1VZZA

Crystal structure of mutant enzyme y32f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
120
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords STEROID DELTA-ISOMERASE
total genus 33
structure length 120
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vzzA00
3GZRA 1GYBA 1DMNA 3DM8A 4WP5A 4HM7B 1BUQA 2RFRA 1QJGA 2I9WA 3NM2A 4XDWA 3EJVA 5D83A 3S5CA 3JUPA 3MG2A 3MKIA 5DREA 1NU3A 2HMMB 4LMIA 5CXOA 5AIIA 3JUOA 3OXAA 1E3RA 1NDOB 1OF5B 3CU3A 1E97A 3FH1A 2HMOB 4J9AA 2W2CA 4PEJA 1STDA 2F98A 2QGUA 4HJLB 4LEHA 3MG3A 2YFLB 4H3UA 4XM4A 3KE7A 3KSPA 3HZPA 3OV4A 4STDA 3SOAA 1UUWB 2YFIB 5AEUB 3F8XA 3LYGA 5CF1A 1EG9B 3H3HA 4HM2B 3VSYA 3BB9A 3F7SA 1AR0A 1JKGB 1ISKA 5IG3A 1S5AA 5G2GA 3NBRA 1OGZA 5AI1A 3OWYA 2HMJB 5JPUA 3DUKA 4HKVB 4WYKA 3STDA 2PZVA 4OVMA 1HKXA 4FCJA 2XR8B 1A2KA 1O7GB 3DMCA 3NXJA 1Z1SA 2QIYA 1NWWA 4HM3B 3ECFA 1W00A 3MYTA 4XB5A 5CLKA 3B8LA 2R4IA 4N3VA 1W6YA 3MG1A 3OWUA 3NV0A 5STDA 1OUNA 2UX0A 4R1KA 1ULJB 3JUQA 2OWPA 2HMLB 2B1XB 2GBWB 2INXA 2K54A 4L7KA 4XBTA 5AIFA 1WQLB 2XSHB 5AEWB 8CHOA 3NV0B 2GXFA 1E3VA 1OHSA 3EBYA 3FF2A 3G16A 4U13A 1O7PB 3CNXA 3RGAA 4FCMA 3K0ZA 1QMAA 2HMNB 4OUQA 3F9SA 3G8ZA 3F7XA 3EHCA 4HM4B 5D81A 5IG0A 3SEDA 5IG5A 3B4PA 3Q90A 1DMMA 4X2HA 4R9LA 3CNMA 3DXOA 4ORLA 1W01A 1ASKA 2A15A 4KVHA 1JN5A 3EN1B 1ULIB 1OHPA 2IMJA 3D9RA 2Z77A 2BMQB 3M8CA 4XBYA 3ROBA 5EVHA 1Q40A 2STDA 3EN8A 3GZXB 3MHEA 3MSOA 3SOYA 3B4OA 2GBXB 4HM5B 4HM6B 5DRVA 2CKFB 2BMOB 4WYKB 5D82A 1K41A 4J8TA 3FGYA 4I4KA 1U5OA 2XRXB 3EC9A 4HZBB 3JUNA 3G0KA 4X2OA 1OPYA 3KKGA 1JKGA 3LZAA 2B24B 1VZZA 5IERA 4GB5A 5IEOA 1OH0A 5AIHA 1SJWA 4HM8B 2GEYA 5KP3A 3GRDA 3FF0A 4IIAA 5HGRA 3F40A 5AIGA 1JB5A 3FKAA 4XBXA 2HMKB 1JN5B 4LGQA 1GS3A 3E99A 3WMDA 5IG4A 1JB2A 1TUHA 3GZYB 1GY6A 1TP6A 1ZO2A 3OX9A 3OWSA 4HZ9B 1EA2A 4MJDA 5FW5A 3T8UA 1IDPA 3EBTA 3FZWA 3UJMA 5IENA 5KP1A 2CHCA 1UUVB 1Q42A 2Z76A 4Q53A 1JB4A 1O7HB 2YFJB 2F86B 3ER7A 3GWRA 3VGNA 4CDLA 7STDA 3EX9A 3NUVA 4L8OA 5JPPA 5TGNA 5KP4A 3CPOA 3FSDA 3T8NA 3BLZA 1C7HA 4L8PA 4WWUC 6STDA 1OF5A 2GEXA 1O7MB 2XSOB 3HX8A 3EQQB 3RGRA 1GY7A 1OHOA 2Z7AA 3IPTA 3JUMA 3NHXA 4HM0B 4K1UA 1OGXA 2BNGA 2RCDA 1ZX2A 2F99A 2JQ5A 2RGQA 1CQSA 3DZLA 3GZBA 3HK4A 1GY5A 4HM1B 3A76A 4RZMA 5BVBA 1Q40B 3K7CA 3H51A 1OCVA 3UNLA 3FLJA 4HVNA 2BMRB 3EF8A 3F14A 3F8HA 5CF2A 4R9KA 5IEPA 1O7NB 3I0YA 5CK6A 5IF6A 3B7CA 3KZTA 1W02A 1O7WB 5BXQA 4XDVA 4K1VA 1DMQA
chains in the Genus database with same CATH superfamily
1UI7A 3D4AA 3GZRA 1BRIA 1SARA 3FG1A 3L0RA 1BIRA 1FGQA 4HM7B 4WP5A 3LT8A 1BU4A 4XDWA 1YI23 4RNTA 1N5HA 3EB8A 1FUTA 1Q9EA 2F56A 3MKIA 1MNLA 5EQLA 3S28A 1FW7A 3CC23 2HMMB 1G96A 5BU4A 3JUOA 4RNZA 1NDOB 1OF5B 2HOHA 1I8VA 3U97A 2WGOA 4ILFA 1IT8A 3GAXA 4HJLB 1WTHA 2V1LA 1QVG2 2YFLB 4H3UA 4O02B 1RSNA 4XM4A 1JBTA 3KE7A 4STDA 5AEUB 5CF1A 4HM2B 4BU4A 1RKYA 2RNTA 4R80A 5IG3A 2XF3A 3AGOA 3NBRA 5M1AA 2CW9A 5I97A 3S67A 4O8SA 4KZ1A 4OVMA 1Z1SA 1VQ43 1F8NA 2KCDA 1JBSA 1BRKA 2R4IA 1UGIA 1V57A 1W2ZA 3OWUA 2UX0A 1ROVA 1JZDA 1ULJB 1WMPA 4R4KA 5AYSC 2B1XB 2BU4A 2BIRA 4NREA 4L7KA 3CCR3 1N9JA 1CYUA 3AGNA 3J7Yd 1NB5I 3JVCA 5AIGA 1E3VA 1EEJA 2C10A 3RGAA 1VQN3 1QMAA 2HMNB 3Q1CA 4HM4B 1UDII 4WHAA 5IG5A 3B4PA 3Q90A 1RNBA 4X2HA 1TJDA 2LQVA 3DGMA 4R9LA 1ASKA 2P0MA 1LOWA 3D9RA 3ROBA 4BTYA 1B2ZA 2Z77A 4WFOA 2CFLA 5EVHA 3GZXB 3SOYA 1CYVA 3WOEB 2ZHXB 3PCRA 3B4OA 4HM6B 3LXUX 3CXC2 2AADA 1W5ZA 1B27A 4HZBB 1SPUA 3AMOB 3G0KA 1OPYA 1Y4KA 2CC3A 4G1MB 4LSOA 1A2VA 2J8XB 2P38A 1M1K4 4RBNA 1MOLA 1K8A4 1QAKA 1TTOA 5KP3A 1DVCA 3LOYA 1BNGA 4J5KA 5HGRA 3F40A 3I563 1M1XB 1ZS7A 2UUGC 1EUIC 1CH0A 4O2HA 1DETA 2MC8A 1GS3A 3CME3 3E99A 1TFOA 2WGQA 3GZYB 1GY6A 1TP6A 3OWSA 1MGWA 3G6E3 3NQZA 1RN4A 5KP1A 3VF1A 2CWVA 1UUVB 2Z76A 4Q53A 1C54A 1R4YA 4HOHA 3ER7A 5KP4A 4L8OA 2QA43 3T8NA 1BSAA 1OF5A 1O7MB 1GOUA 1TRQA 3EQQB 3HX8A 3AHWA 9RNTA 4HM0B 3JUMA 3NHXA 4BL3A 2H0IA 1G02A 1OGXA 2FXTA 1AVKA 1CQSA 1QALA 1IV9A 1BRSA 1ZGXA 2UGIA 2O9UX 4HM1B 3K7CA 1OCVA 3V98A 1KWIA 3FLJA 1GSPA 3F14A 2FNQA 1SIHA 3UL5A 1RGLA 2KXGA 1VQM3 3RDEA 1RMSA 1GYBA 1DMNA 3DM8A 4N6OB 1BUQA 1RGHA 2CH9A 3BNEA 1X1WA 3NM2A 3EJVA 1GOYA 3JUPA 3MG2A 1I0XA 1Q7Y4 2OTJ3 2W9PA 4I5QA 5AIIA 1TFKA 4N6MA 2K3DA 4J9AA 1U8CB 2HMOB 1UCLA 1W6CA 1PU4A 1STDA 1TIJA 3QRDA 3KN4A 1FUSA 4LEHA 3I553 3MG3A 