1VZEA

L. casei thymidylate synthase mutant e60q ternary complex with dump and cb3717
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
316
structure length
316
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSQLLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKAPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFNIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The separate effects of E60Q in Lactobacillus casei thymidylate synthase delineate between mechanisms for formation of intermediates in catalysis.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Methyltransferase
source organism Lactobacillus casei
total genus 85
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1996-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1vzeA00
4KNZA 4EILA 2KCEA 2G8DA 1JMGA 1BO8A 1JTUA 2RDAA 3UWLB 2G8XA 4Q0DA 4DP3A 3CLBA 4DPHA 1JMHA 4XSEA 4KPWA 1JUTA 1KZJA 1VZDA 4O1XA 1BDUA 1NJCA 3IROA 3UWLA 1I00A 1NJAA 3IK0A 3EGYX 4FGTA 4IQQA 3EAWX 1EVFA 1B02A 1JUJA 1JG0A 1F4BA 4H0UA 3TMSA 1TLSA 4KY8A 1LCAA 1VZBA 2TSRA 4G6WX 3EF9A 1JMFA 4FOGA 1F4CA 1TISA 1VZCA 3H9KA 1BP0A 1HZWA 3BHRA 1BKPA 5WRNA 1TVWA 4F2VA 4IQBA 1NJBA 4ISWA 1TSZA 1JTQA 4XSCA 4DPDA 4EZ8A 1F4GA 1FFLA 1F28A 3CL9A 3BYXA 1CI7A 3UM5A 1TDUA 1TSYA 1TVUA 1TJSA 2A9WA 2G86A 3DL6A 4ECKA 1VZEA 1DDUA 1TSMA 2FTQA 4E5OA 1BO7A 1J3IC 1JU6A 1AIQA 3DGAC 3IX6A 1B5EA 3QG2A 1NCEA 1QQQA 1TDBA 4FQSA 4GYHA 4ISKA 1EV8A 2TDMA 3IRMA 1BP6A 5H3AA 5HS3A 3EBUA 1VZAA 3BGXA 1F4FA 4O7UA 1KZIA 3GG5A 1AN5A 1F4EA 4KY4A 3K2HA 1NJDA 4FOAA 4KYAA 1DNAA 1J3KC 3EDWX 1ZPRA 1BSFA 3C0AA 1TSNA 1J3JC 1TSWA 1YPVA 3INVA 1BQ2A 1B5DA 4GEVA 3N5GA 1LCEA 1FWMA 2FTOX 4XSDA 1B49A 3ED7A 1TSDA 5J7WA 2OIPA 3KJRA 2VETA 3HB8A 5H38A 3BZ0A 3BHLA 3IRNA 1BJGA 3NRRA 1TYSA 2AAZA 4LRRA 3KGBA 2BBQA 3OB7A 2ONBA 3B9HA 3V8HA 4EINA 4IRRA 4PSGA 1QZFA 1TSXA 2RD8B 4FOXA 2TSCA 3N5EB 4GD7A 3DL5A 1TDCA 1HW4A 3EJLA 1BPJA 3BNZA 3GH2X 2RD8A 2G8AA 3N5EA 1HW3A 1THYA 4O1UA 2G89A 1TSVA 3IHIA 5FCTA 1TDAA 1HVYA 1BQ1A 1SYNA 1RTSA 1AJMA 2VF0A 1KCEA 1SEJA 3I3RA 3UM6A 4H0RA 4TMSA 4DQ1A 1LCBA 1TRGA 1TVVA 3HBBA 4EB4A 3KJSA 4E28A 2H2QA 3GH0A 1EVGA 1BSPA 1TSLA 3JSUA 1JMIA 1AOBA 1AXWA 1BKOA 3HJ3A 1F4DA 3DG8C 3EHIX 3IK1A 2TDDA 3QJ7A 4G2OX 4H1IA 1EV5A 1NJEA 3C06A 3QGTA 4UP1A 1TLCA 3B5BA 3IJZA 2FTNA 3BFIA 5BY6A 4O1XD 1BIDA 4JEFA 5H39A 3UM8A 4Q0EA
