1VZZA

Crystal structure of mutant enzyme y32f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
120
Chain Sequence
b'NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 120
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vzzA00
3Q90A 1W00A 2F99A 3MG1A 5HGRA 2YFIB 3UNLA 5CF1A 3H3HA 1NU3A 1C7HA 1GY6A 3NBRA 1O7MB 3NV0A 5AIIA 2CHCA 1JN5A 5IEOA 1JKGB 1BUQA 1Z1SA 3JUOA 3GZBA 4I4KA 4HJLB 1ULJB 3K7CA 1NDOB 5DREA 4XB5A 3ROBA 3STDA 1E97A 1ULIB 4KVHA 3SOYA 3MKIA 3LYGA 1GS3A 5IG4A 3MG2A 3CNMA 3F8HA 2QIYA 4LEHA 1OF5B 3B8LA 2RFRA 1O7WB 4WYKB 5CXOA 3GRDA 1EA2A 3EN1B 1OGXA 5D82A 4PEJA 1UUWB 3NHXA 8CHOA 3GZRA 2Z76A 4K1UA 3CPOA 2GBWB 2INXA 3G8ZA 3IPTA 3JUQA 4MJDA 3G0KA 2YFJB 1K41A 5TGNA 2BMQB 3JUMA 1ZX2A 3FSDA 5AIGA 1OHOA 5D81A 1JKGA 2XSOB 1ZO2A 5STDA 2IMJA 2GEYA 2GBXB 5AEWB 4XDVA 3DUKA 1S5AA 4HM8B 5IENA 3EJVA 3HX8A 1SJWA 4RZMA 3B4PA 1OH0A 3H51A 4CDLA 4X2HA 1E3RA 2K54A 3EHCA 2BMRB 3FF0A 4OVMA 1OF5A 4XBYA 4WYKA 2STDA 2BNGA 2Z7AA 3F7SA 6STDA 3KE7A 3BLZA 2YFLB 4HKVB 2RCDA 1EG9B 3RGAA 2GXFA 3MG3A 1OHSA 4HM6B 5IG5A 4ORLA 4WP5A 2A15A 2OWPA 3SOAA 4L8PA 3VGNA 5EVHA 5IEPA 3T8NA 2CKFB 5CF2A 1O7HB 3KZTA 3OX9A 3NXJA 3FF2A 3NM2A 3EBTA 3SEDA 4FCMA 4H3UA 5AIFA 3HK4A 3FGYA 3K0ZA 2I9WA 4HM2B 2JQ5A 5DRVA 3RGRA 1DMQA 3F7XA 5CLKA 4XM4A 3MYTA 4J9AA 3LZAA 1O7GB 4HM5B 2HMOB 4Q53A 2UX0A 4HZ9B 1ASKA 2RGQA 5BXQA 3EBYA 3GZXB 2XR8B 4OUQA 5JPUA 4L7KA 3DXOA 3BB9A 3VSYA 1QMAA 1Q42A 2PZVA 1JB2A 2GEXA 1OPYA 1ISKA 3A76A 3S5CA 1OUNA 1TP6A 2HMMB 3B4OA 1OHPA 3EC9A 5BVBA 3B7CA 3EX9A 5IF6A 3ECFA 3F8XA 4HM7B 1GY7A 3JUNA 3KKGA 4FCJA 5KP4A 1E3VA 1W01A 3T8UA 3F9SA 3GZYB 1UUVB 2QGUA 7STDA 1AR0A 5CK6A 3F14A 2B24B 3E99A 4L8OA 1JB5A 1O7NB 1TUHA 4HVNA 3M8CA 3F40A 5G2GA 1O7PB 3I0YA 4GB5A 1U5OA 3NUVA 4IIAA 4R1KA 