2H0HA 1RGCA 4EW5A 3KSPA 3HZPA 3OV4A 4K61A 1W6GA 3D5IA 2IYJA 3LYGA 3MWZA 3CCE3 3VSYA 1JV2B 3BB9A 3ZFZA 1VQ53 1AR0A 2ZA4A 1BOXA 1FGMA 1MWSA 3LTBA 1GMRA 3WA2X 3NM7A 2OOVA 1HKXA 1RDSA 2LYXA 1DYUA 3DMCA 3NXJA 1LNHA 4AKYA 2H0GA 3ECFA 4XB5A 5CLKA 3X3YA 1V58A 3B8LA 1GMQA 3N8BA 2CG0A 3MG1A 3CC73 2W56B 3NV0A 1FUWA 4N6UA 1B2UA 4R1KA 3JUQA 5BIRA 2OWPA 2HMLB 2RBIA 2IY2A 1K734 5AIFA 1IT7A 1YGEA 3BU4A 2XSHB 1PYLA 5IF6A 1OHSA 2E2VA 4U13A 1O7PB 3K0ZA 3F9SA 1RNTA 1LOVA 1RGFA 1T2HA 3EHCA 3SEDA 3WOFB 1EQKA 1DMMA 4BL2A 3LMLA 3PGBA 1VQ83 1RRHA 3BNCA 3CNMA 3DXOA 3FCSB 4BIRA 3DGLA 4KVHA 1JN5A 1IVVA 2BT3A 3EN1B 3LT9A 1CEWI 2IMJA 2K0MA 3KFQC 1V74A 2Q07A 4AEQA 1BSDA 1YGWA 2JDIH 3Q2PA 2GBXB 2CKFB 1GD4A 2BMOB 1RGGA 1MWTA 4WYKB 8RNTA 1HU9A 1RCKA 3CCL3 4I4KA 3RNTA 1A2PA 1U5OA 2XRXB 2CFWA 3KKGA 2Y74A 1Q864 2B24B 1BRNL 1IQXA 2M7OA 1US1A 1B3SA 1BNEA 6GSPA 5IEOA 2OQEA 3ZG5A 1YVSA 2YX9A 3G4S3 2W0QA 4HM8B 1FYSA 3ZG0A 1Q814 1I70A 1YIJ3 1FGRA 1T5YA 2KF3A 4XBXA 2HMKB 3URPA 1Q7HA 1LOYA 2PNCA 3NBJA 3G713 1IQ8A 4EV5A 3OW22 1TUHA 1I2GA 4HZ9B 1ZO2A 5FW5A 2XH9A 3T8UA 3UJMA 3FZWA 4EBGA 1STFI 1SIIA 4RNYA 7RNTA 1O7HB 3GWRA 3VGNA 5JPPA 2CIUA 2ML6A 3EX9A 1W4NA 2KAAA 1S723 5TGNA 1T3BA 3FSDA 2W6JH 3O8YA 4L8PA 4K90B 2GEXA 2RSXA 1D6UA 3WDGB 1N8R4 2ZL8A 1YIT3 4HBRA 2F5MA 1AV4A 2BNGA 4FMDA 3HK4A 3TDGA 2L4VA 4RZMA 3DZLA 1GY5A 3A76A 3SYUA 1UCJA 3H51A 3UNLA 1I2FA 4HVNA 1HYFA 2BMRB 3F8HA 4CPKA 1BNSA 1BNIA 4R9KA 5IEPA 1IK3A 3I0YA 5IW9A 1O7WB 4K1VA 2QIYA 1VQL3 2P0XA 2Y73A 2RFRA 1QJGA 5D83A 1PFPA 3IJEB 1RGKA 3MPHA 1NU3A 1UCIA 4OK0A 1W2B2 1A67A 2XGNA 3PYJA 1E3RA 1WMNA 3CU3A 3FH1A 3CCJ3 1M904 2W2CA 2W56A 3EE1A 2F98A 1RLSA 2ML5A 3SOAA 2IA7A 1UUWB 1KC84 3F8XA 1EG9B 1X1UA 3LTAA 3F7SA 3V92A 4FMBA 4FMCA 4KFEA 1JKGB 2SBLA 1S5AA 1W7CA 5G2GA 3X40A 1RTUA 3OWYA 1X1YA 5JPUA 3DUKA 4WYKA 2KF4A 4FCJA 2C4BA 1A2KA 1YVBI 4HM3B 1NWWA 1LRAA 4LZIA 7GSPA 3KSED 5STDA 1ROAA 3HIGA 2XGLA 1TRPA 1VQO3 1B21A 1B2XA 1IVUA 1VQQA 1N9EA 4MEIA 2CWTA 5AEWB 8CHOA 3NV0B 2GXFA 5LC7A 1UW1A 3SX1A 1EKMA 5D81A 4OUQA 4NHFA 2GU1A 1FZUA 2F5WA 2KRTA 3D79A 5IG0A 2IUJA 2D1WA 1YJW3 5A0OB 1BSEA 1QAFA 1W01A 3GSPA 1Q824 2GSPA 1ULIB 1OHPA 3FG3A 2BMQB 4DKIA 1IVXA 1YNVX 1OACA 1Q40A 3MSOA 3X41A 3MHEA 1RGAA 4N6LA 1RN7A 2KF6A 4JF8A 5DRVA 1NO3A 3BNBA 3LTDA 4CCVA 1IVWA 4MMZB 2CFGA 1BNJA 5ELJA 4X2OA 5AYRB 3LZAA 1KD14 1IQYA 2W9QA 1YHQ3 1VZZA 3WA3A 5IERA 1UUGB 2FGTA 1IV7A 1OH0A 4IT7A 1D6YA 1RHLA 1SJWA 1RRLA 2GEYA 4TX4A 5AIHA 3D5GA 3FF0A 3GRDA 3HOHA 4IIAA 2QEX3 5FGOA 1LXEA 1WMOA 4NPBA 1BRHA 3NQYA 3FKAA 4AKZA 1R4CA 4HAAA 4LGQA 1N8QA 4GSPA 4EC6A 3ALAA 1JNQA 1LVNA 1VQ73 4BTWA 2GU3A 3EBTA 2SARA 1B20A 1AQZA 1RJOA 5EEOA 2W04A 4EYCA 1Q42A 5IENA 1BGSA 1JB4A 2YFJB 4CDLA 2F86B 3UB1A 7STDA 2CFKA 3FG4A 3NUVA 3X42A 3PXMA 3CPOA 3PS8A 2CG1A 4GL6A 1UGHI 2XSOB 1I3IA 2P05A 3RGRA 1VQK3 1GY7A 4FMAA 1VQ63 1DVDA 4K1UA 1VQP3 2RCDA 4LYLB 1ZX2A 2F99A 2JQ5A 2ZDJA 3GZBA 3N9HA 1BNFA 2IUKA 1Q40B 5CF2A 1YJN3 1BAOA 1GOVA 5CK6A 1N5PA 1UCKA 2XFTA 3B7CA 1W02A 5BXQA 1FGTA 1D6ZA 1DMQA 3QK9A 4N6V0 3UL6A 1JRQA 5M18A 3SLUA 2Z6BA 1X1XA 2I9WA 3SXXA 3S5CA 2OTL3 3PZWA 5DREA 2XEPA 3X3ZA 2OQEC 3CCV3 4N6NB 3LH4A 4LMIA 5CXOA 5ELUA 3CCQ3 3OXAA 4HYZA 1E97A 4GHOA 4PEJA 1YJ93 1BUJA 3DGOA 2QGUA 1LNIA 2CWUA 2WO0A 2OOVC 1BANA 1I0VA 4KT3B 2YFIB 1RGEA 3H3HA 5RNTA 1VQ93 2BO9B 1G0TA 3WODG 5HOHA 4IPBA 1BRJA 5AI1A 1OGZA 1BNRA 1RN1A 1MWUA 2HMJB 4HKVB 2XFSA 4MMXB 3STDA 2PZVA 2XR8B 1J2BA 1O7GB 3NBBA 3PCSA 3DY5A 1NB3I 1W00A 3MYTA 3CCS3 3K5TA 3U1WA 4N3VA 4FR9A 3K63A 1W6YA 4CJNA 3CCM3 1BSCA 4N6TA 1NNVA 1OUNA 3CD63 3WHOA 1QVF2 1IYYA 1HZ1A 2GBWB 2INXA 2K54A 4XBTA 2D42A 1WQLB 1I2EA 2R41A 4KFDA 3G16A 3EBYA 3FF2A 4O3VA 4QWTA 5GSPA 5IG4A 3CNXA 3N54B 4FCMA 3X3XA 3G8ZA 1LQMB 3F7XA 3DGYA 3WR2A 1KSIA 3HIIA 2WOHA 4ORLA 1FA3A 1RCLA 2A15A 1B2MA 2W03A 3M8CA 2BHMA 4XBYA 1JJ22 3AHSA 4H61A 2AAEA 3EN8A 2STDA 1K28A 3AMOA 1LOXA 4HM5B 3KCHA 3Q3FA 5JBSA 4JRFA 2KF5A 4EV2A 5D82A 1K41A 4J8TA 3FGYA 4ZM8A 5M19A 3CMA3 6RNTA 1DE3A 3EC9A 1GD3A 3JUNA 2MF7A 1JKGA 2OCTA 2CX1A 2C11A 4J5GA 1AY7A 1SQWA 4GB5A 3K9MC 1MWRA 1WNHA 2E2UA 4MMYB 2P09A 1L5GB 3CCU3 1NJI4 5G1LA 1AVLA 1JB5A 3D3LA 3CPW2 1UI8A 2L1SA 1JN5B 1T2IA 3NX0A 3WMDA 2CFDA 1JB2A 3V99A 4BTXA 1K9M4 1BRGA 1B2SA 1PY3A 2WOFA 3DH2A 3OX9A 3S29A 4KFFA 4MJDA 1EA2A 4EXRA 1ISKA 1IDPA 3HI7A 1FGOA 3CC43 2CHCA 2F4YA 3IMAB 3LTCA 1JZOA 1A90A 3KIIA 3BLZA 1C7HA 4WWUC 3BIRA 6STDA 3BNDA 1TU5A 4FCZA 1KQS2 1BSBA 3IPTA 1OHOA 1GMPA 2Z7AA 5LC6A 5G1KA 1IU7A 1BVIA 2RGQA 3S27A 5BVBA 1LQGC 1MGRA 1M9GA 2E2TA 3SVAA 3DGNA 3EF8A 1JBRA 2CX0A 1O7NB 3KZTA 3T0UA 4XDVA 3A5EA 2CK3H 1I3FA 2O3OA
