X 2OFAA 1VYGA 2W2AA 4NV7A 4HPDA 2BLGA 3P02A 2FWVA 4LZVA 3TF6A 3VG7A 5K67A 1I04A 5IRUA 2G7BA 5HCDC 1K3BA 1SRGA 2X4MA 5DG4A 1ZRYA 1SWDA 1YP6A 1U17A 2N93A 4QQ1A 1VWDB 4UU2A 3NADA 1IIUA 3ZQ3A 3BLGA 1CBQA 5FFHA 1MX8A 3O19A 2OL7A 1HMTA 1JV4A 1O1UA 2LA7A 1MM9A 1IJ8A 4GJVA 1NDJA 4CDFA 1SLEB 3KFGA 4QZTA 1XCAA 1YIVA 1VYFA 3EBKA 2HKDA 4ML7B 3SLOA 1VWLB 2NP1A 4GE1A 4I60A 3B2IA 2C1SA 4XMHA 5D47A 4AZMA 1ERXA 4ORXA 4BX7A 1KXOA 3KFFA 4WBKA 1KQWA 2DJFA 2JOZA 2AL0X 3BDRA 4BX7B 1SWQA 4CPHA 4KCAA 1KZXA 4ZGFA 2P8GA 1ACDA 4QGXA 3FW5A 2GJ5A 4KH8A 5HWZA 4KC8A 3JSQA 3KFHA 1RAVA 1QFVA 3PH6A 3ZZVA 3UEWA 4BCSA 1AQBA 3GAQA 1VWRB 2QOSC 1EIOA 4BGFA 4QGWA 2VFBA 3SAOA 1I4UA 3OE3A 4Z28A 3VGWA 4ARHA 5BYPA 4O3XB 4Y0SA 1QG5A 2IZFB 1H91A 1NQNA 1JYDA 3PK2A 4WHIA 4MVIA 5FQ8E 4ZHDA 4QGVA 1JJJA 2FKGA 1KOIA 3CQRA 3FA6A 4A60A 2RQ0A 1IFBA 1RLBE 1AVEA 4CPIA 4ZH6A 3CMPA 1EI5A 5HZ5A 1LELA 2ASNX 4ZCBA 4FBRA 1SWFA 1LNMA 1W5RA 2WR6A 3D95A 2GTLN 3HWEA 5B10O 1SA8A 4TQ2A 1HY2A 1ZNEA 2LKKA 1S2PA 3PDFA 4B55A 2RD7C 5L8OA 2C4IA 2JGSA 5F1EA 1SLGB 2A13A 4AW8A 4NV8A 1PBOA 2RCTA 4RUNA 4C5PA 2IZBA 3HWFA 2OF9A 1O8VA 2DJGA 3SLJA 4YCEA 5B3MO 4MEEA 1X89A 5B11O 1LFOA 2AH7X 1SRFA 1KL3A 1SY1A 2ACPX 1OBPA 5LJGA 1RSTB 1SXWA 4ORYA 4TLJA 2RN4A 1QFTA 2IZIA 3TGAA 5HTEA 1ADLA 2UYWA 5H8TA 3F6ZB 3T2WA 5F58A 1LUQA 2ZAIA 1YWCA 1OPAA 1MVGA 3RWXA 5L8IA 4XMCA 1Z24A 4NNTA 1LICA 2ZAGA 2OY7A 4ORSA 1BSYA 1Y0GA 2C1QA 2X32A 3WYPA 3ZWEA 3FR4A 3IA8A 4Z6JA 2RTMA 4I9SA 3MVFA 2HZRA 4N7DA 2Y32A 1FDQA 3PQUA 4KC7A 3B2JA 1VPRA 5F2BA 3TGBA 2OFBA 1S7DA 3WJCA 4CSBA 1BJ7A 3Q6LA 2Z4HA 4YCHA 3B2HA 3STNA 1OPBA 1EW3A 1SRIA 4Y0QA 2QO5A 4AZQA 4A1HA 1VWOB 2CM4A 4IRWA 3RBYA 4GDAA 4NYRA 3BRNA 2POAA 4U9CA 2OY5O 3O22A 2JN3A 2A0AA 3PEDA 5C0NA 2FS7A 2L68A 2JU3A 5B2AO 2WEXA 1LF7A 1T68X 2X45A 3UEUA 1L6MA 4EFGA 2ANSA 4O4UA 1KL5A 4YGHA 3RE6A 1EPAA 3RDOA 4ZGUA 1YP7A 4GK9A 3WZOA 1JIWI 4YH0A 3S5VA 1X8PA 4HPCA 4QZUA 2BS6A 4IAXA 1JBHA 3UAQA 1VWNB 1VWEB 4QAEA 4CDCA 1ICMA 1KL4A 4OS3A 4FQBB 1X8NA 1N43A 1SWRA 5CYBA 3EW1A 1SWEA 3FR2A 4CPFA 3FR5A 1N4JA 1SWPA 3OBLA 4IMNA 2FS6A 4EDEA 1YWAA 5LJBA 5JR8A 3NQKA 5KHPA 2JMBA 1LKEA 4OS0A 2WQAE 3AUMO 4IB8A 1S44A 4ZHHA 3PQSA 2KTDA 2RTAA 2A8GA 2LFOA 5F7GA 2PY1A 2MO5A 4PSQA 1ZNHA 2CAMA 5JD2A 1TOWA 1LDQA 5B5FA 2WWPA 3LHNA 5AQ6A 4BBOA 1SWOA 3PPTA 1KT6A 4M7MA 4Y0RA 3BX7A 4KIIA 1SREA 4BX6A 2GTFX 2BS5A 1GKAA 4BVMA 3EW2A 4MISA 5FQ7E 4BX6B 4FGIB 5HZQA 2AVIA 1GKAB 1SXXA 2RTGB 4YMYA 3MBTA 1SY3A 5H9AA 3RY2A 3CKGA 3C78X 3FDCA 2X55A 1X8QA 1PMPA 1EQDA 3NQ9A 1Y9LA 1QY1A 3N91A 2QCBA 4LQZA 3ZI8A 1BLRA 2LB6A 1PBYA 1ZNGA 1RXJA 3VG4A 3PP6A 3P6GA 1LPJA 3QQ2A 2O62A 3P6EA 1HQQA 3HWDA 5D45A 3UEVA 5KIDA 4Y59A 3RKGA 1A3YA 1VWMB 3C76X 5H9KA 1GXAA 5HZ9A 1NQMA 1SY0A 1TW4A 1I05A 1N9MA 1TVQA 1CBSA 1JMXA 2OVSA 3VG6A 3ZW2A 5CE4A 1DF3A 2NNDA 1SWHA 3PH5A 4GNYA 3HWGA 3I0AA 1E02A 2FTBA 2RTBB 1BBPA 4XMGA 1DFVA 1FJ1E 5B5GA 1FEMA 4YBPA 4GGZA 2YG2A 4KT5A 1YWBA 2X34A 3P6HA 1SWLA 