chains in the Genus database with same CATH superfamily
4KNZA 4EILA 2KCEA 2G8DA 1JMGA 1BO8A 1JTUA 2RDAA 3UWLB 2G8XA 4Q0DA 4DP3A 3CLBA 4DPHA 1JMHA 4XSEA 4KPWA 1JUTA 1KZJA 1VZDA 4O1XA 1BDUA 1NJCA 3IROA 3UWLA 1I00A 1NJAA 3IK0A 3EGYX 4FGTA 4IQQA 3EAWX 1EVFA 1B02A 1JUJA 1JG0A 1F4BA 4H0UA 3TMSA 1TLSA 4KY8A 1LCAA 1VZBA 2TSRA 4G6WX 3EF9A 1JMFA 4FOGA 1F4CA 1TISA 1VZCA 3H9KA 1BP0A 1HZWA 3BHRA 1BKPA 5WRNA 1TVWA 4F2VA 4IQBA 1NJBA 4ISWA 1TSZA 1JTQA 4XSCA 4DPDA 4EZ8A 1F4GA 1FFLA 1F28A 3CL9A 3BYXA 1CI7A 3UM5A 1TDUA 1TSYA 1TVUA 1TJSA 2A9WA 2G86A 3DL6A 4ECKA 1VZEA 1DDUA 1TSMA 2FTQA 4E5OA 1BO7A 1J3IC 1JU6A 1AIQA 3DGAC 3IX6A 1B5EA 3QG2A 1NCEA 1QQQA 1TDBA 4FQSA 4GYHA 4ISKA 1EV8A 2TDMA 3IRMA 1BP6A 5H3AA 5HS3A 3EBUA 1VZAA 3BGXA 1F4FA 4O7UA 1KZIA 3GG5A 1AN5A 1F4EA 4KY4A 3K2HA 1NJDA 4FOAA 4KYAA 1DNAA 1J3KC 3EDWX 1ZPRA 1BSFA 3C0AA 1TSNA 1J3JC 1TSWA 1YPVA 3INVA 1BQ2A 1B5DA 4GEVA 3N5GA 1LCEA 1FWMA 2FTOX 4XSDA 1B49A 3ED7A 1TSDA 5J7WA 2OIPA 3KJRA 2VETA 3HB8A 5H38A 3BZ0A 3BHLA 3IRNA 1BJGA 3NRRA 1TYSA 2AAZA 4LRRA 3KGBA 2BBQA 3OB7A 2ONBA 3B9HA 3V8HA 4EINA 4IRRA 4PSGA 1QZFA 1TSXA 2RD8B 4FOXA 2TSCA 3N5EB 4GD7A 3DL5A 1TDCA 1HW4A 3EJLA 1BPJA 3BNZA 3GH2X 2RD8A 2G8AA 3N5EA 1HW3A 1THYA 4O1UA 2G89A 1TSVA 3IHIA 5FCTA 1TDAA 1HVYA 1BQ1A 1SYNA 1RTSA 1AJMA 2VF0A 1KCEA 1SEJA 3I3RA 3UM6A 4H0RA 4TMSA 4DQ1A 1LCBA 1TRGA 1TVVA 3HBBA 4EB4A 3KJSA 4E28A 2H2QA 3GH0A 1EVGA 1BSPA 1TSLA 3JSUA 1JMIA 1AOBA 1AXWA 1BKOA 3HJ3A 1F4DA 3DG8C 3EHIX 3IK1A 2TDDA 3QJ7A 4G2OX 4H1IA 1EV5A 1NJEA 3C06A 3QGTA 4UP1A 1TLCA 3B5BA 3IJZA 2FTNA 3BFIA 5BY6A 4O1XD 1BIDA 4JEFA 5H39A 3UM8A 4Q0EA
chains in the Genus database with same CATH topology