chains in the Genus database with same CATH topology
1UI7A 3GZRA 3L0RA 3FG1A 4WP5A 4HM7B 1FGQA 3LT8A 4XDWA 1YI23 1N5HA 3EB8A 3MKIA 5EQLA 1MNLA 3S28A 3CC23 2HMMB 1G96A 3JUOA 4RNZA 1NDOB 1OF5B 3U97A 2WGOA 1IT8A 3GAXA 4HJLB 1WTHA 2V1LA 1QVG2 2YFLB 4H3UA 4O02B 4XM4A 3KE7A 4STDA 5AEUB 5CF1A 4HM2B 1RKYA 4R80A 5IG3A 2XF3A 3NBRA 2CW9A 5I97A 3S67A 4O8SA 4KZ1A 4OVMA 1Z1SA 1F8NA 2KCDA 2R4IA 3OWUA 1W2ZA 2UX0A 1ROVA 1ULJB 1WMPA 4R4KA 5AYSC 2B1XB 4NREA 4L7KA 3CCR3 1N9JA 1CYUA 3J7Yd 1NB5I 3JVCA 5AIGA 1E3VA 2C10A 3RGAA 1VQN3 1QMAA 2HMNB 3Q1CA 4HM4B 4WHAA 5IG5A 3B4PA 3Q90A 4X2HA 4R9LA 2LQVA 3DGMA 1ASKA 2P0MA 3ROBA 3D9RA 4BTYA 2Z77A 4WFOA 2CFLA 5EVHA 3GZXB 3SOYA 1CYVA 3WOEB 3PCRA 3B4OA 4HM6B 3LXUX 3CXC2 1W5ZA 4HZBB 1SPUA 3AMOB 3G0KA 1OPYA 1Y4KA 2CC3A 4G1MB 4LSOA 1A2VA 2P38A 1M1K4 4RBNA 1MOLA 1K8A4 1QAKA 5KP3A 1DVCA 3LOYA 5HGRA 3F40A 3I563 1M1XB 4O2HA 2MC8A 1GS3A 3CME3 3E99A 1TFOA 2WGQA 3GZYB 1GY6A 1TP6A 3OWSA 3G6E3 3NQZA 5KP1A 3VF1A 2CWVA 1UUVB 2Z76A 4Q53A 3ER7A 5KP4A 4L8OA 2QA43 3T8NA 1OF5A 1O7MB 3HX8A 3EQQB 4HM0B 3JUMA 3NHXA 1OGXA 2FXTA 1AVKA 1CQSA 1QALA 1IV9A 4HM1B 2O9UX 3K7CA 1OCVA 3V98A 1KWIA 3FLJA 3F14A 2FNQA 1SIHA 3UL5A 1VQM3 2KXGA 3RDEA 1GYBA 1DMNA 3DM8A 4N6OB 1BUQA 2CH9A 3BNEA 3NM2A 3EJVA 3JUPA 3MG2A 1Q7Y4 2OTJ3 2W9PA 5AIIA 1TFKA 4N6MA 4J9AA 1U8CB 2HMOB 1W6CA 1PU4A 1STDA 1TIJA 3QRDA 3KN4A 4LEHA 3I553 3MG3A 3KSPA 3HZPA 3OV4A 4K61A 1W6GA 3LYGA 3MWZA 3CCE3 3VSYA 1JV2B 3BB9A 1VQ53 1AR0A 1FGMA 3LTBA 3WA2X 3NM7A 2OOVA 1HKXA 2LYXA 1DYUA 3DMCA 3NXJA 1LNHA 4AKYA 3ECFA 4XB5A 5CLKA 3X3YA 3B8LA 3N8BA 2CG0A 3MG1A 1FUWA 2W56B 3NV0A 4N6UA 4R1KA 3JUQA 2OWPA 2HMLB 1K734 5AIFA 1IT7A 1YGEA 2XSHB 5IF6A 1OHSA 2E2VA 4U13A 1O7PB 3K0ZA 3F9SA 3EHCA 3SEDA 3WOFB 1EQKA 1DMMA 3LMLA 3PGBA 1VQ83 1RRHA 3BNCA 3CNMA 3DXOA 3FCSB 3DGLA 4KVHA 3EN1B 1JN5A 1IVVA 2BT3A 3LT9A 1CEWI 2IMJA 2K0MA 3KFQC 1V74A 2Q07A 4AEQA 2JDIH 3Q2PA 2GBXB 2CKFB 1GD4A 2BMOB 4WYKB 1HU9A 3CCL3 4I4KA 1U5OA 2XRXB 2CFWA 3KKGA 2Y74A 1Q864 2B24B 1IQXA 2M7OA 1US1A 5IEOA 2OQEA 3G4S3 2YX9A 2W0QA 4HM8B 1Q814 1YIJ3 1FGRA 1T5YA 4XBXA 2HMKB 2PNCA 3NBJA 3G713 1IQ8A 4EV5A 3OW22 1TUHA 4HZ9B 1ZO2A 5FW5A 2XH9A 3T8UA 3UJMA 3FZWA 4EBGA 1STFI 1SIIA 4RNYA 1O7HB 3GWRA 3VGNA 5JPPA 2CIUA 2ML6A 3EX9A 1W4NA 1S723 5TGNA 3FSDA 2W6JH 3O8YA 4L8PA 4K90B 2GEXA 2RSXA 1D6UA 3WDGB 1N8R4 2ZL8A 1YIT3 4HBRA 1AV4A 2BNGA 4FMDA 3HK4A 3TDGA 2L4VA 4RZMA 3DZLA 1GY5A 3A76A 3H51A 3UNLA 4HVNA 2BMRB 3F8HA 5IEPA 4R9KA 1IK3A 3I0YA 5IW9A 1O7WB 4K1VA 2QIYA 1VQL3 2P0XA 2Y73A 2RFRA 1QJGA 5D83A 1PFPA 3IJEB 3MPHA 1NU3A 4OK0A 1W2B2 1A67A 2XGNA 3PYJA 1E3RA 1WMNA 3CU3A 3FH1A 3CCJ3 1M904 2W2CA 2W56A 3EE1A 2F98A 2ML5A 3SOAA 2IA7A 1UUWB 1KC84 3F8XA 1EG9B 3LTAA 3F7SA 3V92A 4FMBA 4FMCA 4KFEA 1JKGB 2SBLA 1S5AA 1W7CA 5G2GA 3X40A 3OWYA 5JPUA 3DUKA 4WYKA 4FCJA 1A2KA 1YVBI 4HM3B 1NWWA 4LZIA 3KSED 5STDA 1ROAA 3HIGA 2XGLA 1VQO3 1IVUA 4MEIA 1N9EA 2CWTA 5AEWB 8CHOA 3NV0B 2GXFA 5LC7A 1UW1A 3SX1A 1EKMA 5D81A 4OUQA 4NHFA 2GU1A 2KRTA 5IG0A 2IUJA 2D1WA 1YJW3 5A0OB 1QAFA 1W01A 1Q824 1ULIB 1OHPA 3FG3A 2BMQB 1IVXA 1OACA 1Q40A 3MSOA 3X41A 3MHEA 4N6LA 1RN7A 4JF8A 5DRVA 1NO3A 3BNBA 3LTDA 4CCVA 1IVWA 4MMZB 2CFGA 5ELJA 4X2OA 5AYRB 3LZAA 1KD14 1IQYA 2W9QA 1YHQ3 1VZZA 3WA3A 5IERA 2FGTA 1IV7A 1OH0A 4IT7A 1D6YA 1RRLA 1SJWA 5AIHA 2GEYA 4TX4A 3GRDA 3FF0A 4IIAA 2QEX3 5FGOA 1LXEA 1WMOA 3NQYA 3FKAA 4AKZA 1R4CA 4LGQA 1N8QA 4EC6A 3ALAA 1JNQA 1LVNA 1VQ73 4BTWA 2GU3A 3EBTA 4EYCA 5IENA 5EEOA 1RJOA 1VQ43 2W04A 1Q42A 1JB4A 2YFJB 4CDLA 2F86B 3UB1A 7STDA 2CFKA 3FG4A 3NUVA 3X42A 3PXMA 3CPOA 3PS8A 2CG1A 4GL6A 2XSOB 2P05A 3RGRA 1VQK3 1GY7A 4FMAA 1VQ63 1DVDA 4K1UA 1VQP3 2RCDA 2ZDJA 1ZX2A 2F99A 2JQ5A 3GZBA 3N9HA 2IUKA 1Q40B 5CF2A 1YJN3 5CK6A 1N5PA 2XFTA 3B7CA 1W02A 5BXQA 1FGTA 1D6ZA 1DMQA 3QK9A 4N6V0 3UL6A 1JRQA 3SLUA 2Z6BA 3SXXA 2I9WA 3S5CA 2OTL3 3PZWA 5DREA 2XEPA 3X3ZA 2OQEC 3CCV3 4N6NB 3LH4A 4LMIA 5CXOA 5ELUA 3CCQ3 3OXAA 4HYZA 1E97A 1YJ93 4PEJA 3DGOA 