3KVNA 3CR6A 4JHQA 1A18A 1KT3A 1SWSA 1T0VA 2L67A 5LKFA 4DQ3A 2HNXA 5L8NA 1UYNX 1U18A 2F73A 4O4XA 1X8OA 1T8VA 2CBSA 1MOYA 1GT1A 1KT4A 1GX8A 1JMZA 1D2UA 1STSB 1Y53X 3E3CA 4HPBA 4TNNA 4I9RA 1OBQA 2FHNX 3S60A 1EUOA 2AF5A 4ON1A 3SZJA 2OVDA 4AZOA 4GGRA 3WZQA 2WEWA 1HBQA 1LCWA 2GH7A 4GH7A 4Z2VA 3D96A 1PM1X 2AT8X 4ORRA 5H9LA 1N9YA 2X8TA 2WUTA 3VE1A 4D6BA 5B27A 1BRQA 3IFBA 4BJ8A 1ERBA 2HLVA 3BU9A 4CDDA 2A5CA 2IZGB 3P6CA 4O4SA 2OZQA 5LKEA 4NW4A 3D9WA 1QQSA 5EZ2A 1ZNDA 5K06A 4IAWA 2FKJA 4I3BA 4NP1A 2UZ2A 1EXSA 1QWDA 5F6ZA 4O4OA 1HMSA 3VU1A 2WQ9A 4YDBA 5IRWA 5HCCC 2OY8A 4OMXA 2X8SA 2X8FA 4YFRA 3L4RA 5K68A 1LDOA 1K24A 2K62A 5EEEA 2OVEA 5D8JA 2I5VO 5HA1A 2R74A 5BVSA 3T1DA 3WJDA 4UU3A 3HK1A 3NX2A 2OVAA 4N7CA 3VHIA 3WJGA 4XMEA 5HZ6A 1SWCA 1MUPA 4Z2PA 3CKFA 1Y9TA 3EM0A 1VWHB 2JU7A 3BY0A 1ICNA 3AKNA 3P24A 4HPAA 1JQPA 4CV7A 2CM9A 1VWAB 1OEEA 1WBIA 3AKMA 3BSZE 3MG5A 3OD9A 3OJYC 3PECA 4PJ2A 1BSQA 1QY0A 2HMBA 1G85A 5LJEA 3T2XA 4ODDA 4OEMA 5LJKA 3NQ3A 1I06A 2QM9A 1XKIA 3FA8A 2CZUA 3HOEA 4IABA 1W4TA 5FQ6E 2KW1A 1VWBB 4YGZA 2G78A 3FIQA 2CBRA 4ORWA 5BVQA 2IZDB 5B29A 1BM5A 3NBXX 1NP1A 2QMIA 3U0DA 1MK5A 2NNQA 3WXQA 2BT9A 5EDBA 4GETA 1U0XA 2RTQB 3B2LA 1SMPI 4A1YA 4BX5A 1ZNLA 4GD9A 1LIDA 4AZPA 5EDCA 5EEDA 1HBPA 1NP4A 3CBSA 4GU8A 3MX7A 4BX5B 1KFFA 4EQAC 3LTWA 4ZFXA 3STKA 2XKLA 2RTRB 1B4MA 4NNSA 3RY1A 4ZH9A 1G7NA 2RTKA 4GUZA 4U46A 5BVTA 3APVA 4OKAA 2RTEB 4O3ZA 1MEPA 4GKCA 1DC9A 1HN2A 3G7XA 2BSZA 2IZCB 5HTDA 2WSJA 1DZKA 4O49A 4IB7A 1GT4A 5IO5A 2YMSA 3EBWA 3EMMA 2OF8A 4YBUA 4ALOA 4D6AA 1SWAA 2EU7X 2Y3EA 2FLJA 1LCVA 2RTIB 3SLTA 4Z27A 4ORUA 1EIIA 2FR3A 1E06A 3O2YA 2RTCB 4MVKA 5EPQA 4NYQA 3JQOA 1AELA 3STMX 3FW4A 2A5BA 1UZ2X 4AZNA 4JO6A 4I6SA 3RDXA 4FBOA 1KGLA 1JJUA 2X46A 1KT5A 2OL6O 4O9SA 3EC5A 3VG5A 1STPA 2I5ZO 2VFCA 2Q2PA 1SXUA 2FR2A 2GC9A 2NNEA 3APUA 1HMRA 5DPQA 3SZIA 2FHLA 4QYNA 4AZRA 4DQ4A 1P6PA 1FENA 4RUUA 4ZHGA 1DZPA 3VG2A 1IKEA 1UYOX 4GJSA 4TKHA 5LJCA 4OELA 2BC3A 2LBAA 1GM6A 2AMMX 3D4RA 3JS1A 5L3YA 2VDFA 1LIBA 1GX3A 4IBAA 1EPBA 2RTFB 4EKVA 3DSZA 1SLFB 3NR3A 2L9CA 1SWKA 1FTPA 5CHKA 4CK4A 4EXZA 1CJ5A 1VWGB 2R73A 2X56A 1VWPB 3ELZA 5AJBA 2CZTA 3H3IA 3WOVA 2RTDB 3ZUIA 4BQUA 4CPEA 2Q4NA 2FT9A 1SWBA 1CRBA 3FENA 3KFIA 3KZAA 4QNIA 1IW2A 3F9DA 4LKPA 4XMFA 1HXZA 4AYHA 4BOEA 3APXA 2OYBO 2MHDA 2KT4B 2AT3X 5F6BA 2RTJA 1KQXA 2F09A 3FLLA 1PTSA 2QO6A 1JZUA 3RE5A 4QYPA 2XSTA 3RZYA 4DNEA 1R0UA 1BSOA 2G8CO 1VWKB 2ACOA 1G74A 5HA0A 1VWFB 3UEXA 2F01A 4YVBA 1BRPA 3DTQA 2QOMA 1A2DA 1SWUA 4FBVA 3RSWA 2GTLM 4A8ZA 5IO7A 1VWJB 1SY2A 1GX9A 1N7YA 2WPUA 4GGTA 4MVLA 4IB6A 4U8UO 1CBRA 5HCEC 3RDQA 4HWMA 1DZMA 1SLDB 3VHHA 3QKGA 3U03A 1ML7A 5KICA 2IFBA 5LJDA 4CPHB 5IXGA 1GGLA 1WUBA 1VWCB 3WYQA 1KT7A 4OS8A 1E00A 4QRLA 1BWYA 4LKTA 1DZJA 2IZEB 3NP1A 4WFVA 4NLJA 1SWJA 1D3SA 3P6FA 1TXLA 1NGLA 3LV4A 1PEEA 2AT0X 1RBPA 2IZKA 4YGGA 3WVMA 4ZHFA 3K3LA 4DCBA 3TGCA 1QABE 2Q9SA 2ZSCA 3AEHA 3HPEA 5IO6A 4MIRA 3RDMA 1MDCA 2A2GA 3WJFA 2AKQA 3WJEA 4TKJA 4K19A 1RXKA 2G79A 4CDEA 1AVDA 1STRB 2Q39A 3CWKA 4M6SA 2JW1A 1NBXA 4ES7A 1SRHA 3WBGA 3FIDA 1B8EA 1SWTA 4Z2OA 2Y3FA 3SZHA 3WZNA 5HZ8A 1I78A 1OEJA 1X71A 3FMZA 5CSEA 4ID2A 2QO4A 3BU1A 5FENA 1X8UA 1YUPA 5HAEA 2RTOB 2M4LA 2IZJA 2G5LA 3X00A 2JU8A 1HQPA