4KNZA 4EILA 2KCEA 2G8DA 1JMGA 1BO8A 1JTUA 2RDAA 3UWLB 2G8XA 4Q0DA 4DP3A 3CLBA 4DPHA 1JMHA 4XSEA 4KPWA 1JUTA 1KZJA 1VZDA 4O1XA 1BDUA 1NJCA 3IROA 3UWLA 1I00A 1NJAA 3IK0A 3EGYX 4FGTA 4IQQA 3EAWX 1EVFA 1B02A 1JUJA 1JG0A 1F4BA 4H0UA 3TMSA 1TLSA 4KY8A 1LCAA 1VZBA 2TSRA 4G6WX 3EF9A 1JMFA 4FOGA 1F4CA 1TISA 1VZCA 3H9KA 1BP0A 1HZWA 3BHRA 1BKPA 5WRNA 1TVWA 4F2VA 4IQBA 1NJBA 4ISWA 1TSZA 1JTQA 4XSCA 4DPDA 4EZ8A 1F4GA 1FFLA 1F28A 3CL9A 3BYXA 1CI7A 3UM5A 1TDUA 1TSYA 1TVUA 1TJSA 2A9WA 2G86A 3DL6A 4ECKA 1VZEA 1DDUA 1TSMA 2FTQA 4E5OA 1BO7A 1J3IC 1JU6A 1AIQA 3DGAC 3IX6A 1B5EA 3QG2A 1NCEA 1QQQA 1TDBA 4FQSA 4GYHA 4ISKA 1EV8A 2TDMA 3IRMA 1BP6A 5H3AA 5HS3A 3EBUA 1VZAA 3BGXA 1F4FA 4O7UA 1KZIA 3GG5A 1AN5A 1F4EA 4KY4A 3K2HA 1NJDA 4FOAA 4KYAA 1DNAA 1J3KC 3EDWX 1ZPRA 1BSFA 3C0AA 1TSNA 1J3JC 1TSWA 1YPVA 3INVA 1BQ2A 1B5DA 4GEVA 3N5GA 1LCEA 1FWMA 2FTOX 4XSDA 1B49A 3ED7A 1TSDA 5J7WA 2OIPA 3KJRA 2VETA 3HB8A 5H38A 3BZ0A 3BHLA 3IRNA 1BJGA 3NRRA 1TYSA 2AAZA 4LRRA 3KGBA 2BBQA 3OB7A 2ONBA 3B9HA 3V8HA 4EINA 4IRRA 4PSGA 1QZFA 1TSXA 2RD8B 4FOXA 2TSCA 3N5EB 4GD7A 3DL5A 1TDCA 1HW4A 3EJLA 1BPJA 3BNZA 3GH2X 2RD8A 2G8AA 3N5EA 1HW3A 1THYA 4O1UA 2G89A 1TSVA 3IHIA 5FCTA 1TDAA 1HVYA 1BQ1A 1SYNA 1RTSA 1AJMA 2VF0A 1KCEA 1SEJA 3I3RA 3UM6A 4H0RA 4TMSA 4DQ1A 1LCBA 1TRGA 1TVVA 3HBBA 4EB4A 3KJSA 4E28A 2H2QA 3GH0A 1EVGA 1BSPA 1TSLA 3JSUA 1JMIA 1AOBA 1AXWA 1BKOA 3HJ3A 1F4DA 3DG8C 3EHIX 3IK1A 2TDDA 3QJ7A 4G2OX 4H1IA 1EV5A 1NJEA 3C06A 3QGTA 4UP1A 1TLCA 3B5BA 3IJZA 2FTNA 3BFIA 5BY6A 4O1XD 1BIDA 4JEFA 5H39A 3UM8A 4Q0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KNZ A;  4EIL A;  2KCE A;  2G8D A;  1JMG A;  1BO8 A;  1JTU A;  2RDA A;  3UWL B;  2G8X A;  4Q0D A;  4DP3 A;  3CLB A;  4DPH A;  1JMH A;  4XSE A;  4KPW A;  1JUT A;  1KZJ A;  1VZD A;  4O1X A;  1BDU A;  1NJC A;  3IRO A;  3UWL A;  1I00 A;  1NJA A;  3IK0 A;  3EGY X;  4FGT A;  4IQQ A;  3EAW X;  1EVF A;  1B02 A;  1JUJ A;  1JG0 A;  1F4B A;  4H0U A;  3TMS A;  1TLS A;  4KY8 A;  1LCA A;  1VZB A;  2TSR A;  4G6W X;  3EF9 A;  1JMF A;  4FOG A;  1F4C A;  1TIS A;  1VZC A;  3H9K A;  1BP0 A;  1HZW A;  3BHR A;  1BKP A;  5WRN A;  1TVW A;  4F2V A;  4IQB A;  1NJB A;  4ISW A;  1TSZ A;  1JTQ A;  4XSC A;  4DPD A;  4EZ8 A;  1F4G A;  1FFL A;  1F28 A;  3CL9 A;  3BYX A;  1CI7 A;  3UM5 A;  1TDU A;  1TSY A;  1TVU A;  1TJS A;  2A9W A;  2G86 A;  3DL6 