2QGUA 2CWUA 2WO0A 2OOVC 2YFIB 3H3HA 1VQ93 2BO9B 3WODG 4IPBA 5AI1A 1OGZA 2HMJB 4HKVB 2XFSA 4MMXB 3STDA 2PZVA 2XR8B 1J2BA 1O7GB 3NBBA 3PCSA 3DY5A 1NB3I 1W00A 3MYTA 3CCS3 3K5TA 3U1WA 4N3VA 4FR9A 3K63A 1W6YA 3CCM3 4N6TA 1OUNA 3CD63 1QVF2 2GBWB 2INXA 2K54A 4XBTA 2D42A 1WQLB 4KFDA 3G16A 3EBYA 3FF2A 4O3VA 4QWTA 5IG4A 3CNXA 3N54B 4FCMA 3X3XA 3G8ZA 3F7XA 1KSIA 3HIIA 2WOHA 4ORLA 1FA3A 2A15A 2W03A 3M8CA 2BHMA 4XBYA 1JJ22 4H61A 3EN8A 2STDA 1K28A 3AMOA 1LOXA 4HM5B 5JBSA 4JRFA 4EV2A 5D82A 1K41A 4J8TA 3FGYA 4ZM8A 3CMA3 3EC9A 1GD3A 3JUNA 2MF7A 1JKGA 2OCTA 2C11A 1SQWA 4GB5A 3K9MC 1WNHA 2E2UA 4MMYB 2P09A 1L5GB 3CCU3 1NJI4 1AVLA 1JB5A 3D3LA 3CPW2 1UI8A 1JN5B 3NX0A 3WMDA 2CFDA 1JB2A 3V99A 4BTXA 1K9M4 3CC73 4EXRA 2WOFA 3OX9A 3S29A 1ISKA 4KFFA 4MJDA 1EA2A 1IDPA 3HI7A 1FGOA 3CC43 2CHCA 3IMAB 3LTCA 1A90A 3KIIA 3BLZA 1C7HA 4WWUC 6STDA 3BNDA 1TU5A 4FCZA 1KQS2 3IPTA 1OHOA 2Z7AA 5LC6A 1IU7A 2RGQA 3S27A 5BVBA 1M9GA 2E2TA 3SVAA 3DGNA 3EF8A 1O7NB 3KZTA 3T0UA 4XDVA 2CK3H 2O3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZR A;  1GYB A;  1DMN A;  3DM8 A;  4WP5 A;  4HM7 B;  1BUQ A;  2RFR A;  1QJG A;  2I9W A;  3NM2 A;  4XDW A;  3EJV A;  5D83 A;  3S5C A;  3JUP A;  3MG2 A;  3MKI A;  5DRE A;  1NU3 A;  2HMM B;  4LMI A;  5CXO A;  5AII A;  3JUO A;  3OXA A;  1E3R A;  1NDO B;  1OF5 B;  3CU3 A;  1E97 A;  3FH1 A;  2HMO B;  4J9A A;  2W2C A;  4PEJ A;  1STD A;  2F98 A;  2QGU A;  4HJL B;  4LEH A;  3MG3 A;  2YFL B;  4H3U A;  4XM4 A;  3KE7 A;  3KSP A;  3HZP A;  3OV4 A;  4STD A;  3SOA A;  1UUW B;  2YFI B;  5AEU B;  3F8X A;  3LYG A;  5CF1 A;  1EG9 B;  3H3H A;  4HM2 B;  3VSY A;  3BB9 A;  3F7S A;  1AR0 A;  1JKG B;  1ISK A;  5IG3 A;  1S5A A;  5G2G A;  3NBR A;  1OGZ A;  5AI1 A;  3OWY A;  2HMJ B;  5JPU A;  3DUK A;  4HKV B;  4WYK A;  3STD A;  2PZV A;  4OVM A;  1HKX A;  4FCJ A;  2XR8 B;  1A2K A;  1O7G B;  3DMC A;  3NXJ A;  1Z1S A;  2QIY A;  1NWW A;  4HM3 B;  3ECF A;  1W00 A;  3MYT A;  4XB5 A;  5CLK A;  3B8L A;  2R4I A;  4N3V A;  1W6Y A;  3MG1 A;  3OWU A;  3NV0 A;  5STD A;  1OUN A;  2UX0 A;  4R1K A;  1ULJ B;  3JUQ A;  2OWP A;  2HML B;  2B1X B;  2GBW B;  2INX A;  2K54 A;  4L7K A;  4XBT A;  5AIF A;  1WQL B;  2XSH B;  5AEW B;  8CHO A;  3NV0 B;  2GXF A;  1E3V A;  1OHS A;  3EBY A;  3FF2 A;  3G16 A;  4U13 A;  1O7P B;  3CNX A;  3RGA A;  4FCM A;  3K0Z A;  1QMA A;  2HMN B;  4OUQ A;  3F9S A;  3G8Z A;  3F7X A;  3EHC A;  4HM4 B;  5D81 A;  5IG0 A;  3SED A;  5IG5 A;  3B4P A;  3Q90 A;  1DMM A;  4X2H A;  4R9L A;  3CNM A;  3DXO A;  4ORL A;  1W01 A;  1ASK A;  2A15 A;  4KVH A;  1JN5 A;  3EN1 B;  1ULI B;  1OHP A;  2IMJ A;  3D9R A;  2Z77 A;  2BMQ B;  3M8C A;  4XBY A;  3ROB A;  5EVH A;  1Q40 A;  2STD A;  3EN8 A;  3GZX B;  3MHE A;  3MSO A;  3SOY A;  3B4O A;  2GBX B;  4HM5 B;  4HM6 B;  5DRV A;  2CKF B;  2BMO B;  4WYK B;  5D82 A;  1K41 A;  4J8T A;  3FGY A;  4I4K A;  1U5O A;  2XRX B;  3EC9 A;  4HZB B;  3JUN A;  3G0K A;  4X2O A;  1OPY A;  3KKG A;  1JKG A;  3LZA A;  2B24 B;  1VZZ A;  5IER A;  4GB5 A;  5IEO A;  1OH0 A;  5AIH A;  1SJW A;  4HM8 B;  2GEY A;  5KP3 A;  3GRD A;  3FF0 A;  4IIA A;  5HGR A;  3F40 A;  5AIG A;  1JB5 A;  3FKA A;  4XBX A;  2HMK B;  1JN5 B;  4LGQ A;  1GS3 A;  3E99 A;  3WMD A;  5IG4 A;  1JB2 A;  1TUH A;  3GZY B;  1GY6 A;  1TP6 A;  1ZO2 A;  3OX9 A;  3OWS A;  4HZ9 B;  1EA2 A;  4MJD A;  5FW5 A;  3T8U A;  1IDP A;  3EBT A;  3FZW A;  3UJM A;  5IEN A;  5KP1 A;  2CHC A;  1UUV B;  1Q42 A;  2Z76 A;  4Q53 A;  1JB4 A;  1O7H B;  2YFJ B;  2F86 B;  3ER7 A;  3GWR A;  3VGN A;  4CDL A;  7STD A;  3EX9 A;  3NUV A;  4L8O A;  5JPP A;  5TGN A;  5KP4 A;  3CPO A;  3FSD A;  3T8N A;  3BLZ A;  1C7H A;  4L8P A;  4WWU C;  6STD A;  1OF5 A;  2GEX A;  1O7M B;  2XSO B;  3HX8 A;  3EQQ B;  3RGR A;  1GY7 A;  1OHO A;  2Z7A A;  3IPT A;  3JUM A;  3NHX A;  4HM0 B;  4K1U A;  1OGX A;  2BNG A;  2RCD A;  1ZX2 A;  2F99 A;  2JQ5 A;  2RGQ A;  1CQS A;  3DZL A;  3GZB A;  3HK4 A;  1GY5 A;  4HM1 B;  3A76 A;  4RZM A;  5BVB A;  1Q40 B;  3K7C A;  3H51 A;  1OCV A;  3UNL A;  3FLJ A;  4HVN A;  2BMR B;  3EF8 A;  3F14 A;  3F8H A;  5CF2 A;  4R9K A;  5IEP A;  1O7N B;  3I0Y A;  5CK6 A;  5IF6 A;  3B7C A;  3KZT A;  1W02 A;  1O7W B;  5BXQ A;  4XDV A;  4K1V A;  1DMQ A; 
#chains in the Genus database with same CATH topology
