1VYWB

Structure of cdk2/cyclin a with pnu-292137
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title 3-Aminopyrazole Inhibitors of Cdk2/Cyclin a as Antitumor Agents. Part 1. Lead Finding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1vywB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1vywB02
4F7SB 2PK9B 3M03A 5BNJB 4EOKB 3TN8B 5HNBB 4G6LB 2CCHB 2R7GA 4F70B 2UZBB 3TNHB 4BCND 1W98B 4BCQD 2WIHB 4EORB 1N4MA 1UNHD 4UN0A 1H1PB 1H1QB 4EOPB 1AD6A 4YOSA 1H24B 2CJMB 3BHUB 3LQ5B 2UZDB 4BCJB 3MY5B 1OKWB 1AISB 4Y72B 3EIDB 4CFWB 3DDQB 1H4LD 5EFQB 3EJ1B 1OI9B 1H25B 1H1SB 2UUEB 2WIPB 3K7AM 4BCMB 3BHTB 2EUFA 2WXVB 2UZLB 3O0GD 5CEIB 2WMAB 1VINA 2CCIB 1OKVB 1C9BA 1OL2B 1ZP2A 2W99A 1H27B 4BCKB 2BKZB 1UNLD 2WEVB 4F7JB 4EOMB 1QMZB 2W96A 4BCHB 4F6UB 1FINB 4I3ZB 3MI9B 2IW9B 3RGFB 4BCFB 3BLHB 2X1NB 2W2HA 1GUXB 4BCPB 2C6TB 5ICPB 1VYWB 4CFXB 4EOLB 4CFVB 4CFUB 2C4GB 2I53A 5ACBA 2QDJA 4F6SB 4CFNB 4EC9B 4YC3B 3BLRB 4BCGB 1O9KA 3QHWB 1UNGD 3DDPB 4RODA 2C5OB 1OGUB 5IDPB 1JSTB 3MY1B 3QHRB 4BCMD 2IW8B 4BCQB 2WHBB 4KRDB 2C5VB 5LMKB 2W9ZA 2WMBB 4ELJA 4II5B 5FGKB 5HBHB 2BPMB 3BLQB 4EONB 1KXUA 2I40B 3EOCB 5IF1B 4EOQB 4ROEA 1G3NC 4EOIB 2IVXA 4BCOB 1URCB 3G33B 1JSUB 4CFMB 3TNWB 4EOSB 3F5XB 4EOJB 1OIUB 4BCIB 1D3UB 5L2WB 4YOOA 1P5EB 2C5XB 4F7NB 1OIYB 4ROCA 1XO2A 2F2CA 4TTHA 1JKWA 4NSTB 2UZEB 3MIAB 4OR5B 1TFBA 5HVYB 5HBEB 1OL1B 4BCNB 4KRCB 4FX3B 5LQFB 2B9RA 2PK2A 5IDNB 2W9FA 2JGZB 2WFYB 5HQ0B 2C5NB 4OGRB 4F6WB 5I5ZB 1BU2A 4EOOB 1O9KB 1E9HB 3TNIB 5CYIB 5HBJB 4CXAB 4YOZA 4IMYB 3BHVB 1JOWA 1PKDB 4ELLA 1H28B 2WPAB 4CRLB 2V22B 4F7LB 2PMIB 1GH6B 2G9XB 2PHGA 1FVVB 1GY3B 3DOGB 1H1RB 2IW6B 1H26B 4EC8B 3POMA 4CFUD 1VOLA 1GUXA 3H4CA 1F5QB
chains in the Genus database with same CATH superfamily
1UGQB 5HNBB 1N4MA 1UNHD 1AHJB 1H1PB 1AD6A 2CJMB 3LQ5B 4AKHA 1OKWB 2DD4B 4CFWB 3BG3A 1OI9B 1H1SB 2UUEB 1FKMA 3VYHB 3HHTB 2UZLB 5CEIB 2DMEA 2CCIB 1ZP2A 2W99A 1H27B 4EOMB 1QMZB 2W96A 4F6UB 3WVDB 4I3ZB 2IW9B 3DJBA 2C6TB 5ICPB 1VYWB 4EOLB 2ZPFB 4AI6A 2QDJA 4YC3B 1UNGD 4LOCA 3QHRB 4BCMD 2C5VB 2W9ZA 4BY7X 3TW6A 2QGSA 3BLQB 4BBSM 5IF1B 1G3NC 1URCB 4EOSB 1JSUB 3TNWB 3BG5A 4JX6A 1P5EB 3A8MB 