chains in the Genus database with same CATH topology
4Z28A 2QCBA 3VGWA 2RTPB 1RXJA 2IZFB 1NQNA 1RSUB 3PK2A 1NC9A 2RTHB 1HQQA 2OF8A 4Y59A 1VWIB 1VWMB 1SWAA 2MF6A 2Y3EA 2RTIB 1LCVA 4Z27A 3RDSA 4CPIA 1AVEA 2RTCB 1NQMA 1N9MA 1LCZA 2A5BA 1LELA 4JO6A 5IRAA 3RDXA 1SWHA 1SWFA 1STPA 1HY2A 4CPHB 2RTBB 2RTNB 3VHMA 5B5GA 1VWQB 2C4IA 2JGSA 4GGZA 1SLGB 3SZIA 2FHLA 1SWLA 4JHQA 1SWSA 4GJSA 2IZAA 2BC3A 2IZBA 3MM0A 2OF9A 5L3YA 1MOYA 2RTFB 1SWGA 1STSB 2RTLA 4EKVA 1Y53X 1SRFA 1KL3A 1SLFB 2FHNX 1RSTB 3SZJA 1SWKA 1RXHA 5CHKA 3RDUA 4GGRA 2IZIA 3T6LA 3WZQA 1LCWA 1VWGB 1Y52X 1SRJA 1VWPB 2GH7A 2UYWA 4CPEA 4Z2VA 1HXLA 2RTDB 3T2WA 1LUQA 1N9YA 2IZHB 3T6FA 1SWBA 1I9HA 4BJ8A 1HXZA 2A5CA 2IZGB 2C1QA 2RTJA 3WYPA 4Z6JA 1PTSA 1VYOA 2UZ2A 4Y5DA 1DF8A 2RTMA 3WZPA 1SWNA 3RE5A 2Y32A 5IRWA 4DNEA 1VWKB 4JNJA 5F2BA 5K68A 1LDOA 1VWFB 2OFBA 2F01A 4YVBA 1SRIA 1SWUA 1VWOB 2IZLB 4IRWA 4GDAA 3VHIA 1VWJB 4GGTA 1N7YA 1SWCA 2WPUA 4Z2PA 1VWHB 1Y55X 2OFAA 1SLDB 3VHHA 5K67A 1VWAB 1WBIA 3MG5A 1KL5A 5IRUA 3RDQA 1VWCB 3RE6A 1SRGA 3RDOA 3WYQA 1SWDA 3WZOA 2IZEB 1VWDB 1VWNB 1VWEB 3T2XA 1SWJA 1KL4A 1VWBB 1N43A 2IZKA 1SWRA 1MM9A 3EW1A 1IJ8A 1SWEA 4CPFA 1N4JA 1SWPA 2IZDB 1NDJA 4GJVA 1SLEB 2ZSCA 1MK5A 1VWLB 3RDMA 4I60A 4BX7A 2C1SA 2RTAA 2A8GA 2RTQB 5JD2A 1RXKA 2CAMA 4GD9A 4BX5A 1AVDA 1STRB 1LDQA 4BX7B 5B5FA 1SWQA 1NBXA 4BBOA 1SRHA 1SWOA 1KFFA 4BX5B 4CPHA 4BX6A 1SREA 1SWTA 4Z2OA 2RTRB 2Y3FA 3SZHA 3RY1A 3WZNA 3EW2A 2RTKA 4U46A 5CSEA 1RAVA 4BX6B 4OKAA 2RTEB 4BCSA 2AVIA 2RTGB 1VWRB 3RY2A 1MEPA 2RTOB 2IZJA 2G5LA 3FDCA 3X00A 2IZCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z28 A;  2QCB A;  3VGW A;  2RTP B;  1RXJ A;  2IZF B;  1NQN A;  1RSU B;  3PK2 A;  1NC9 A;  2RTH B;  1HQQ A;  2OF8 A;  4Y59 A;  1VWI B;  1VWM B;  1SWA A;  2MF6 A;  2Y3E A;  2RTI B;  1LCV A;  4Z27 A;  3RDS A;  4CPI A;  1AVE A;  2RTC B;  1NQM A;  1N9M A;  1LCZ A;  2A5B A;  1LEL A;  4JO6 A;  5IRA A;  3RDX A;  1SWH A;  1SWF A;  1STP A;  1HY2 A;  4CPH B;  2RTB B;  2RTN B;  3VHM A;  5B5G A;  1VWQ B;  2C4I A;  2JGS A;  4GGZ A;  1SLG B;  3SZI A;  2FHL A;  1SWL A;  4JHQ A;  1SWS A;  4GJS A;  2IZA A;  2BC3 A;  2IZB A;  3MM0 A;  2OF9 A;  5L3Y A;  1MOY A;  2RTF B;  1SWG A;  1STS B;  2RTL A;  4EKV A;  1Y53 X;  1SRF A;  1KL3 A;  1SLF B;  2FHN X;  1RST B;  3SZJ A;  1SWK A;  1RXH A;  5CHK A;  3RDU A;  4GGR A;  2IZI A;  3T6L A;  3WZQ A;  1LCW A;  1VWG B;  1Y52 X;  1SRJ A;  1VWP B;  2GH7 A;  2UYW A;  4CPE A;  4Z2V A;  1HXL A;  2RTD B;  3T2W A;  1LUQ A;  1N9Y A;  2IZH B;  3T6F A;  1SWB A;  1I9H A;  4BJ8 A;  1HXZ A;  2A5C A;  2IZG B;  2C1Q A;  2RTJ A;  3WYP A;  4Z6J A;  1PTS A;  1VYO A;  2UZ2 A;  4Y5D