 1UI7 A;  3D4A A;  3GZR A;  1BRI A;  1SAR A;  3FG1 A;  3L0R A;  1BIR A;  1FGQ A;  4HM7 B;  4WP5 A;  3LT8 A;  1BU4 A;  4XDW A;  1YI2 3;  4RNT A;  1N5H A;  3EB8 A;  1FUT A;  1Q9E A;  2F56 A;  3MKI A;  1MNL A;  5EQL A;  3S28 A;  1FW7 A;  3CC2 3;  2HMM B;  1G96 A;  5BU4 A;  3JUO A;  4RNZ A;  1NDO B;  1OF5 B;  2HOH A;  1I8V A;  3U97 A;  2WGO A;  4ILF A;  1IT8 A;  3GAX A;  4HJL B;  1WTH A;  2V1L A;  1QVG 2;  2YFL B;  4H3U A;  4O02 B;  1RSN A;  4XM4 A;  1JBT A;  3KE7 A;  4STD A;  5AEU B;  5CF1 A;  4HM2 B;  4BU4 A;  1RKY A;  2RNT A;  4R80 A;  5IG3 A;  2XF3 A;  3AGO A;  3NBR A;  5M1A A;  2CW9 A;  5I97 A;  3S67 A;  4O8S A;  4KZ1 A;  4OVM A;  1Z1S A;  1VQ4 3;  1F8N A;  2KCD A;  1JBS A;  1BRK A;  2R4I A;  1UGI A;  1V57 A;  1W2Z A;  3OWU A;  2UX0 A;  1ROV A;  1JZD A;  1ULJ B;  1WMP A;  4R4K A;  5AYS C;  2B1X B;  2BU4 A;  2BIR A;  4NRE A;  4L7K A;  3CCR 3;  1N9J A;  1CYU A;  3AGN A;  3J7Y d;  1NB5 I;  3JVC A;  5AIG A;  1E3V A;  1EEJ A;  2C10 A;  3RGA A;  1VQN 3;  1QMA A;  2HMN B;  3Q1C A;  4HM4 B;  1UDI I;  4WHA A;  5IG5 A;  3B4P A;  3Q90 A;  1RNB A;  4X2H A;  1TJD A;  2LQV A;  3DGM A;  4R9L A;  1ASK A;  2P0M A;  1LOW A;  3D9R A;  3ROB A;  4BTY A;  1B2Z A;  2Z77 A;  4WFO A;  2CFL A;  5EVH A;  3GZX B;  3SOY A;  1CYV A;  3WOE B;  2ZHX B;  3PCR A;  3B4O A;  4HM6 B;  3LXU X;  3CXC 2;  2AAD A;  1W5Z A;  1B27 A;  4HZB B;  1SPU A;  3AMO B;  3G0K A;  1OPY A;  1Y4K A;  2CC3 A;  4G1M B;  4LSO A;  1A2V A;  2J8X B;  2P38 A;  1M1K 4;  4RBN A;  1MOL A;  1K8A 4;  1QAK A;  1TTO A;  5KP3 A;  1DVC A;  3LOY A;  1BNG A;  4J5K A;  5HGR A;  3F40 A;  3I56 3;  1M1X B;  1ZS7 A;  2UUG C;  1EUI C;  1CH0 A;  4O2H A;  1DET A;  2MC8 A;  1GS3 A;  3CME 3;  3E99 A;  1TFO A;  2WGQ A;  3GZY B;  1GY6 A;  1TP6 A;  3OWS A;  1MGW A;  3G6E 3;  3NQZ A;  1RN4 A;  5KP1 A;  3VF1 A;  2CWV A;  1UUV B;  2Z76 A;  4Q53 A;  1C54 A;  1R4Y A;  4HOH A;  3ER7 A;  5KP4 A;  4L8O A;  2QA4 3;  3T8N A;  1BSA A;  1OF5 A;  1O7M B;  1GOU A;  1TRQ A;  3EQQ B;  3HX8 A;  3AHW A;  9RNT A;  4HM0 B;  3JUM A;  3NHX A;  4BL3 A;  2H0I A;  1G02 A;  1OGX A;  2FXT A;  1AVK A;  1CQS A;  1QAL A;  1IV9 A;  1BRS A;  1ZGX A;  2UGI A;  2O9U X;  4HM1 B;  3K7C A;  1OCV A;  3V98 A;  1KWI A;  3FLJ A;  1GSP A;  3F14 A;  2FNQ A;  1SIH A;  3UL5 A;  1RGL A;  2KXG A;  1VQM 3;  3RDE A;  1RMS A;  1GYB A;  1DMN A;  3DM8 A;  4N6O B;  1BUQ A;  1RGH A;  2CH9 A;  3BNE A;  1X1W A;  3NM2 A;  3EJV A;  1GOY A;  3JUP A;  3MG2 A;  1I0X A;  1Q7Y 4;  2OTJ 3;  2W9P A;  4I5Q A;  5AII A;  1TFK A;  4N6M A;  2K3D A;  4J9A A;  1U8C B;  2HMO B;  1UCL A;  1W6C A;  1PU4 A;  1STD A;  1TIJ A;  3QRD A;  3KN4 A;  1FUS A;  4LEH A;  3I55 3;  3MG3 A;  2H0H A;  1RGC A;  4EW5 A;  3KSP A;  3HZP A;  3OV4 A;  4K61 A;  1W6G A;  3D5I A;  2IYJ A;  3LYG A;  3MWZ A;  3CCE 3;  3VSY A;  1JV2 B;  3BB9 A;  3ZFZ A;  1VQ5 3;  1AR0 A;  2ZA4 A;  1BOX A;  1FGM A;  1MWS A;  3LTB A;  1GMR A;  3WA2 X;  3NM7 A;  2OOV A;  1HKX A;  1RDS A;  2LYX A;  1DYU A;  3DMC A;  3NXJ A;  1LNH A;  4AKY A;  2H0G A;  3ECF A;  4XB5 A;  5CLK A;  3X3Y A;  1V58 A;  3B8L A;  1GMQ A;  3N8B A;  2CG0 A;  3MG1 A;  3CC7 3;  2W56 B;  3NV0 A;  1FUW A;  4N6U A;  1B2U A;  4R1K A;  3JUQ A;  5BIR A;  2OWP A;  2HML B;  2RBI A;  2IY2 A;  1K73 4;  5AIF A;  1IT7 A;  1YGE A;  3BU4 A;  2XSH B;  1PYL A;  5IF6 A;  1OHS A;  2E2V A;  4U13 A;  1O7P B;  3K0Z A;  3F9S A;  1RNT A;  1LOV A;  1RGF A;  1T2H A;  3EHC A;  3SED A;  3WOF B;  1EQK A;  1DMM A;  4BL2 A;  3LML A;  3PGB A;  1VQ8 3;  1RRH A;  3BNC A;  3CNM A;  3DXO A;  3FCS B;  4BIR A;  3DGL A;  4KVH A;  1JN5 A;  1IVV A;  2BT3 A;  3EN1 B;  3LT9 A;  1CEW I;  2IMJ A;  2K0M A;  3KFQ C;  1V74 A;  2Q07 A;  4AEQ A;  1BSD A;  1YGW A;  2JDI H;  3Q2P A;  2GBX B;  2CKF B;  1GD4 A;  2BMO B;  1RGG A;  1MWT A;  4WYK B;  8RNT A;  1HU9 A;  1RCK A;  3CCL 3;  4I4K A;  3RNT A;  1A2P A;  1U5O A;  2XRX B;  2CFW A;  3KKG A;  2Y74 A;  1Q86 4;  2B24 B;  1BRN L;  1IQX A;  2M7O A;  1US1 A;  1B3S A;  1BNE A;  6GSP A;  5IEO A;  2OQE A;  3ZG5 A;  1YVS A;  2YX9 A;  3G4S 3;  2W0Q A;  4HM8 B;  1FYS A;  3ZG0 A;  1Q81 4;  1I70 A;  1YIJ 3;  1FGR A;  1T5Y A;  2KF3 A;  4XBX A;  2HMK B;  3URP A;  1Q7H A;  1LOY A;  2PNC A;  3NBJ A;  3G71 3;  1IQ8 