1XO2A 2F2CA 4TTHA 4NSTB 5HVYB 4FX3B 5LQFB 3WVEB 2JGZB 5HQ0B 2CZ7B 4EOOB 5DQWA 4Z6YA 3KHIA 4HNUA 3BHVB 2V22B 2DXCB 2CZ1B 2DPPB 4MFDA 2QQ8A 3H4CA 3HB9A 1F5QB 4ZGJB 4F7SB 5BNJB 4JX4A 4G6LB 2CCHB 4AKGA 3TNHB 4BCND 3QYGB 3MY5B 1AISB 3DDQB 3PO3S 3DL1A 4BY1X 3K7AM 3BHTB 2ZPIB 1C9BA 1IREB 4F7JB 3A8LB 1FINB 3MI9B 3A8HB 2X1NB 2W2HA 4CFVB 2I53A 3BLRB 4OB1B 2KR6A 4ELJA 3DTOA 4II5B 2CZ6B 3QYEA 2BS3A 2ZPBB 1KXUA 3EOCB 3VYGB 4EOQB 4EOIB 2DXBB 2IVXA 3G33B 1OIUB 2LW4A 1D3UB 4AKIA 4ROCA 4ZGEB 3MIAB 4OR5B 4HNVA 3QYBA 3QXEB 4FM4B 1OL1B 4KRCB 4F6WB 3X28B 4OGRB 4OB0B 5CYIB 5HBJB 4YOZA 1JOWA 4ELLA 2ZZDB 4MIMA 4CRLB 2G9XB 1FVVB 3B57A 1H1RB 1H26B 3POMA 4CFUD 1GUXA 5IDNB 2PK9B 3M03A 4EOKB 3X25B 4F70B 2UZBB 1W98B 4BCQD 2QDYB 4UN0A 1H1QB 4YOSA 1H24B 4BCJB 2UZDB 3A8OB 4Y72B 3EIDB 1H4LD 2CYZB 1H25B 2WIPB 4BCMB 2WJ9A 2WXVB 3O0GD 4HNTA 2WMAB 2CZ0B 2IN3A 2ZCFB 1OL2B 2PJQA 3BG9A 2ZPGB 4BCHB 4JX5A 3TW7A 1GUXB 4BCPB 4BBRM 1QLBA 4CFUB 2C4GB 5ACBA 5DQVA 4EC9B 4QSHA 2C5OB 1JSTB 4HLQA 4BCQB 4ZGDB 2WMBB 5EJCA 5FGKB 2BPMB 2AHJB 4NC6A 4ROEA 3HZJA 2KMGA 4CFMB 5L2WB 2C5XB 1UGRB 4F7NB 3VKHA 1OIYB 1JKWA 2UZEB 2G77A 5IHYA 4OB3B 4BXXX 3X26B 4BCNB 2B9RA 2W9FA 2WFYB 2C5NB 1BU2A 1E9HB 3TNIB 4CXAB 4IMYB 1H28B 2QFZA 4F7LB 1GH6B 4OB2B 1GY3B 2IW6B 4EC8B 1ENWA 4HL4A 3TN8B 3QYHB 2R7GA 2WIHB 4EORB 3BHUB 3GTMS 5EFQB 3EJ1B 2EUFA 3X20B 1V29B 3A8GB 1VINA 1OKVB 4BCKB 2BKZB 1UNLD 2WEVB 2DD5B 3RGFB 4BCFB 3BLHB 2ZPHB 1UGPB 2QF7A 3QZ9B 4CFXB 2BS4A 4F6SB 4CFNB 4BCGB 1O9KA 2ZPEB 3QHWB 3DDPB 4RODA 1OGUB 3NDQA 5IDPB 3MY1B 2IW8B 2WHBB 4KRDB 5LMKB 3X24B 1UGSB 5HBHB 4EONB 2I40B 1E7PA 2D0QB 3VKGA 4BCOB 4EOJB 3F5XB 4BCIB 4YOOA 3QWLA 1TFBA 5HBEB 4MFEA 2PK2A 2BS2A 5I5ZB 1O9KB 4M6VA 1PKDB 3QZ5B 1TD6A 2WPAB 2PMIB 2PHGA 3DOGB 3HO8A 1VOLA 3HBLA 4EOPB
chains in the Genus database with same CATH topology
4F7SB 2PK9B 3M03A 5BNJB 4EOKB 3TN8B 5HNBB 4G6LB 2CCHB 2R7GA 4F70B 2UZBB 3TNHB 4BCND 1W98B 4BCQD 2WIHB 4EORB 1N4MA 1UNHD 4UN0A 1H1PB 1H1QB 4EOPB 1AD6A 4YOSA 1H24B 2CJMB 3BHUB 3LQ5B 2UZDB 4BCJB 3MY5B 1OKWB 1AISB 4Y72B 3EIDB 4CFWB 3DDQB 1H4LD 5EFQB 3EJ1B 1OI9B 1H25B 1H1SB 2UUEB 2WIPB 3K7AM 4BCMB 3BHTB 2EUFA 2WXVB 2UZLB 3O0GD 