A;  1DF8 A;  2RTM A;  3WZP A;  1SWN A;  3RE5 A;  2Y32 A;  5IRW A;  4DNE A;  1VWK B;  4JNJ A;  5F2B A;  5K68 A;  1LDO A;  1VWF B;  2OFB A;  2F01 A;  4YVB A;  1SRI A;  1SWU A;  1VWO B;  2IZL B;  4IRW A;  4GDA A;  3VHI A;  1VWJ B;  4GGT A;  1N7Y A;  1SWC A;  2WPU A;  4Z2P A;  1VWH B;  1Y55 X;  2OFA A;  1SLD B;  3VHH A;  5K67 A;  1VWA B;  1WBI A;  3MG5 A;  1KL5 A;  5IRU A;  3RDQ A;  1VWC B;  3RE6 A;  1SRG A;  3RDO A;  3WYQ A;  1SWD A;  3WZO A;  2IZE B;  1VWD B;  1VWN B;  1VWE B;  3T2X A;  1SWJ A;  1KL4 A;  1VWB B;  1N43 A;  2IZK A;  1SWR A;  1MM9 A;  3EW1 A;  1IJ8 A;  1SWE A;  4CPF A;  1N4J A;  1SWP A;  2IZD B;  1NDJ A;  4GJV A;  1SLE B;  2ZSC A;  1MK5 A;  1VWL B;  3RDM A;  4I60 A;  4BX7 A;  2C1S A;  2RTA A;  2A8G A;  2RTQ B;  5JD2 A;  1RXK A;  2CAM A;  4GD9 A;  4BX5 A;  1AVD A;  1STR B;  1LDQ A;  4BX7 B;  5B5F A;  1SWQ A;  1NBX A;  4BBO A;  1SRH A;  1SWO A;  1KFF A;  4BX5 B;  4CPH A;  4BX6 A;  1SRE A;  1SWT A;  4Z2O A;  2RTR B;  2Y3F A;  3SZH A;  3RY1 A;  3WZN A;  3EW2 A;  2RTK A;  4U46 A;  5CSE A;  1RAV A;  4BX6 B;  4OKA A;  2RTE B;  4BCS A;  2AVI A;  2RTG B;  1VWR B;  3RY2 A;  1MEP A;  2RTO B;  2IZJ A;  2G5L A;  3FDC A;  3X00 A;  2IZC B; 
#chains in the Genus database with same CATH topology
 1W6F A;  3CBC A;  3NX1 A;  2RTP B;  4O3Y A;  3Q34 A;  3FYF A;  3C77 X;  1RSU B;  1BEB A;  1NC9 A;  2MWH A;  2OFM X;  2RTH B;  4U8U M;  4NLI A;  3EYC A;  3D97 A;  1VWI B;  3FA7 A;  5D4A A;  3CQN A;  2MF6 A;  2A3F X;  3RDS A;  3WJB A;  1E2T A;  1SXY A;  2OL8 O;  4WFU A;  4ZJ0 A;  1DV9 A;  1LCZ A;  1FE3 A;  2ALL X;  3S5X A;  5IRA A;  1LIF A;  2FGS A;  3VG3 A;  2DM5 A;  1EAL A;  2RTN B;  3VHM A;  4Y0P A;  4O3W A;  1ALB A;  4GNW A;  1VWQ B;  2Q2M A;  2LBV A;  4HFO A;  4I3D A;  3BS2 A;  2KTS A;  3KQ0 A;  4GRJ A;  2IZA A;  3V8U A;  2HZQ A;  3ZW1 A;  3APW A;  3MM0 A;  1MX7 A;  1GT5 A;  2OY1 O;  1OEK A;  2RA6 A;  1OSP O;  5LJH A;  3FA9 A;  3GE2 A;  5AJC A;  3S26 A;  4ZR2 A;  3ZW1 B;  1A57 A;  1SWG A;  2RTL A;  3BX8 A;  4R0B A;  2W2B A;  5FAZ A;  3VPJ E;  4ZHC A;  4MVE A;  2PI3 O;  3HOL A;  3ZW0 A;  2R56 A;  2E4J A;  1URE A;  3F8A A;  1RXH A;  4L1N A;  2A2U A;  4XMD A;  4YKO A;  3RDU A;  3T6L A;  3TZS A;  4YFQ A;  1Y52 X;  3SOT A;  1SRJ A;  3ZW0 B;  1HXL A;  4COT A;  4I3C A;  2HYS A;  4U8U N;  3ELX A;  4L3R A;  2GTL O;  2IZH B;  3T6F A;  1YWD A;  1I9H A;  3VE2 A;  1B0O A;  2K23 A;  2Z4I A;  1FEL A;  3B2K A;  3HTY A;  2AT5 X;  4IB9 A;  1LIE A;  1GT3 A;  3FEP A;  3P6D A;  5AEO A;  3I17 A;  1IFC A;  2AT6 X;  1VYO A;  4TJZ A;  4Y5D A;  1DF8 A;  2W2F A;  4YDA A;  1B56 A;  5HBS A;  3U9P C;  1SWN A;  3WZP A;  1KZW A;  3FEK A;  4I95 A;  5H9N A;  1O1V A;  4IMO A;  3FEL A;  4JNJ A;  4OMW A;  4YFP A;  4ALB A;  3ZUO A;  1JJX A;  2RCQ A;  1AVG I;  1N0S A;  1IKJ A;  4JGL A;  1AB0 A;  4YKM A;  2L5P A;  2KD2 A;  1E5P A;  1ZNK A;  4EEJ A;  4INN A;  1OBU A;  2IZL B;  1TOU A;  2BHV A;  