A;  4EV5 A;  3OW2 2;  1TUH A;  1I2G A;  4HZ9 B;  1ZO2 A;  5FW5 A;  2XH9 A;  3T8U A;  3UJM A;  3FZW A;  4EBG A;  1STF I;  1SII A;  4RNY A;  7RNT A;  1O7H B;  3GWR A;  3VGN A;  5JPP A;  2CIU A;  2ML6 A;  3EX9 A;  1W4N A;  2KAA A;  1S72 3;  5TGN A;  1T3B A;  3FSD A;  2W6J H;  3O8Y A;  4L8P A;  4K90 B;  2GEX A;  2RSX A;  1D6U A;  3WDG B;  1N8R 4;  2ZL8 A;  1YIT 3;  4HBR A;  2F5M A;  1AV4 A;  2BNG A;  4FMD A;  3HK4 A;  3TDG A;  2L4V A;  4RZM A;  3DZL A;  1GY5 A;  3A76 A;  3SYU A;  1UCJ A;  3H51 A;  3UNL A;  1I2F A;  4HVN A;  1HYF A;  2BMR B;  3F8H A;  4CPK A;  1BNS A;  1BNI A;  4R9K A;  5IEP A;  1IK3 A;  3I0Y A;  5IW9 A;  1O7W B;  4K1V A;  2QIY A;  1VQL 3;  2P0X A;  2Y73 A;  2RFR A;  1QJG A;  5D83 A;  1PFP A;  3IJE B;  1RGK A;  3MPH A;  1NU3 A;  1UCI A;  4OK0 A;  1W2B 2;  1A67 A;  2XGN A;  3PYJ A;  1E3R A;  1WMN A;  3CU3 A;  3FH1 A;  3CCJ 3;  1M90 4;  2W2C A;  2W56 A;  3EE1 A;  2F98 A;  1RLS A;  2ML5 A;  3SOA A;  2IA7 A;  1UUW B;  1KC8 4;  3F8X A;  1EG9 B;  1X1U A;  3LTA A;  3F7S A;  3V92 A;  4FMB A;  4FMC A;  4KFE A;  1JKG B;  2SBL A;  1S5A A;  1W7C A;  5G2G A;  3X40 A;  1RTU A;  3OWY A;  1X1Y A;  5JPU A;  3DUK A;  4WYK A;  2KF4 A;  4FCJ A;  2C4B A;  1A2K A;  1YVB I;  4HM3 B;  1NWW A;  1LRA A;  4LZI A;  7GSP A;  3KSE D;  5STD A;  1ROA A;  3HIG A;  2XGL A;  1TRP A;  1VQO 3;  1B21 A;  1B2X A;  1IVU A;  1VQQ A;  1N9E A;  4MEI A;  2CWT A;  5AEW B;  8CHO A;  3NV0 B;  2GXF A;  5LC7 A;  1UW1 A;  3SX1 A;  1EKM A;  5D81 A;  4OUQ A;  4NHF A;  2GU1 A;  1FZU A;  2F5W A;  2KRT A;  3D79 A;  5IG0 A;  2IUJ A;  2D1W A;  1YJW 3;  5A0O B;  1BSE A;  1QAF A;  1W01 A;  3GSP A;  1Q82 4;  2GSP A;  1ULI B;  1OHP A;  3FG3 A;  2BMQ B;  4DKI A;  1IVX A;  1YNV X;  1OAC A;  1Q40 A;  3MSO A;  3X41 A;  3MHE A;  1RGA A;  4N6L A;  1RN7 A;  2KF6 A;  4JF8 A;  5DRV A;  1NO3 A;  3BNB A;  3LTD A;  4CCV A;  1IVW A;  4MMZ B;  2CFG A;  1BNJ A;  5ELJ A;  4X2O A;  5AYR B;  3LZA A;  1KD1 4;  1IQY A;  2W9Q A;  1YHQ 3;  1VZZ A;  3WA3 A;  5IER A;  1UUG B;  2FGT A;  1IV7 A;  1OH0 A;  4IT7 A;  1D6Y A;  1RHL A;  1SJW A;  1RRL A;  2GEY A;  4TX4 A;  5AIH A;  3D5G A;  3FF0 A;  3GRD A;  3HOH A;  4IIA A;  2QEX 3;  5FGO A;  1LXE A;  1WMO A;  4NPB A;  1BRH A;  3NQY A;  3FKA A;  4AKZ A;  1R4C A;  4HAA A;  4LGQ A;  1N8Q A;  4GSP A;  4EC6 A;  3ALA A;  1JNQ A;  1LVN A;  1VQ7 3;  4BTW A;  2GU3 A;  3EBT A;  2SAR A;  1B20 A;  1AQZ A;  1RJO A;  5EEO A;  2W04 A;  4EYC A;  1Q42 A;  5IEN A;  1BGS A;  1JB4 A;  2YFJ B;  4CDL A;  2F86 B;  3UB1 A;  7STD A;  2CFK A;  3FG4 A;  3NUV A;  3X42 A;  3PXM A;  3CPO A;  3PS8 A;  2CG1 A;  4GL6 A;  1UGH I;  2XSO B;  1I3I A;  2P05 A;  3RGR A;  1VQK 3;  1GY7 A;  4FMA A;  1VQ6 3;  1DVD A;  4K1U A;  1VQP 3;  2RCD A;  4LYL B;  1ZX2 A;  2F99 A;  2JQ5 A;  2ZDJ A;  3GZB A;  3N9H A;  1BNF A;  2IUK A;  1Q40 B;  5CF2 A;  1YJN 3;  1BAO A;  1GOV A;  5CK6 A;  1N5P A;  1UCK A;  2XFT A;  3B7C A;  1W02 A;  5BXQ A;  1FGT A;  1D6Z A;  1DMQ A;  3QK9 A;  4N6V 0;  3UL6 A;  1JRQ A;  5M18 A;  3SLU A;  2Z6B A;  1X1X A;  2I9W A;  3SXX A;  3S5C A;  2OTL 3;  3PZW A;  5DRE A;  2XEP A;  3X3Z A;  2OQE C;  3CCV 3;  4N6N B;  3LH4 A;  4LMI A;  5CXO A;  5ELU A;  3CCQ 3;  3OXA A;  4HYZ A;  1E97 A;  4GHO A;  4PEJ A;  1YJ9 3;  1BUJ A;  3DGO A;  2QGU A;  1LNI A;  2CWU A;  2WO0 A;  2OOV C;  1BAN A;  1I0V A;  4KT3 B;  2YFI B;  1RGE A;  3H3H A;  5RNT A;  1VQ9 3;  2BO9 B;  1G0T A;  3WOD G;  5HOH A;  4IPB A;  1BRJ A;  5AI1 A;  1OGZ A;  1BNR A;  1RN1 A;  1MWU A;  2HMJ B;  4HKV B;  2XFS A;  4MMX B;  3STD A;  2PZV A;  2XR8 B;  1J2B A;  1O7G B;  3NBB A;  3PCS A;  3DY5 A;  1NB3 I;  1W00 A;  3MYT A;  3CCS 3;  3K5T A;  3U1W A;  4N3V A;  4FR9 A;  3K63 A;  1W6Y A;  4CJN A;  3CCM 3;  1BSC A;  4N6T A;  1NNV A;  1OUN A;  3CD6 3;  3WHO A;  1QVF 2;  1IYY A;  1HZ1 A;  2GBW B;  2INX A;  2K54 A;  4XBT A;  2D42 A;  1WQL B;  1I2E A;  2R41 A;  4KFD A;  3G16 A;  3EBY A;  3FF2 A;  4O3V A;  4QWT A;  5GSP A;  5IG4 A;  3CNX A;  3N54 B;  4FCM A;  3X3X A;  3G8Z A;  1LQM B;  3F7X A;  3DGY A;  3WR2 A;  1KSI A;  3HII A;  2WOH A;  4ORL A;  1FA3 A;  1RCL A;  2A15 A;  1B2M A;  2W03 A;  3M8C A;  2BHM A;  4XBY A;  1JJ2 2;  3AHS A;  4H61 A;  2AAE A;  3EN8 A;  2STD A;  1K28 A;  3AMO A;  1LOX A;  