5CEIB 2WMAB 1VINA 2CCIB 1OKVB 1C9BA 1OL2B 1ZP2A 2W99A 1H27B 4BCKB 2BKZB 1UNLD 2WEVB 4F7JB 4EOMB 1QMZB 2W96A 4BCHB 4F6UB 1FINB 4I3ZB 3MI9B 2IW9B 3RGFB 4BCFB 3BLHB 2X1NB 2W2HA 1GUXB 4BCPB 2C6TB 5ICPB 1VYWB 4CFXB 4EOLB 4CFVB 4CFUB 2C4GB 2I53A 5ACBA 2QDJA 4F6SB 4CFNB 4EC9B 4YC3B 3BLRB 4BCGB 1O9KA 3QHWB 1UNGD 3DDPB 4RODA 2C5OB 1OGUB 5IDPB 1JSTB 3MY1B 3QHRB 4BCMD 2IW8B 4BCQB 2WHBB 4KRDB 2C5VB 5LMKB 2W9ZA 2WMBB 4ELJA 4II5B 5FGKB 5HBHB 2BPMB 3BLQB 4EONB 1KXUA 2I40B 3EOCB 5IF1B 4EOQB 4ROEA 1G3NC 4EOIB 2IVXA 4BCOB 1URCB 3G33B 1JSUB 4CFMB 3TNWB 4EOSB 3F5XB 4EOJB 1OIUB 4BCIB 1D3UB 5L2WB 4YOOA 1P5EB 2C5XB 4F7NB 1OIYB 4ROCA 1XO2A 2F2CA 4TTHA 1JKWA 4NSTB 2UZEB 3MIAB 4OR5B 1TFBA 5HVYB 5HBEB 1OL1B 4BCNB 4KRCB 4FX3B 5LQFB 2B9RA 2PK2A 5IDNB 2W9FA 2JGZB 2WFYB 5HQ0B 2C5NB 4OGRB 4F6WB 5I5ZB 1BU2A 4EOOB 1O9KB 1E9HB 3TNIB 5CYIB 5HBJB 4CXAB 4YOZA 4IMYB 3BHVB 1JOWA 1PKDB 4ELLA 1H28B 2WPAB 4CRLB 2V22B 4F7LB 2PMIB 1GH6B 2G9XB 2PHGA 1FVVB 1GY3B 3DOGB 1H1RB 2IW6B 1H26B 4EC8B 3POMA 4CFUD 1VOLA 1GUXA 3H4CA 1F5QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7S B;  2PK9 B;  3M03 A;  5BNJ B;  4EOK B;  3TN8 B;  5HNB B;  4G6L B;  2CCH B;  2R7G A;  4F70 B;  2UZB B;  3TNH B;  4BCN D;  1W98 B;  4BCQ D;  2WIH B;  4EOR B;  1N4M A;  1UNH D;  4UN0 A;  1H1P B;  1H1Q B;  4EOP B;  1AD6 A;  4YOS A;  1H24 B;  2CJM B;  3BHU B;  3LQ5 B;  2UZD B;  4BCJ B;  3MY5 B;  1OKW B;  1AIS B;  4Y72 B;  3EID B;  4CFW B;  3DDQ B;  1H4L D;  5EFQ B;  3EJ1 B;  1OI9 B;  1H25 B;  1H1S B;  2UUE B;  2WIP B;  3K7A M;  4BCM B;  3BHT B;  2EUF A;  2WXV B;  2UZL B;  3O0G D;  5CEI B;  2WMA B;  1VIN A;  2CCI B;  1OKV B;  1C9B A;  1OL2 B;  1ZP2 A;  2W99 A;  1H27 B;  4BCK B;  2BKZ B;  1UNL D;  2WEV B;  4F7J B;  4EOM B;  1QMZ B;  2W96 A;  4BCH B;  4F6U B;  1FIN B;  4I3Z B;  3MI9 B;  2IW9 B;  3RGF B;  4BCF B;  3BLH B;  2X1N B;  2W2H A;  1GUX B;  4BCP B;  2C6T B;  5ICP B;  1VYW B;  4CFX B;  4EOL B;  4CFV B;  4CFU B;  2C4G B;  2I53 A;  5ACB A;  2QDJ A;  4F6S B;  4CFN B;  4EC9 B;  4YC3 B;  3BLR B;  4BCG B;  1O9K A;  3QHW B;  1UNG D;  3DDP B;  4ROD A;  2C5O B;  1OGU B;  5IDP B;  1JST B;  3MY1 B;  3QHR B;  4BCM D;  