4LGQA 1CQSA 5KP1A 3OV4A 3OWSA 3OWYA 4WWUC 5D83A 5IG0A 2B1XB 3GWRA 1JB4A 4U13A 1IDPA 2HMLB 4N3VA 2XSHB 2XRXB 3HZPA 5IERA 4HM1B 3FZWA 3DMCA 5AIHA 1DMNA 4HM0B 1Q40B 4HM3B 2F98A 4K1VA 2BMOB 1W02A 1GYBA 4XBTA 5FW5A 3EN8A 5KP3A 3FKAA 3MSOA 1VZZA 1OGZA 3G16A 4X2OA 3DM8A 3UJMA 1A2KA 2HMNB 3EQQB 4R9KA 3OWUA 2HMKB 4XDWA 1HKXA 1STDA 3FH1A 3NV0B 1GY5A 2R4IA 3KSPA 5JPPA 3JUPA 4XBXA 3OXAA 3ER7A 1JN5B 3MHEA 2Z77A 1W6YA 1WQLB 3CNXA 5AI1A 3EF8A 4HZBB 2W2CA 5IG3A 3CU3A 4HM4B 5AEUB 4LMIA 4R9LA 1OCVA 4STDA 4J8TA 2HMJB 1NWWA 3WMDA 3DZLA 3D9RA 1Q40A 3FLJA 2F86B 1QJGA 1DMMA
chains in the Genus database with same CATH superfamily
3PZWA 3Q90A 1I0VA 1W00A 1IU7A 1YVBI 2XGLA 5LC6A 2F99A 1Q7Y4 3I553 1RGFA 1BANA 1SIIA 2KAAA 4FCZA 3MG1A 4O02B 5HGRA 4GL6A 1FZUA 2CWTA 2SBLA 2YFIB 1BU4A 1IT8A 2BHMA 1G02A 1YVSA 2W56B 1RMSA 3K9MC 1BRSA 3UNLA 4MMZB 1C54A 1N8QA 2P09A 1A2PA 3CCL3 5CF1A 3H3HA 3G4S3 1ROAA 1CYVA 2W03A 1G0TA 1NU3A 3V98A 3AMOA 1T2HA 1C7HA 4KFFA 1GY6A 3X41A 5M19A 1B2MA 3NBRA 1UCJA 1KWIA 4BL3A 1GMRA 1UI8A 2C11A 4N6LA 1IVVA 1O7MB 3NV0A 5AIIA 2W9PA 4FMBA 1RN1A 2CHCA 3WOFB 2CWUA 4EYCA 1AVKA 1JN5A 1RGLA 3KIIA 4J5KA 3KN4A 5IEOA 1JKGB 6GSPA 1KD14 1BUQA 1Z1SA 3JUOA 1FGMA 3GZBA 1BNJA 2F5WA 4I4KA 4HJLB 1ULJB 3BIRA 1NDOB 3K7CA 5I97A 1X1UA 5DREA 4XB5A 4NHFA 3UL6A 2OTL3 1VQ63 1B20A 1BSBA 4IPBA 3ROBA 1RN7A 3S29A 1LOYA 3STDA 2E2VA 1V57A 1VQK3 4EV5A 3RDEA 5ELJA 4EC6A 1E97A 1QAKA 1ULIB 4KVHA 1UI7A 8RNTA 3SOYA 1BRNL 2OQEC 3MKIA 4KZ1A 2W0QA 2Q07A 3LYGA 1B21A 3PGBA 1GS3A 4R80A 5IG4A 1AY7A 3Q3FA 1TJDA 3MG2A 1YIJ3 3CCJ3 4BU4A 3CNMA 1JJ22 3F8HA 2XFTA 2QIYA 4KFDA 3KSED 3WDGB 4LEHA 2CFGA 3IJEB 1OF5B 3B8LA 2D1WA 2RFRA 2XH9A 3U1WA 1O7WB 4CCVA 1D6YA 4WYKB 5CXOA 4MMXB 1RJOA 2R41A 2K3DA 3Q2PA 1FUTA 1NJI4 3JVCA 