2FRS A;  1QY2 A;  2MJI A;  4GDZ A;  1G5W A;  4GZV A;  1JYJ A;  2MM3 A;  4LZU A;  2OFR X;  1CBI A;  5D48 A;  4U3Q A;  4TKB A;  3NPO A;  1Y55 X;  2OFA A;  1VYG A;  2W2A A;  4NV7 A;  4HPD A;  2BLG A;  3P02 A;  2FWV A;  4LZV A;  3TF6 A;  3VG7 A;  5K67 A;  1I04 A;  5IRU A;  2G7B A;  5HCD C;  1K3B A;  1SRG A;  2X4M A;  5DG4 A;  1ZRY A;  1SWD A;  1YP6 A;  1U17 A;  2N93 A;  4QQ1 A;  1VWD B;  4UU2 A;  3NAD A;  1IIU A;  3ZQ3 A;  3BLG A;  1CBQ A;  5FFH A;  1MX8 A;  3O19 A;  2OL7 A;  1HMT A;  1JV4 A;  1O1U A;  2LA7 A;  1MM9 A;  1IJ8 A;  4GJV A;  1NDJ A;  4CDF A;  1SLE B;  3KFG A;  4QZT A;  1XCA A;  1YIV A;  1VYF A;  3EBK A;  2HKD A;  4ML7 B;  3SLO A;  1VWL B;  2NP1 A;  4GE1 A;  4I60 A;  3B2I A;  2C1S A;  4XMH A;  5D47 A;  4AZM A;  1ERX A;  4ORX A;  4BX7 A;  1KXO A;  3KFF A;  4WBK A;  1KQW A;  2DJF A;  2JOZ A;  2AL0 X;  3BDR A;  4BX7 B;  1SWQ A;  4CPH A;  4KCA A;  1KZX A;  4ZGF A;  2P8G A;  1ACD A;  4QGX A;  3FW5 A;  2GJ5 A;  4KH8 A;  5HWZ A;  4KC8 A;  3JSQ A;  3KFH A;  1RAV A;  1QFV A;  3PH6 A;  3ZZV A;  3UEW A;  4BCS A;  1AQB A;  3GAQ A;  1VWR B;  2QOS C;  1EIO A;  4BGF A;  4QGW A;  2VFB A;  3SAO A;  1I4U A;  3OE3 A;  4Z28 A;  3VGW A;  4ARH A;  5BYP A;  4O3X B;  4Y0S A;  1QG5 A;  2IZF B;  1H91 A;  1NQN A;  1JYD A;  3PK2 A;  4WHI A;  4MVI A;  5FQ8 E;  4ZHD A;  4QGV A;  1JJJ A;  2FKG A;  1KOI A;  3CQR A;  3FA6 A;  4A60 A;  2RQ0 A;  1IFB A;  1RLB E;  1AVE A;  4CPI A;  4ZH6 A;  3CMP A;  1EI5 A;  5HZ5 A;  1LEL A;  2ASN X;  4ZCB A;  4FBR A;  1SWF A;  1LNM A;  1W5R A;  2WR6 A;  3D95 A;  2GTL N;  3HWE A;  5B10 O;  1SA8 A;  4TQ2 A;  1HY2 A;  1ZNE A;  2LKK A;  1S2P A;  3PDF A;  4B55 A;  2RD7 C;  5L8O A;  2C4I A;  2JGS A;  5F1E A;  1SLG B;  2A13 A;  4AW8 A;  4NV8 A;  1PBO A;  2RCT A;  4RUN A;  4C5P A;  2IZB A;  3HWF A;  2OF9 A;  1O8V A;  2DJG A;  3SLJ A;  4YCE A;  5B3M O;  4MEE A;  1X89 A;  5B11 O;  1LFO A;  2AH7 X;  1SRF A;  1KL3 A;  1SY1 A;  2ACP X;  1OBP A;  5LJG A;  1RST B;  1SXW A;  4ORY A;  4TLJ A;  2RN4 A;  1QFT A;  2IZI A;  3TGA A;  5HTE A;  1ADL A;  2UYW A;  5H8T A;  3F6Z B;  3T2W A;  5F58 A;  1LUQ A;  2ZAI A;  1YWC A;  1OPA A;  1MVG A;  3RWX A;  5L8I A;  4XMC A;  1Z24 A;  4NNT A;  1LIC A;  2ZAG A;  2OY7 A;  4ORS A;  1BSY A;  1Y0G A;  2C1Q A;  2X32 A;  3WYP A;  3ZWE A;  3FR4 A;  3IA8 A;  4Z6J A;  2RTM A;  4I9S A;  3MVF A;  2HZR A;  4N7D A;  2Y32 A;  1FDQ A;  3PQU A;  4KC7 A;  3B2J A;  1VPR A;  5F2B A;  3TGB A;  2OFB A;  1S7D A;  3WJC A;  4CSB A;  1BJ7 A;  3Q6L A;  2Z4H A;  4YCH A;  3B2H A;  3STN A;  1OPB A;  1EW3 A;  1SRI A;  4Y0Q A;  2QO5 A;  4AZQ A;  4A1H A;  1VWO B;  2CM4 A;  4IRW A;  3RBY A;  4GDA A;  4NYR A;  3BRN A;  2POA A;  4U9C A;  2OY5 O;  3O22 A;  2JN3 A;  2A0A A;  3PED A;  5C0N A;  2FS7 A;  2L68 A;  2JU3 A;  5B2A O;  2WEX A;  1LF7 A;  1T68 X;  2X45 A;  3UEU A;  1L6M A;  4EFG A;  2ANS A;  4O4U A;  1KL5 A;  4YGH A;  3RE6 A;  1EPA A;  3RDO A;  4ZGU A;  