A;  4ECK A;  1VZE A;  1DDU A;  1TSM A;  2FTQ A;  4E5O A;  1BO7 A;  1J3I C;  1JU6 A;  1AIQ A;  3DGA C;  3IX6 A;  1B5E A;  3QG2 A;  1NCE A;  1QQQ A;  1TDB A;  4FQS A;  4GYH A;  4ISK A;  1EV8 A;  2TDM A;  3IRM A;  1BP6 A;  5H3A A;  5HS3 A;  3EBU A;  1VZA A;  3BGX A;  1F4F A;  4O7U A;  1KZI A;  3GG5 A;  1AN5 A;  1F4E A;  4KY4 A;  3K2H A;  1NJD A;  4FOA A;  4KYA A;  1DNA A;  1J3K C;  3EDW X;  1ZPR A;  1BSF A;  3C0A A;  1TSN A;  1J3J C;  1TSW A;  1YPV A;  3INV A;  1BQ2 A;  1B5D A;  4GEV A;  3N5G A;  1LCE A;  1FWM A;  2FTO X;  4XSD A;  1B49 A;  3ED7 A;  1TSD A;  5J7W A;  2OIP A;  3KJR A;  2VET A;  3HB8 A;  5H38 A;  3BZ0 A;  3BHL A;  3IRN A;  1BJG A;  3NRR A;  1TYS A;  2AAZ A;  4LRR A;  3KGB A;  2BBQ A;  3OB7 A;  2ONB A;  3B9H A;  3V8H A;  4EIN A;  4IRR A;  4PSG A;  1QZF A;  1TSX A;  2RD8 B;  4FOX A;  2TSC A;  3N5E B;  4GD7 A;  3DL5 A;  1TDC A;  1HW4 A;  3EJL A;  1BPJ A;  3BNZ A;  3GH2 X;  2RD8 A;  2G8A A;  3N5E A;  1HW3 A;  1THY A;  4O1U A;  2G89 A;  1TSV A;  3IHI A;  5FCT A;  1TDA A;  1HVY A;  1BQ1 A;  1SYN A;  1RTS A;  1AJM A;  2VF0 A;  1KCE A;  1SEJ A;  3I3R A;  3UM6 A;  4H0R A;  4TMS A;  4DQ1 A;  1LCB A;  1TRG A;  1TVV A;  3HBB A;  4EB4 A;  3KJS A;  4E28 A;  2H2Q A;  3GH0 A;  1EVG A;  1BSP A;  1TSL A;  3JSU A;  1JMI A;  1AOB A;  1AXW A;  1BKO A;  3HJ3 A;  1F4D A;  3DG8 C;  3EHI X;  3IK1 A;  2TDD A;  3QJ7 A;  4G2O X;  4H1I A;  1EV5 A;  1NJE A;  3C06 A;  3QGT A;  4UP1 A;  1TLC A;  3B5B A;  3IJZ A;  2FTN A;  3BFI A;  5BY6 A;  4O1X D;  1BID A;  4JEF A;  5H39 A;  3UM8 A;  4Q0E A; 
#chains in the Genus database with same CATH topology
 4KNZ A;  4EIL A;  2KCE A;  2G8D A;  1JMG A;  1BO8 A;  1JTU A;  2RDA A;  3UWL B;  2G8X A;  4Q0D A;  4DP3 A;  3CLB A;  4DPH A;  1JMH A;  4XSE A;  4KPW A;  1JUT A;  1KZJ A;  1VZD A;  4O1X A;  1BDU A;  1NJC A;  3IRO A;  3UWL A;  1I00 A;  1NJA A;  3IK0 A;  3EGY X;  4FGT A;  4IQQ A;  3EAW X;  1EVF A;  1B02 A;  1JUJ A;  1JG0 A;  1F4B A;  4H0U A;  3TMS A;  1TLS A;  4KY8 A;  1LCA A;  1VZB A;  2TSR A;  4G6W X;  3EF9 A;  1JMF A;  4FOG A;  1F4C A;  1TIS A;  1VZC A;  3H9K A;  1BP0 A;  1HZW