3NQYA 5FGOA 3GRDA 3SVAA 2BO9B 1EA2A 2XFSA 1OGXA 3DGYA 3EN1B 5D82A 4PEJA 1RLSA 1UUWB 2KRTA 3NHXA 1VQ73 2CG0A 1J2BA 1BUJA 8CHOA 3GZRA 1LOWA 3N54B 3LTDA 1GMPA 1DYUA 2FXTA 2Z76A 2O3OA 2OQEA 1L5GB 4OK0A 1BSCA 1NNVA 3FG4A 3CPOA 2V1LA 3LT8A 4K1UA 2XF3A 5BU4A 2W56A 2GBWB 2INXA 2ZA4A 2H0GA 3G8ZA 1W6CA 4ILFA 3IPTA 5GSPA 1M9GA 3JUQA 4MJDA 2QA43 1EKMA 1TFOA 3G0KA 1UCLA 1WMNA 2YFJB 1I3FA 1X1YA 1AVLA 1A67A 1K41A 1GOUA 2BT3A 4BL2A 5TGNA 6RNTA 2BMQB 3HOHA 3JUMA 1UGHI 5G1LA 1ZX2A 5A0OB 3A5EA 2L1SA 3FSDA 5AIGA 1OHOA 5D81A 1JKGA 3FCSB 2XSOB 2ZL8A 2W9QA 1ZO2A 2GU1A 1B2UA 3KCHA 5STDA 1IQ8A 2IMJA 1AV4A 1I0XA 1W5ZA 1PY3A 2GEYA 2GBXB 4QWTA 5AEWB 1K8A4 1GD3A 1SARA 3O8YA 4XDVA 3DUKA 1S5AA 2CH9A 4HM8B 2AAEA 1MOLA 2KF3A 2CWVA 3PXMA 5IENA 1B2ZA 1RCLA 3CC23 1IT7A 1BSDA 2O9UX 3EJVA 3HX8A 4TX4A 1VQP3 2ZHXB 1SJWA 4RZMA 1QAFA 3B4PA 1OH0A 1FW7A 3H51A 1SIHA 4CDLA 9RNTA 2WOFA 3D5GA 1LVNA 1IVWA 3K63A 3U97A 4X2HA 1BGSA 1E3RA 1W2ZA 2K54A 2P05A 3EB8A 1I2FA 2P38A 3EHCA 5M1AA 3X40A 1WMPA 2BMRB 3FF0A 4OVMA 3WA2X 1W2B2 1OF5A 1LQMB 3DY5A 4CJNA 4XBYA 1BNRA 4WYKA 1LOXA 1MWRA 3CCE3 1IQXA 1M1XB 2PNCA 2STDA 2BNGA 2LQVA 2Z7AA 4NREA 3F7SA 2WGOA 1T3BA 3LOYA 3T0UA 6STDA 2OCTA 2C10A 2HOHA 1BNGA 3WOEB 2MF7A 3KE7A 3BLZA 5AYRB 2YFLB 4HKVB 2RCDA 1BSAA 2W04A 4G1MB 1EG9B 1WTHA 4HAAA 1UDII 3WR2A 3NBBA 1MWUA 3RGAA 2CX0A 1MNLA 1RRHA 2GXFA 1DETA 1LXEA 2CFKA 3CXC2 3MG3A 3V92A 4RNZA 5LC7A 1OHSA 4HM6B 1MWSA 5IG5A 2CIUA 4ORLA 4WP5A 2A15A 2OWPA 1GD4A 1Q7HA 3SOAA 1RGCA 4HYZA 3BNDA 4L8PA 1RDSA 2H0HA 3VGNA 1YJ93 2E2TA 1HU9A 5EVHA 5IEPA 3T8NA 2CKFB 4EXRA 1VQQA 5CF2A 1O7HB 2RNTA 3KZTA 3LTBA 3OX9A 3D4AA 4K90B 1YJW3 3NXJA 1M904 2KF5A 1BRGA 4MEIA 3CCS3 3PCRA 3DGMA 1T2IA 3CC43 3FF2A 2CFWA 3NM2A 3EBTA 2WOHA 2OTJ3 2WGQA 3S28A 1UCKA 2KCDA 