4HM5 B;  3KCH A;  3Q3F A;  5JBS A;  4JRF A;  2KF5 A;  4EV2 A;  5D82 A;  1K41 A;  4J8T A;  3FGY A;  4ZM8 A;  5M19 A;  3CMA 3;  6RNT A;  1DE3 A;  3EC9 A;  1GD3 A;  3JUN A;  2MF7 A;  1JKG A;  2OCT A;  2CX1 A;  2C11 A;  4J5G A;  1AY7 A;  1SQW A;  4GB5 A;  3K9M C;  1MWR A;  1WNH A;  2E2U A;  4MMY B;  2P09 A;  1L5G B;  3CCU 3;  1NJI 4;  5G1L A;  1AVL A;  1JB5 A;  3D3L A;  3CPW 2;  1UI8 A;  2L1S A;  1JN5 B;  1T2I A;  3NX0 A;  3WMD A;  2CFD A;  1JB2 A;  3V99 A;  4BTX A;  1K9M 4;  1BRG A;  1B2S A;  1PY3 A;  2WOF A;  3DH2 A;  3OX9 A;  3S29 A;  4KFF A;  4MJD A;  1EA2 A;  4EXR A;  1ISK A;  1IDP A;  3HI7 A;  1FGO A;  3CC4 3;  2CHC A;  2F4Y A;  3IMA B;  3LTC A;  1JZO A;  1A90 A;  3KII A;  3BLZ A;  1C7H A;  4WWU C;  3BIR A;  6STD A;  3BND A;  1TU5 A;  4FCZ A;  1KQS 2;  1BSB A;  3IPT A;  1OHO A;  1GMP A;  2Z7A A;  5LC6 A;  5G1K A;  1IU7 A;  1BVI A;  2RGQ A;  3S27 A;  5BVB A;  1LQG C;  1MGR A;  1M9G A;  2E2T A;  3SVA A;  3DGN A;  3EF8 A;  1JBR A;  2CX0 A;  1O7N B;  3KZT A;  3T0U A;  4XDV A;  3A5E A;  2CK3 H;  1I3F A;  2O3O A; 
#chains in the Genus database with same CATH homology
 1UI7 A;  3GZR A;  3L0R A;  3FG1 A;  4WP5 A;  4HM7 B;  1FGQ A;  3LT8 A;  4XDW A;  1YI2 3;  1N5H A;  3EB8 A;  3MKI A;  5EQL A;  1MNL A;  3S28 A;  3CC2 3;  2HMM B;  1G96 A;  3JUO A;  4RNZ A;  1NDO B;  1OF5 B;  3U97 A;  2WGO A;  1IT8 A;  3GAX A;  4HJL B;  1WTH A;  2V1L A;  1QVG 2;  2YFL B;  4H3U A;  4O02 B;  4XM4 A;  3KE7 A;  4STD A;  5AEU B;  5CF1 A;  4HM2 B;  1RKY A;  4R80 A;  5IG3 A;  2XF3 A;  3NBR A;  2CW9 A;  5I97 A;  3S67 A;  4O8S A;  4KZ1 A;  4OVM A;  1Z1S A;  1F8N A;  2KCD A;  2R4I A;  3OWU A;  1W2Z A;  2UX0 A;  1ROV A;  1ULJ B;  1WMP A;  4R4K A;  5AYS C;  2B1X B;  4NRE A;  4L7K A;  3CCR 3;  1N9J A;  1CYU A;  3J7Y d;  1NB5 I;  3JVC A;  5AIG A;  1E3V A;  2C10 A;  3RGA A;  1VQN 3;  1QMA A;  2HMN B;  3Q1C A;  4HM4 B;  4WHA A;  5IG5 A;  3B4P A;  3Q90 A;  4X2H A;  4R9L A;  2LQV A;  3DGM A;  1ASK A;  2P0M A;  3ROB A;  3D9R A;  4BTY A;  2Z77 A;  4WFO A;  2CFL A;  5EVH A;  3GZX B;  3SOY A;  1CYV A;  3WOE B;  3PCR A;  3B4O A;  4HM6 B;  3LXU X;  3CXC 2;  1W5Z A;  4HZB B;  1SPU A;  3AMO B;  3G0K A;  1OPY A;  1Y4K A;  2CC3 A;  4G1M B;  4LSO A;  1A2V A;  2P38 A;  1M1K 4;  4RBN A;  1MOL A;  1K8A 4;  1QAK A;  5KP3 A;  1DVC A;  3LOY A;  5HGR A;  3F40 A;  3I56 3;  1M1X B;  4O2H A;  2MC8 A;  1GS3 A;  3CME 3;  3E99 A;  1TFO A;  2WGQ A;  3GZY B;  1GY6 A;  1TP6 A;  3OWS A;  3G6E 3;  3NQZ A;  5KP1 A;  3VF1 A;  2CWV A;  1UUV B;  2Z76 A;  4Q53 A;  3ER7 A;  5KP4 A;  4L8O A;  2QA4 3;  3T8N A;  1OF5 A;  1O7M B;  3HX8 A;  3EQQ B;  4HM0 B;  3JUM A;  3NHX A;  1OGX A;  2FXT A;  1AVK A;  1CQS A;  1QAL A;  1IV9 A;  4HM1 B;  2O9U X;  3K7C A;  1OCV A;  3V98 A;  1KWI A;  3FLJ A;  3F14 A;  2FNQ A;  1SIH A;  3UL5 A;  1VQM 3;  2KXG A;  3RDE A;  1GYB A;  1DMN A;  3DM8 A;  4N6O B;  1BUQ A;  2CH9 A;  3BNE A;  3NM2 A;  3EJV A;  3JUP A;  3MG2 A;  1Q7Y 4;  2OTJ 3;  2W9P A;  5AII A;  1TFK A;  4N6M A;  4J9A A;  1U8C B;  2HMO B;  1W6C A;  1PU4 A;  1STD A;  1TIJ A;  3QRD A;  3KN4 A;  4LEH A;  3I55 3;  3MG3 A;  3KSP A;  3HZP A;  3OV4 A;  4K61 A;  1W6G A;  3LYG A;  3MWZ A;  3CCE 3;  3VSY A;  1JV2 B;  3BB9 A;  1VQ5 3;  1AR0 A;  1FGM A;  3LTB A;  3WA2 X;  3NM7 A;  2OOV A;  1HKX A;  2LYX A;  1DYU A;  3DMC A;  3NXJ A;  1LNH A;  4AKY A;  3ECF A;  4XB5 A;  5CLK A;  3X3Y A;  3B8L A;  3N8B A;  2CG0 A;  3MG1 A;  1FUW A;  2W56 B;  3NV0 A;  4N6U A;  4R1K A;  3JUQ A;  2OWP A;  2HML B;  1K73 4;  5AIF A;  1IT7 A;  1YGE A;  2XSH B;  5IF6 A;  1OHS A;  2E2V A;  4U13 A;  1O7P B;  3K0Z A;  3F9S A;  3EHC A;  3SED A;  3WOF B;  1EQK A;  1DMM A;  3LML A;  3PGB A;  1VQ8 3;  1RRH A;  3BNC A;  3CNM A;  3DXO A;  3FCS B;  3DGL A;  4KVH A;  3EN1 B;  1JN5 A;  1IVV A;  2BT3 A;  3LT9 A;  1CEW I;  2IMJ A;  2K0M A;  3KFQ C;  1V74 A;  2Q07 A;  4AEQ A;  2JDI H;  3Q2P A;  2GBX B;  2CKF B;  1GD4 A;  2BMO B;  4WYK B;  1HU9 A;  3CCL 3;  4I4K A;  1U5O A;  2XRX B;  2CFW A;  3KKG A;  2Y74 A;  1Q86 4;  2B24 B;  1IQX A;  2M7O A;  1US1 A;  5IEO A;  2OQE A;  3G4S 3;  2YX9 A;  2W0Q A;  4HM8 B;  1Q81 4;  1YIJ 3;  1FGR A;  1T5Y A;  4XBX A;  2HMK B;  2PNC A;  3NBJ A;  3G71 3;  1IQ8 A;  4EV5 A;  3OW2 2;  1TUH A;  