2IW8 B;  4BCQ B;  2WHB B;  4KRD B;  2C5V B;  5LMK B;  2W9Z A;  2WMB B;  4ELJ A;  4II5 B;  5FGK B;  5HBH B;  2BPM B;  3BLQ B;  4EON B;  1KXU A;  2I40 B;  3EOC B;  5IF1 B;  4EOQ B;  4ROE A;  1G3N C;  4EOI B;  2IVX A;  4BCO B;  1URC B;  3G33 B;  1JSU B;  4CFM B;  3TNW B;  4EOS B;  3F5X B;  4EOJ B;  1OIU B;  4BCI B;  1D3U B;  5L2W B;  4YOO A;  1P5E B;  2C5X B;  4F7N B;  1OIY B;  4ROC A;  1XO2 A;  2F2C A;  4TTH A;  1JKW A;  4NST B;  2UZE B;  3MIA B;  4OR5 B;  1TFB A;  5HVY B;  5HBE B;  1OL1 B;  4BCN B;  4KRC B;  4FX3 B;  5LQF B;  2B9R A;  2PK2 A;  5IDN B;  2W9F A;  2JGZ B;  2WFY B;  5HQ0 B;  2C5N B;  4OGR B;  4F6W B;  5I5Z B;  1BU2 A;  4EOO B;  1O9K B;  1E9H B;  3TNI B;  5CYI B;  5HBJ B;  4CXA B;  4YOZ A;  4IMY B;  3BHV B;  1JOW A;  1PKD B;  4ELL A;  1H28 B;  2WPA B;  4CRL B;  2V22 B;  4F7L B;  2PMI B;  1GH6 B;  2G9X B;  2PHG A;  1FVV B;  1GY3 B;  3DOG B;  1H1R B;  2IW6 B;  1H26 B;  4EC8 B;  3POM A;  4CFU D;  1VOL A;  1GUX A;  3H4C A;  1F5Q B; 
#chains in the Genus database with same CATH topology
 1UGQ B;  5HNB B;  1N4M A;  1UNH D;  1AHJ B;  1H1P B;  1AD6 A;  2CJM B;  3LQ5 B;  4AKH A;  1OKW B;  2DD4 B;  4CFW B;  3BG3 A;  1OI9 B;  1H1S B;  2UUE B;  1FKM A;  3VYH B;  3HHT B;  2UZL B;  5CEI B;  2DME A;  2CCI B;  1ZP2 A;  2W99 A;  1H27 B;  4EOM B;  1QMZ B;  2W96 A;  4F6U B;  3WVD B;  4I3Z B;  2IW9 B;  3DJB A;  2C6T B;  5ICP B;  1VYW B;  4EOL B;  2ZPF B;  4AI6 A;  2QDJ A;  4YC3 B;  1UNG D;  4LOC A;  3QHR B;  4BCM D;  2C5V B;  2W9Z A;  4BY7 X;  3TW6 A;  2QGS A;  3BLQ B;  4BBS M;  5IF1 B;  1G3N C;  1URC B;  4EOS B;  1JSU B;  3TNW B;  3BG5 A;  4JX6 A;  1P5E B;  3A8M B;  1XO2 A;  2F2C A;  4TTH A;  4NST B;  5HVY B;  4FX3 B;  5LQF B;  3WVE B;  2JGZ B;  5HQ0 B;  2CZ7 B;  4EOO B;  5DQW A;  4Z6Y A;  3KHI A;  4HNU A;  3BHV B;  2V22 B;  2DXC B;  2CZ1 B;  2DPP B;  4MFD A;  2QQ8 A;  3H4C A;  3HB9 A;  1F5Q B;  4ZGJ B;  4F7S B;  5BNJ B;  4JX4 A;  4G6L B;  2CCH B;  4AKG A;  3TNH B;  4BCN D;  3QYG B;  3MY5 B;  1AIS B;  3DDQ B;  3PO3 S;  3DL1 A;  4BY1 X;  3K7A M;  3BHT B;  2ZPI B;  1C9B A;  1IRE B;  4F7J B;  3A8L B;  1FIN B;  3MI9 B;  3A8H B;  2X1N B;  2W2H A;  