3SEDA 2C4BA 1Q824 2KXGA 5AYSC 1JBRA 1JBSA 1CH0A 1ZS7A 1RKYA 1VQ83 1RN4A 4FCMA 1M1K4 3AGNA 1A2VA 1K9M4 4H3UA 5AIFA 1IVUA 3HK4A 2RSXA 3FGYA 3UL5A 3GSPA 3K0ZA 2D42A 2I9WA 4FMAA 4WHAA 3X42A 1STFI 1BRJA 4HM2B 1U8CB 2JQ5A 5DRVA 1BNIA 1IV7A 1RSNA 3RGRA 1DMQA 3LH4A 3F7XA 5IW9A 4MMYB 1Q9EA 1FGTA 5CLKA 1Q814 4XM4A 2MC8A 3L0RA 3MYTA 3SX1A 2J8XB 3BNBA 1RGKA 1X1WA 2E2UA 2QEX3 1LNHA 2P0MA 4J9AA 3LZAA 1A90A 4HBRA 1O7GB 3QRDA 1YHQ3 4HM5B 3CME3 2HMOB 4AEQA 4Q53A 1JRQA 1GOVA 2UX0A 4HZ9B 3NM7A 3CCM3 1BIRA 4WFOA 3HIGA 4EBGA 1ASKA 2RGQA 1W4NA 3SLUA 2XEPA 3EE1A 3N9HA 3EBYA 3GZXB 3ZG0A 5BXQA 1KC84 2XR8B 4OUQA 2IUJA 4BIRA 4LZIA 3PCSA 1RRLA 4EV2A 4RNYA 3UB1A 5JPUA 4L7KA 3DXOA 2OOVC 3BB9A 4O2HA 2YX9A 3VSYA 1VQ53 1YJN3 1EUIC 1CYUA 1QMAA 4R4KA 1Q42A 3CCU3 1I8VA 1ROVA 2PZVA 3FG1A 3KFQC 3NX0A 3SYUA 1TU5A 1X1XA 1JB2A 1BAOA 2GEXA 1OPYA 1Y4KA 1ISKA 3A76A 3S5CA 1OUNA 1TP6A 1VQM3 2HMMB 3V99A 3GAXA 3OW22 1FUWA 1I2EA 3B4OA 1OHPA 3EC9A 5BVBA 4NPBA 2IUKA 3B7CA 3EX9A 3G713 1ZGXA 1BRKA 1OACA 5IF6A 4RNTA 2P0XA 3ECFA 1K28A 1UW1A 1KSIA 1NO3A 1GY7A 3F8XA 4HM7B 4LYLB 4O8SA 3WODG 1BNEA 1RGHA 2JDIH 3D3LA 2ML5A 1B2XA 3JUNA 3KKGA 3MPHA 4FCJA 5KP4A 3CC73 2OOVA 1E3VA 1JZOA 1RNBA 1W01A 1I2GA 3VF1A 3T8UA 5ELUA 1RNTA 3Q1CA 2WO0A 1N5HA 3F9SA 3G6E3 3TDGA 1FYSA 1RGEA 4N6TA 3GZYB 4JRFA 1FGOA 2UUGC 3AGOA 1PFPA 1VQO3 1UUVB 2QGUA 7STDA 7GSPA 1AR0A 5CK6A 3F14A 2B24B 3WA3A 1B3SA 1TTOA 2M7OA 3E99A 4L8OA 3CD63 3I563 3X3XA 1JB5A 1DE3A 1O7NB 1TUHA 4FMCA 4AKZA 1MWTA 1IQYA 1IYYA 3S27A 3CCQ3 4HVNA 1VQ93 1GSPA 3M8CA 3ZG5A 1YIT3 3F40A 1KQS2 4GSPA 1O7PB 5G2GA 5EEOA 1Q864 3LTCA 3I0YA 4GB5A 1U5OA 1AQZA 1BVIA 3NQZA 3NUVA 4IIAA 4R1KA 5HOHA 4LGQA 3MWZA 1QVF2 1CQSA 4J5GA 5KP1A 3CMA3 1W7CA 3AHWA 3OV4A 3OWSA 3OWYA 4LSOA 1NB5I 1N5PA 