4HZ9 B;  1ZO2 A;  5FW5 A;  2XH9 A;  3T8U A;  3UJM A;  3FZW A;  4EBG A;  1STF I;  1SII A;  4RNY A;  1O7H B;  3GWR A;  3VGN A;  5JPP A;  2CIU A;  2ML6 A;  3EX9 A;  1W4N A;  1S72 3;  5TGN A;  3FSD A;  2W6J H;  3O8Y A;  4L8P A;  4K90 B;  2GEX A;  2RSX A;  1D6U A;  3WDG B;  1N8R 4;  2ZL8 A;  1YIT 3;  4HBR A;  1AV4 A;  2BNG A;  4FMD A;  3HK4 A;  3TDG A;  2L4V A;  4RZM A;  3DZL A;  1GY5 A;  3A76 A;  3H51 A;  3UNL A;  4HVN A;  2BMR B;  3F8H A;  5IEP A;  4R9K A;  1IK3 A;  3I0Y A;  5IW9 A;  1O7W B;  4K1V A;  2QIY A;  1VQL 3;  2P0X A;  2Y73 A;  2RFR A;  1QJG A;  5D83 A;  1PFP A;  3IJE B;  3MPH A;  1NU3 A;  4OK0 A;  1W2B 2;  1A67 A;  2XGN A;  3PYJ A;  1E3R A;  1WMN A;  3CU3 A;  3FH1 A;  3CCJ 3;  1M90 4;  2W2C A;  2W56 A;  3EE1 A;  2F98 A;  2ML5 A;  3SOA A;  2IA7 A;  1UUW B;  1KC8 4;  3F8X A;  1EG9 B;  3LTA A;  3F7S A;  3V92 A;  4FMB A;  4FMC A;  4KFE A;  1JKG B;  2SBL A;  1S5A A;  1W7C A;  5G2G A;  3X40 A;  3OWY A;  5JPU A;  3DUK A;  4WYK A;  4FCJ A;  1A2K A;  1YVB I;  4HM3 B;  1NWW A;  4LZI A;  3KSE D;  5STD A;  1ROA A;  3HIG A;  2XGL A;  1VQO 3;  1IVU A;  4MEI A;  1N9E A;  2CWT A;  5AEW B;  8CHO A;  3NV0 B;  2GXF A;  5LC7 A;  1UW1 A;  3SX1 A;  1EKM A;  5D81 A;  4OUQ A;  4NHF A;  2GU1 A;  2KRT A;  5IG0 A;  2IUJ A;  2D1W A;  1YJW 3;  5A0O B;  1QAF A;  1W01 A;  1Q82 4;  1ULI B;  1OHP A;  3FG3 A;  2BMQ B;  1IVX A;  1OAC A;  1Q40 A;  3MSO A;  3X41 A;  3MHE A;  4N6L A;  1RN7 A;  4JF8 A;  5DRV A;  1NO3 A;  3BNB A;  3LTD A;  4CCV A;  1IVW A;  4MMZ B;  2CFG A;  5ELJ A;  4X2O A;  5AYR B;  3LZA A;  1KD1 4;  1IQY A;  2W9Q A;  1YHQ 3;  1VZZ A;  3WA3 A;  5IER A;  2FGT A;  1IV7 A;  1OH0 A;  4IT7 A;  1D6Y A;  1RRL A;  1SJW A;  5AIH A;  2GEY A;  4TX4 A;  3GRD A;  3FF0 A;  4IIA A;  2QEX 3;  5FGO A;  1LXE A;  1WMO A;  3NQY A;  3FKA A;  4AKZ A;  1R4C A;  4LGQ A;  1N8Q A;  4EC6 A;  3ALA A;  1JNQ A;  1LVN A;  1VQ7 3;  4BTW A;  2GU3 A;  3EBT A;  4EYC A;  5IEN A;  5EEO A;  1RJO A;  1VQ4 3;  2W04 A;  1Q42 A;  1JB4 A;  2YFJ B;  4CDL A;  2F86 B;  3UB1 A;  7STD A;  2CFK A;  3FG4 A;  3NUV A;  3X42 A;  3PXM A;  3CPO A;  3PS8 A;  2CG1 A;  4GL6 A;  2XSO B;  2P05 A;  3RGR A;  1VQK 3;  1GY7 A;  4FMA A;  1VQ6 3;  1DVD A;  4K1U A;  1VQP 3;  2RCD A;  2ZDJ A;  1ZX2 A;  2F99 A;  2JQ5 A;  3GZB A;  3N9H A;  2IUK A;  1Q40 B;  5CF2 A;  1YJN 3;  5CK6 A;  1N5P A;  2XFT A;  3B7C A;  1W02 A;  5BXQ A;  1FGT A;  1D6Z A;  1DMQ A;  3QK9 A;  4N6V 0;  3UL6 A;  1JRQ A;  3SLU A;  2Z6B A;  3SXX A;  2I9W A;  3S5C A;  2OTL 3;  3PZW A;  5DRE A;  2XEP A;  3X3Z A;  2OQE C;  3CCV 3;  4N6N B;  3LH4 A;  4LMI A;  5CXO A;  5ELU A;  3CCQ 3;  3OXA A;  4HYZ A;  1E97 A;  1YJ9 3;  4PEJ A;  3DGO A;  2QGU A;  2CWU A;  2WO0 A;  2OOV C;  2YFI B;  3H3H A;  1VQ9 3;  2BO9 B;  3WOD G;  4IPB A;  5AI1 A;  1OGZ A;  2HMJ B;  4HKV B;  2XFS A;  4MMX B;  3STD A;  2PZV A;  2XR8 B;  1J2B A;  1O7G B;  3NBB A;  3PCS A;  3DY5 A;  1NB3 I;  1W00 A;  3MYT A;  3CCS 3;  3K5T A;  3U1W A;  4N3V A;  4FR9 A;  3K63 A;  1W6Y A;  3CCM 3;  4N6T A;  1OUN A;  3CD6 3;  1QVF 2;  2GBW B;  2INX A;  2K54 A;  4XBT A;  2D42 A;  1WQL B;  4KFD A;  3G16 A;  3EBY A;  3FF2 A;  4O3V A;  4QWT A;  5IG4 A;  3CNX A;  3N54 B;  4FCM A;  3X3X A;  3G8Z A;  3F7X A;  1KSI A;  3HII A;  2WOH A;  4ORL A;  1FA3 A;  2A15 A;  2W03 A;  3M8C A;  2BHM A;  4XBY A;  1JJ2 2;  4H61 A;  3EN8 A;  2STD A;  1K28 A;  3AMO A;  1LOX A;  4HM5 B;  5JBS A;  4JRF A;  4EV2 A;  5D82 A;  1K41 A;  4J8T A;  3FGY A;  4ZM8 A;  3CMA 3;  3EC9 A;  1GD3 A;  3JUN A;  2MF7 A;  1JKG A;  2OCT A;  2C11 A;  1SQW A;  4GB5 A;  3K9M C;  1WNH A;  2E2U A;  4MMY B;  2P09 A;  1L5G B;  3CCU 3;  1NJI 4;  1AVL A;  1JB5 A;  3D3L A;  3CPW 2;  1UI8 A;  1JN5 B;  3NX0 A;  3WMD A;  2CFD A;  1JB2 A;  3V99 A;  4BTX A;  1K9M 4;  3CC7 3;  4EXR A;  2WOF A;  3OX9 A;  3S29 A;  1ISK A;  4KFF A;  4MJD A;  1EA2 A;  1IDP A;  3HI7 A;  1FGO A;  3CC4 3;  2CHC A;  3IMA B;  3LTC A;  1A90 A;  3KII A;  3BLZ A;  1C7H A;  4WWU C;  6STD A;  3BND A;  1TU5 A;  4FCZ A;  1KQS 2;  3IPT A;  1OHO A;  2Z7A A;  5LC6 A;  1IU7 A;  2RGQ A;  3S27 A;  5BVB A;  1M9G A;  2E2T A;  3SVA A;  3DGN A;  3EF8 A;  1O7N B;  3KZT A;  3T0U A;  4XDV A;  2CK3 H;  2O3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...