4CFV B;  2I53 A;  3BLR B;  4OB1 B;  2KR6 A;  4ELJ A;  3DTO A;  4II5 B;  2CZ6 B;  3QYE A;  2BS3 A;  2ZPB B;  1KXU A;  3EOC B;  3VYG B;  4EOQ B;  4EOI B;  2DXB B;  2IVX A;  3G33 B;  1OIU B;  2LW4 A;  1D3U B;  4AKI A;  4ROC A;  4ZGE B;  3MIA B;  4OR5 B;  4HNV A;  3QYB A;  3QXE B;  4FM4 B;  1OL1 B;  4KRC B;  4F6W B;  3X28 B;  4OGR B;  4OB0 B;  5CYI B;  5HBJ B;  4YOZ A;  1JOW A;  4ELL A;  2ZZD B;  4MIM A;  4CRL B;  2G9X B;  1FVV B;  3B57 A;  1H1R B;  1H26 B;  3POM A;  4CFU D;  1GUX A;  5IDN B;  2PK9 B;  3M03 A;  4EOK B;  3X25 B;  4F70 B;  2UZB B;  1W98 B;  4BCQ D;  2QDY B;  4UN0 A;  1H1Q B;  4YOS A;  1H24 B;  4BCJ B;  2UZD B;  3A8O B;  4Y72 B;  3EID B;  1H4L D;  2CYZ B;  1H25 B;  2WIP B;  4BCM B;  2WJ9 A;  2WXV B;  3O0G D;  4HNT A;  2WMA B;  2CZ0 B;  2IN3 A;  2ZCF B;  1OL2 B;  2PJQ A;  3BG9 A;  2ZPG B;  4BCH B;  4JX5 A;  3TW7 A;  1GUX B;  4BCP B;  4BBR M;  1QLB A;  4CFU B;  2C4G B;  5ACB A;  5DQV A;  4EC9 B;  4QSH A;  2C5O B;  1JST B;  4HLQ A;  4BCQ B;  4ZGD B;  2WMB B;  5EJC A;  5FGK B;  2BPM B;  2AHJ B;  4NC6 A;  4ROE A;  3HZJ A;  2KMG A;  4CFM B;  5L2W B;  2C5X B;  1UGR B;  4F7N B;  3VKH A;  1OIY B;  1JKW A;  2UZE B;  2G77 A;  5IHY A;  4OB3 B;  4BXX X;  3X26 B;  4BCN B;  2B9R A;  2W9F A;  2WFY B;  2C5N B;  1BU2 A;  1E9H B;  3TNI B;  4CXA B;  4IMY B;  1H28 B;  2QFZ A;  4F7L B;  1GH6 B;  4OB2 B;  1GY3 B;  2IW6 B;  4EC8 B;  1ENW A;  4HL4 A;  3TN8 B;  3QYH B;  2R7G A;  2WIH B;  4EOR B;  3BHU B;  3GTM S;  5EFQ B;  3EJ1 B;  2EUF A;  3X20 B;  1V29 B;  3A8G B;  1VIN A;  1OKV B;  4BCK B;  2BKZ B;  1UNL D;  2WEV B;  2DD5 B;  3RGF B;  4BCF B;  3BLH B;  2ZPH B;  1UGP B;  2QF7 A;  3QZ9 B;  4CFX B;  2BS4 A;  4F6S B;  4CFN B;  4BCG B;  1O9K A;  2ZPE B;  3QHW B;  3DDP B;  4ROD A;  1OGU B;  3NDQ A;  5IDP B;  3MY1 B;  2IW8 B;  2WHB B;  4KRD B;  5LMK B;  3X24 B;  1UGS B;  5HBH B;  4EON B;  2I40 B;  1E7P A;  2D0Q B;  3VKG A;  4BCO B;  4EOJ B;  3F5X B;  4BCI B;  4YOO A;  3QWL A;  1TFB A;  5HBE B;  4MFE A;  2PK2 A;  2BS2 A;  5I5Z B;  1O9K B;  4M6V A;  1PKD B;  3QZ5 B;  1TD6 A;  2WPA B;  2PMI B;  2PHG A;  3DOG B;  3HO8 A;  1VOL A;  3HBL A;  4EOP B; 