A;  3BHR A;  1BKP A;  5WRN A;  1TVW A;  4F2V A;  4IQB A;  1NJB A;  4ISW A;  1TSZ A;  1JTQ A;  4XSC A;  4DPD A;  4EZ8 A;  1F4G A;  1FFL A;  1F28 A;  3CL9 A;  3BYX A;  1CI7 A;  3UM5 A;  1TDU A;  1TSY A;  1TVU A;  1TJS A;  2A9W A;  2G86 A;  3DL6 A;  4ECK A;  1VZE A;  1DDU A;  1TSM A;  2FTQ A;  4E5O A;  1BO7 A;  1J3I C;  1JU6 A;  1AIQ A;  3DGA C;  3IX6 A;  1B5E A;  3QG2 A;  1NCE A;  1QQQ A;  1TDB A;  4FQS A;  4GYH A;  4ISK A;  1EV8 A;  2TDM A;  3IRM A;  1BP6 A;  5H3A A;  5HS3 A;  3EBU A;  1VZA A;  3BGX A;  1F4F A;  4O7U A;  1KZI A;  3GG5 A;  1AN5 A;  1F4E A;  4KY4 A;  3K2H A;  1NJD A;  4FOA A;  4KYA A;  1DNA A;  1J3K C;  3EDW X;  1ZPR A;  1BSF A;  3C0A A;  1TSN A;  1J3J C;  1TSW A;  1YPV A;  3INV A;  1BQ2 A;  1B5D A;  4GEV A;  3N5G A;  1LCE A;  1FWM A;  2FTO X;  4XSD A;  1B49 A;  3ED7 A;  1TSD A;  5J7W A;  2OIP A;  3KJR A;  2VET A;  3HB8 A;  5H38 A;  3BZ0 A;  3BHL A;  3IRN A;  1BJG A;  3NRR A;  1TYS A;  2AAZ A;  4LRR A;  3KGB A;  2BBQ A;  3OB7 A;  2ONB A;  3B9H A;  3V8H A;  4EIN A;  4IRR A;  4PSG A;  1QZF A;  1TSX A;  2RD8 B;  4FOX A;  2TSC A;  3N5E B;  4GD7 A;  3DL5 A;  1TDC A;  1HW4 A;  3EJL A;  1BPJ A;  3BNZ A;  3GH2 X;  2RD8 A;  2G8A A;  3N5E A;  1HW3 A;  1THY A;  4O1U A;  2G89 A;  1TSV A;  3IHI A;  5FCT A;  1TDA A;  1HVY A;  1BQ1 A;  1SYN A;  1RTS A;  1AJM A;  2VF0 A;  1KCE A;  1SEJ A;  3I3R A;  3UM6 A;  4H0R A;  4TMS A;  4DQ1 A;  1LCB A;  1TRG A;  1TVV A;  3HBB A;  4EB4 A;  3KJS A;  4E28 A;  2H2Q A;  3GH0 A;  1EVG A;  1BSP A;  1TSL A;  3JSU A;  1JMI A;  1AOB A;  1AXW A;  1BKO A;  3HJ3 A;  1F4D A;  3DG8 C;  3EHI X;  3IK1 A;  2TDD A;  3QJ7 A;  4G2O X;  4H1I A;  1EV5 A;  1NJE A;  3C06 A;  3QGT A;  4UP1 A;  1TLC A;  3B5B A;  3IJZ A;  2FTN A;  3BFI A;  5BY6 A;  4O1X D;  1BID A;  4JEF A;  5H39 A;  3UM8 A;  4Q0E A; 
#chains in the Genus database with same CATH homology