1YP7 A;  4GK9 A;  3WZO A;  1JIW I;  4YH0 A;  3S5V A;  1X8P A;  4HPC A;  4QZU A;  2BS6 A;  4IAX A;  1JBH A;  3UAQ A;  1VWN B;  1VWE B;  4QAE A;  4CDC A;  1ICM A;  1KL4 A;  4OS3 A;  4FQB B;  1X8N A;  1N43 A;  1SWR A;  5CYB A;  3EW1 A;  1SWE A;  3FR2 A;  4CPF A;  3FR5 A;  1N4J A;  1SWP A;  3OBL A;  4IMN A;  2FS6 A;  4EDE A;  1YWA A;  5LJB A;  5JR8 A;  3NQK A;  5KHP A;  2JMB A;  1LKE A;  4OS0 A;  2WQA E;  3AUM O;  4IB8 A;  1S44 A;  4ZHH A;  3PQS A;  2KTD A;  2RTA A;  2A8G A;  2LFO A;  5F7G A;  2PY1 A;  2MO5 A;  4PSQ A;  1ZNH A;  2CAM A;  5JD2 A;  1TOW A;  1LDQ A;  5B5F A;  2WWP A;  3LHN A;  5AQ6 A;  4BBO A;  1SWO A;  3PPT A;  1KT6 A;  4M7M A;  4Y0R A;  3BX7 A;  4KII A;  1SRE A;  4BX6 A;  2GTF X;  2BS5 A;  1GKA A;  4BVM A;  3EW2 A;  4MIS A;  5FQ7 E;  4BX6 B;  4FGI B;  5HZQ A;  2AVI A;  1GKA B;  1SXX A;  2RTG B;  4YMY A;  3MBT A;  1SY3 A;  5H9A A;  3RY2 A;  3CKG A;  3C78 X;  3FDC A;  2X55 A;  1X8Q A;  1PMP A;  1EQD A;  3NQ9 A;  1Y9L A;  1QY1 A;  3N91 A;  2QCB A;  4LQZ A;  3ZI8 A;  1BLR A;  2LB6 A;  1PBY A;  1ZNG A;  1RXJ A;  3VG4 A;  3PP6 A;  3P6G A;  1LPJ A;  3QQ2 A;  2O62 A;  3P6E A;  1HQQ A;  3HWD A;  5D45 A;  3UEV A;  5KID A;  4Y59 A;  3RKG A;  1A3Y A;  1VWM B;  3C76 X;  5H9K A;  1GXA A;  5HZ9 A;  1NQM A;  1SY0 A;  1TW4 A;  1I05 A;  1N9M A;  1TVQ A;  1CBS A;  1JMX A;  2OVS A;  3VG6 A;  3ZW2 A;  5CE4 A;  1DF3 A;  2NND A;  1SWH A;  3PH5 A;  4GNY A;  3HWG A;  3I0A A;  1E02 A;  2FTB A;  2RTB B;  1BBP A;  4XMG A;  1DFV A;  1FJ1 E;  5B5G A;  1FEM A;  4YBP A;  4GGZ A;  2YG2 A;  4KT5 A;  1YWB A;  2X34 A;  3P6H A;  1SWL A;  3KVN A;  3CR6 A;  4JHQ A;  1A18 A;  1KT3 A;  1SWS A;  1T0V A;  2L67 A;  5LKF A;  4DQ3 A;  2HNX A;  5L8N A;  1UYN X;  1U18 A;  2F73 A;  4O4X A;  1X8O A;  1T8V A;  2CBS A;  1MOY A;  1GT1 A;  1KT4 A;  1GX8 A;  1JMZ A;  1D2U A;  1STS B;  1Y53 X;  3E3C A;  4HPB A;  4TNN A;  4I9R A;  1OBQ A;  2FHN X;  3S60 A;  1EUO A;  2AF5 A;  4ON1 A;  3SZJ A;  2OVD A;  4AZO A;  4GGR A;  3WZQ A;  2WEW A;  1HBQ A;  1LCW A;  2GH7 A;  4GH7 A;  4Z2V A;  3D96 A;  1PM1 X;  2AT8 X;  4ORR A;  5H9L A;  1N9Y A;  2X8T A;  2WUT A;  3VE1 A;  4D6B A;  5B27 A;  1BRQ A;  3IFB A;  4BJ8 A;  1ERB A;  2HLV A;  3BU9 A;  4CDD A;  2A5C A;  2IZG B;  3P6C A;  4O4S A;  2OZQ A;  5LKE A;  4NW4 A;  3D9W A;  1QQS A;  5EZ2 A;  1ZND A;  5K06 A;  4IAW A;  2FKJ A;  4I3B A;  4NP1 A;  2UZ2 A;  1EXS A;  1QWD A;  5F6Z A;  4O4O A;  1HMS A;  3VU1 A;  2WQ9 A;  4YDB A;  5IRW A;  5HCC C;  2OY8 A;  4OMX A;  2X8S A;  2X8F A;  4YFR A;  3L4R A;  5K68 A;  1LDO A;  1K24 A;  2K62 A;  5EEE A;  2OVE A;  5D8J A;  2I5V O;  5HA1 A;  2R74 A;  5BVS A;  3T1D A;  3WJD A;  4UU3 A;  3HK1 A;  3NX2 A;  2OVA A;  4N7C A;  3VHI A;  3WJG A;  4XME A;  5HZ6 A;  1SWC A;  1MUP A;  4Z2P A;  3CKF A;  1Y9T A;  3EM0 A;  1VWH B;  2JU7 A;  3BY0 A;  1ICN A;  3AKN A;  3P24 A;  4HPA A;  1JQP A;  4CV7 A;  2CM9 A;  1VWA B;  1OEE A;  1WBI A;  