#chains in the Genus database with same CATH homology
 4F7S B;  2PK9 B;  3M03 A;  5BNJ B;  4EOK B;  3TN8 B;  5HNB B;  4G6L B;  2CCH B;  2R7G A;  4F70 B;  2UZB B;  3TNH B;  4BCN D;  1W98 B;  4BCQ D;  2WIH B;  4EOR B;  1N4M A;  1UNH D;  4UN0 A;  1H1P B;  1H1Q B;  4EOP B;  1AD6 A;  4YOS A;  1H24 B;  2CJM B;  3BHU B;  3LQ5 B;  2UZD B;  4BCJ B;  3MY5 B;  1OKW B;  1AIS B;  4Y72 B;  3EID B;  4CFW B;  3DDQ B;  1H4L D;  5EFQ B;  3EJ1 B;  1OI9 B;  1H25 B;  1H1S B;  2UUE B;  2WIP B;  3K7A M;  4BCM B;  3BHT B;  2EUF A;  2WXV B;  2UZL B;  3O0G D;  5CEI B;  2WMA B;  1VIN A;  2CCI B;  1OKV B;  1C9B A;  1OL2 B;  1ZP2 A;  2W99 A;  1H27 B;  4BCK B;  2BKZ B;  1UNL D;  2WEV B;  4F7J B;  4EOM B;  1QMZ B;  2W96 A;  4BCH B;  4F6U B;  1FIN B;  4I3Z B;  3MI9 B;  2IW9 B;  3RGF B;  4BCF B;  3BLH B;  2X1N B;  2W2H A;  1GUX B;  4BCP B;  2C6T B;  5ICP B;  1VYW B;  4CFX B;  4EOL B;  4CFV B;  4CFU B;  2C4G B;  2I53 A;  5ACB A;  2QDJ A;  4F6S B;  4CFN B;  4EC9 B;  4YC3 B;  3BLR B;  4BCG B;  1O9K A;  3QHW B;  1UNG D;  3DDP B;  4ROD A;  2C5O B;  1OGU B;  5IDP B;  1JST B;  3MY1 B;  3QHR B;  4BCM D;  2IW8 B;  4BCQ B;  2WHB B;  4KRD B;  2C5V B;  5LMK B;  2W9Z A;  2WMB B;  4ELJ A;  4II5 B;  5FGK B;  5HBH B;  2BPM B;  3BLQ B;  4EON B;  1KXU A;  2I40 B;  3EOC B;  5IF1 B;  4EOQ B;  4ROE A;  1G3N C;  4EOI B;  2IVX A;  4BCO B;  1URC B;  3G33 B;  1JSU B;  4CFM B;  3TNW B;  4EOS B;  3F5X B;  4EOJ B;  1OIU B;  4BCI B;  1D3U B;  5L2W B;  4YOO A;  1P5E B;  2C5X B;  4F7N B;  1OIY B;  4ROC A;  1XO2 A;  2F2C A;  4TTH A;  1JKW A;  4NST B;  2UZE B;  3MIA B;  4OR5 B;  1TFB A;  5HVY B;  5HBE B;  1OL1 B;  4BCN B;  4KRC B;  4FX3 B;  5LQF B;  2B9R A;  2PK2 A;  5IDN B;  2W9F A;  2JGZ B;  2WFY B;  5HQ0 B;  2C5N B;  4OGR B;  4F6W B;  5I5Z B;  1BU2 A;  4EOO B;  1O9K B;  1E9H B;  3TNI B;  5CYI B;  5HBJ B;  4CXA B;  4YOZ A;  4IMY B;  3BHV B;  1JOW A;  1PKD B;  4ELL A;  1H28 B;  2WPA B;  4CRL B;  2V22 B;  4F7L B;  2PMI B;  1GH6 B;  2G9X B;  2PHG A;  1FVV B;  1GY3 B;  3DOG B;  1H1R B;  2IW6 B;  1H26 B;  4EC8 B;  3POM A;  4CFU D;  1VOL A;  1GUX A;  3H4C A;  1F5Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...