 4KNZ A;  4EIL A;  2KCE A;  2G8D A;  1JMG A;  1BO8 A;  1JTU A;  2RDA A;  3UWL B;  2G8X A;  4Q0D A;  4DP3 A;  3CLB A;  4DPH A;  1JMH A;  4XSE A;  4KPW A;  1JUT A;  1KZJ A;  1VZD A;  4O1X A;  1BDU A;  1NJC A;  3IRO A;  3UWL A;  1I00 A;  1NJA A;  3IK0 A;  3EGY X;  4FGT A;  4IQQ A;  3EAW X;  1EVF A;  1B02 A;  1JUJ A;  1JG0 A;  1F4B A;  4H0U A;  3TMS A;  1TLS A;  4KY8 A;  1LCA A;  1VZB A;  2TSR A;  4G6W X;  3EF9 A;  1JMF A;  4FOG A;  1F4C A;  1TIS A;  1VZC A;  3H9K A;  1BP0 A;  1HZW A;  3BHR A;  1BKP A;  5WRN A;  1TVW A;  4F2V A;  4IQB A;  1NJB A;  4ISW A;  1TSZ A;  1JTQ A;  4XSC A;  4DPD A;  4EZ8 A;  1F4G A;  1FFL A;  1F28 A;  3CL9 A;  3BYX A;  1CI7 A;  3UM5 A;  1TDU A;  1TSY A;  1TVU A;  1TJS A;  2A9W A;  2G86 A;  3DL6 A;  4ECK A;  1VZE A;  1DDU A;  1TSM A;  2FTQ A;  4E5O A;  1BO7 A;  1J3I C;  1JU6 A;  1AIQ A;  3DGA C;  3IX6 A;  1B5E A;  3QG2 A;  1NCE A;  1QQQ A;  1TDB A;  4FQS A;  4GYH A;  4ISK A;  1EV8 A;  2TDM A;  3IRM A;  1BP6 A;  5H3A A;  5HS3 A;  3EBU A;  1VZA A;  3BGX A;  1F4F A;  4O7U A;  1KZI A;  3GG5 A;  1AN5 A;  1F4E A;  4KY4 A;  3K2H A;  1NJD A;  4FOA A;  4KYA A;  1DNA A;  1J3K C;  3EDW X;  1ZPR A;  1BSF A;  3C0A A;  1TSN A;  1J3J C;  1TSW A;  1YPV A;  3INV A;  1BQ2 A;  1B5D A;  4GEV A;  3N5G A;  1LCE A;  1FWM A;  2FTO X;  4XSD A;  1B49 A;  3ED7 A;  1TSD A;  5J7W A;  2OIP A;  3KJR A;  2VET A;  3HB8 A;  5H38 A;  3BZ0 A;  3BHL A;  3IRN A;  1BJG A;  3NRR A;  1TYS A;  2AAZ A;  4LRR A;  3KGB A;  2BBQ A;  3OB7 A;  2ONB A;  3B9H A;  3V8H A;  4EIN A;  4IRR A;  4PSG A;  1QZF A;  1TSX A;  2RD8 B;  4FOX A;  2TSC A;  3N5E B;  4GD7 A;  3DL5 A;  1TDC A;  1HW4 A;  3EJL A;  1BPJ A;  3BNZ A;  3GH2 X;  2RD8 A;  2G8A A;  3N5E A;  1HW3 A;  1THY A;  4O1U A;  2G89 A;  1TSV A;  3IHI A;  5FCT A;  1TDA A;  1HVY A;  1BQ1 A;  1SYN A;  1RTS A;  1AJM A;  2VF0 A;  1KCE A;  1SEJ A;  3I3R A;  3UM6 A;  4H0R A;  4TMS A;  4DQ1 A;  1LCB A;  1TRG A;  1TVV A;  3HBB A;  4EB4 A;  3KJS A;  4E28 A;  2H2Q A;  3GH0 A;  1EVG A;  1BSP A;  1TSL A;  3JSU A;  1JMI A;  1AOB A;  1AXW A;  1BKO A;  3HJ3 A;  1F4D A;  3DG8 C;  3EHI X;  3IK1 A;  2TDD A;  3QJ7 A;  4G2O X;  4H1I A;  1EV5 A;  1NJE A;  3C06 A;  3QGT A;  4UP1 A;  1TLC A;  3B5B A;  3IJZ A;  2FTN A;  3BFI A;  5BY6 A;  4O1X D;  1BID A;  4JEF A;  5H39 A;  3UM8 A;  4Q0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...