3AKM A;  3BSZ E;  3MG5 A;  3OD9 A;  3OJY C;  3PEC A;  4PJ2 A;  1BSQ A;  1QY0 A;  2HMB A;  1G85 A;  5LJE A;  3T2X A;  4ODD A;  4OEM A;  5LJK A;  3NQ3 A;  1I06 A;  2QM9 A;  1XKI A;  3FA8 A;  2CZU A;  3HOE A;  4IAB A;  1W4T A;  5FQ6 E;  2KW1 A;  1VWB B;  4YGZ A;  2G78 A;  3FIQ A;  2CBR A;  4ORW A;  5BVQ A;  2IZD B;  5B29 A;  1BM5 A;  3NBX X;  1NP1 A;  2QMI A;  3U0D A;  1MK5 A;  2NNQ A;  3WXQ A;  2BT9 A;  5EDB A;  4GET A;  1U0X A;  2RTQ B;  3B2L A;  1SMP I;  4A1Y A;  4BX5 A;  1ZNL A;  4GD9 A;  1LID A;  4AZP A;  5EDC A;  5EED A;  1HBP A;  1NP4 A;  3CBS A;  4GU8 A;  3MX7 A;  4BX5 B;  1KFF A;  4EQA C;  3LTW A;  4ZFX A;  3STK A;  2XKL A;  2RTR B;  1B4M A;  4NNS A;  3RY1 A;  4ZH9 A;  1G7N A;  2RTK A;  4GUZ A;  4U46 A;  5BVT A;  3APV A;  4OKA A;  2RTE B;  4O3Z A;  1MEP A;  4GKC A;  1DC9 A;  1HN2 A;  3G7X A;  2BSZ A;  2IZC B;  5HTD A;  2WSJ A;  1DZK A;  4O49 A;  4IB7 A;  1GT4 A;  5IO5 A;  2YMS A;  3EBW A;  3EMM A;  2OF8 A;  4YBU A;  4ALO A;  4D6A A;  1SWA A;  2EU7 X;  2Y3E A;  2FLJ A;  1LCV A;  2RTI B;  3SLT A;  4Z27 A;  4ORU A;  1EII A;  2FR3 A;  1E06 A;  3O2Y A;  2RTC B;  4MVK A;  5EPQ A;  4NYQ A;  3JQO A;  1AEL A;  3STM X;  3FW4 A;  2A5B A;  1UZ2 X;  4AZN A;  4JO6 A;  4I6S A;  3RDX A;  4FBO A;  1KGL A;  1JJU A;  2X46 A;  1KT5 A;  2OL6 O;  4O9S A;  3EC5 A;  3VG5 A;  1STP A;  2I5Z O;  2VFC A;  2Q2P A;  1SXU A;  2FR2 A;  2GC9 A;  2NNE A;  3APU A;  1HMR A;  5DPQ A;  3SZI A;  2FHL A;  4QYN A;  4AZR A;  4DQ4 A;  1P6P A;  1FEN A;  4RUU A;  4ZHG A;  1DZP A;  3VG2 A;  1IKE A;  1UYO X;  4GJS A;  4TKH A;  5LJC A;  4OEL A;  2BC3 A;  2LBA A;  1GM6 A;  2AMM X;  3D4R A;  3JS1 A;  5L3Y A;  2VDF A;  1LIB A;  1GX3 A;  4IBA A;  1EPB A;  2RTF B;  4EKV A;  3DSZ A;  1SLF B;  3NR3 A;  2L9C A;  1SWK A;  1FTP A;  5CHK A;  4CK4 A;  4EXZ A;  1CJ5 A;  1VWG B;  2R73 A;  2X56 A;  1VWP B;  3ELZ A;  5AJB A;  2CZT A;  3H3I A;  3WOV A;  2RTD B;  3ZUI A;  4BQU A;  4CPE A;  2Q4N A;  2FT9 A;  1SWB A;  1CRB A;  3FEN A;  3KFI A;  3KZA A;  4QNI A;  1IW2 A;  3F9D A;  4LKP A;  4XMF A;  1HXZ A;  4AYH A;  4BOE A;  3APX A;  2OYB O;  2MHD A;  2KT4 B;  2AT3 X;  5F6B A;  2RTJ A;  1KQX A;  2F09 A;  3FLL A;  1PTS A;  2QO6 A;  1JZU A;  3RE5 A;  4QYP A;  2XST A;  3RZY A;  4DNE A;  1R0U A;  1BSO A;  2G8C O;  1VWK B;  2ACO A;  1G74 A;  5HA0 A;  1VWF B;  3UEX A;  2F01 A;  4YVB A;  1BRP A;  3DTQ A;  2QOM A;  1A2D A;  1SWU A;  4FBV A;  3RSW A;  2GTL M;  4A8Z A;  5IO7 A;  1VWJ B;  1SY2 A;  1GX9 A;  1N7Y A;  2WPU A;  4GGT A;  4MVL A;  4IB6 A;  4U8U O;  1CBR A;  5HCE C;  3RDQ A;  4HWM A;  1DZM A;  1SLD B;  3VHH A;  3QKG A;  3U03 A;  1ML7 A;  5KIC A;  2IFB A;  5LJD A;  4CPH B;  5IXG A;  1GGL A;  1WUB A;  1VWC B;  3WYQ A;  1KT7 A;  4OS8 A;  1E00 A;  4QRL A;  1BWY A;  4LKT A;  1DZJ A;  2IZE B;  3NP1 A;  4WFV A;  4NLJ A;  1SWJ A;  1D3S A;  3P6F A;  1TXL A;  1NGL A;  3LV4 A;  1PEE A;  2AT0 X;  1RBP A;  2IZK A;  4YGG A;  3WVM A;  4ZHF A;  3K3L A;  4DCB A;  3TGC A;  1QAB E;  2Q9S A;  2ZSC A;  3AEH A;  3HPE A;  5IO6 A;  4MIR A;  3RDM A;  1MDC A;  2A2G A;  3WJF A;  2AKQ A;  3WJE A;  4TKJ A;  4K19 A;  1RXK A;  2G79 A;  4CDE A;  1AVD A;  1STR B;  2Q39 A;  3CWK A;  4M6S A;  2JW1 A;  1NBX A;  4ES7 A;  1SRH A;  3WBG A;  3FID A;  1B8E A;  1SWT A;  4Z2O A;  2Y3F A;  3SZH A;  3WZN A;  5HZ8 A;  1I78 A;  1OEJ A;  1X71 A;  3FMZ A;  5CSE A;  4ID2 A;  2QO4 A;  3BU1 A;  5FEN A;  1X8U A;  1YUP A;  5HAE A;  2RTO B;  2M4L A;  2IZJ A;  2G5L A;  3X00 A;  2JU8 A;  1HQP A; 
#chains in the Genus database with same CATH homology
 4Z28 A;  2QCB A;  3VGW A;  2RTP B;  1RXJ A;  2IZF B;  1NQN A;  1RSU B;  3PK2 A;  1NC9 A;  2RTH B;  1HQQ A;  2OF8 A;  4Y59 A;  1VWI B;  1VWM B;  1SWA A;  2MF6 A;  2Y3E A;  2RTI B;  1LCV A;  4Z27 A;  3RDS A;  4CPI A;  1AVE A;  2RTC B;  1NQM A;  1N9M A;  1LCZ A;  2A5B A;  1LEL A;  4JO6 A;  5IRA A;  3RDX A;  1SWH A;  1SWF A;  1STP A;  1HY2 A;  4CPH B;  2RTB B;  2RTN B;  3VHM A;  5B5G A;  1VWQ B;  2C4I A;  2JGS A;  4GGZ A;  1SLG B;  3SZI A;  2FHL A;  1SWL A;  4JHQ A;  1SWS A;  4GJS A;  2IZA A;  2BC3 A;  2IZB A;  3MM0 A;  2OF9 A;  5L3Y A;  1MOY A;  2RTF B;  1SWG A;  1STS B;  2RTL A;  4EKV A;  1Y53 X;  1SRF A;  1KL3 A;  1SLF B;  2FHN X;  1RST B;  3SZJ A;  1SWK A;  1RXH A;  5CHK A;  3RDU A;  4GGR A;  2IZI A;  3T6L A;  3WZQ A;  1LCW A;  1VWG B;  1Y52 X;  1SRJ A;  1VWP B;  2GH7 A;  2UYW A;  4CPE A;  4Z2V A;  1HXL A;  2RTD B;  3T2W A;  1LUQ A;  1N9Y A;  2IZH B;  3T6F A;  1SWB A;  1I9H A;  4BJ8 A;  1HXZ A;  2A5C A;  2IZG B;  2C1Q A;  2RTJ A;  3WYP A;  4Z6J A;  1PTS A;  1VYO A;  2UZ2 A;  4Y5D A;  1DF8 A;  2RTM A;  3WZP A;  1SWN A;  3RE5 A;  2Y32 A;  5IRW A;  4DNE A;  1VWK B;  4JNJ A;  5F2B A;  5K68 A;  1LDO A;  1VWF B;  2OFB A;  2F01 A;  4YVB A;  1SRI A;  1SWU A;  1VWO B;  2IZL B;  4IRW A;  4GDA A;  3VHI A;  1VWJ B;  4GGT A;  1N7Y A;  1SWC A;  2WPU A;  4Z2P A;  1VWH B;  1Y55 X;  2OFA A;  1SLD B;  3VHH A;  5K67 A;  1VWA B;  1WBI A;  3MG5 A;  1KL5 A;  5IRU A;  3RDQ A;  1VWC B;  3RE6 A;  1SRG A;  3RDO A;  3WYQ A;  1SWD A;  3WZO A;  2IZE B;  1VWD B;  1VWN B;  1VWE B;  3T2X A;  1SWJ A;  1KL4 A;  1VWB B;  1N43 A;  2IZK A;  1SWR A;  1MM9 A;  3EW1 A;  1IJ8 A;  1SWE A;  4CPF A;  1N4J A;  1SWP A;  2IZD B;  1NDJ A;  4GJV A;  1SLE B;  2ZSC A;  1MK5 A;  1VWL B;  3RDM A;  4I60 A;  4BX7 A;  2C1S A;  2RTA A;  2A8G A;  2RTQ B;  5JD2 A;  1RXK A;  2CAM A;  4GD9 A;  4BX5 A;  1AVD A;  1STR B;  1LDQ A;  4BX7 B;  5B5F A;  1SWQ A;  1NBX A;  4BBO A;  1SRH A;  1SWO A;  1KFF A;  4BX5 B;  4CPH A;  4BX6 A;  1SRE A;  1SWT A;  4Z2O A;  2RTR B;  2Y3F A;  3SZH A;  3RY1 A;  3WZN A;  3EW2 A;  2RTK A;  4U46 A;  5CSE A;  1RAV A;  4BX6 B;  4OKA A;  2RTE B;  4BCS A;  2AVI A;  2RTG B;  1VWR B;  3RY2 A;  1MEP A;  2RTO B;  2IZJ A;  2G5L A;  3FDC A;  3X00 A;  2IZC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...