3HI7A 3LXUX 3N8BA 4WWUC 2FNQA 5D83A 5IG0A 2B1XB 3J7Yd 1YI23 3GWRA 1JB4A 4U13A 1EQKA 1G96A 1IDPA 2LYXA 1I70A 2HMLB 3URPA 4N3VA 2XSHB 2XRXB 3HZPA 2IY2A 1FGRA 2ZDJA 3BNCA 5IERA 4CPKA 1BSEA 4HM1B 1IV9A 3FZWA 1LNIA 2CX1A 3SXXA 3DMCA 1K734 5BIRA 1N9EA 1RHLA 3AHSA 5AIHA 4BTXA 1DMNA 4K61A 3WHOA 1JNQA 5M18A 1V74A 1R4YA 4HM0B 1Q40B 1RGGA 4HM3B 1LRAA 2F98A 4ZM8A 1DVDA 4K1VA 7RNTA 2BMOB 3CPW2 1JZDA 1QVG2 2SARA 1W02A 2UGIA 1N8R4 3DGLA 2AADA 2CW9A 1TRQA 2Y74A 3IMAB 2H0IA 4N6NB 1GYBA 2BIRA 1DVCA 1WMOA 2F4YA 3S67A 4XBTA 1FUSA 1UUGB 1YGEA 3EN8A 5FW5A 5KP3A 1HYFA 3FKAA 3MSOA 3X3YA 4O3VA 1VQL3 1T5YA 1F8NA 1RTUA 1VZZA 4AKYA 1OGZA 3K5TA 2W6JH 4FR9A 2F5MA 3G16A 2BU4A 2CFDA 3ALAA 1B27A 4X2OA 1YGWA 3DM8A 3UJMA 2IA7A 3PYJA 1UGIA 1A2KA 1JV2B 1FGQA 3BNEA 1I3IA 1EEJA 2Y73A 4BTWA 1UCIA 1GMQA 2HMNB 3EQQB 1N9JA 1W6GA 4R9KA 4RBNA 4BTYA 1BRHA 1RCKA 1VQN3 2Z6BA 1B2SA 4JF8A 2GU3A 3D79A 3OWUA 5G1KA 1VQ43 3AMOB 1D6UA 1IVXA 1LQGC 1RGAA 1GOYA 2HMKB 2CK3H 4XDWA 1HKXA 1D6ZA 1STDA 2KF6A 2KF4A 2FGTA 2ML6A 3FH1A 3NV0B 4N6MA 2CG1A 1GY5A 3FG3A 3CCR3 1SQWA 2XGNA 2R4IA 3KSPA 3NBJA 5JPPA 1BRIA 1YNVX 3ZFZA 2IYJA 3JUPA 1MGWA 4XBXA 3OXAA 3ER7A 1JN5B 1S723 2RBIA 3MHEA 3PS8A 4N6UA 3LT9A 2Z77A 3QK9A 4FMDA 4N6V0 1W6YA 4N6OB 1PYLA 1TIJA 1WQLB 3X3ZA 3CNXA 5AI1A 3EF8A 3DGOA 5RNTA 2W2CA 4HZBB 3DH2A 5EQLA 1FA3A 1PU4A 1HZ1A 1MGRA 5IG3A 1SPUA 2GSPA 3CU3A 4HM4B 4H61A 4EW5A 5AEUB 1LOVA 3CCV3 3DGNA 1QALA 4KT3B 4LMIA 1WNHA 3HIIA 5JBSA 1IK3A 3BU4A 4R9LA 1OCVA 2CC3A 4STDA 4J8TA 4GHOA 2L4VA 1CEWI 1BNSA 1TFKA 2HMJB 1NWWA 3D5IA 3LMLA 3LTAA 4I5QA 3WMDA 1V58A 3DZLA 3D9RA 2CFLA 1Q40A 4DKIA 1JBTA 1R4CA 3FLJA 2F56A 2F86B 4IT7A 3RNTA 1BOXA 4HOHA 1US1A 1NB3I 1QJGA 4KFEA 1BNFA 1TRPA 1DMMA 2K0MA
chains in the Genus database with same CATH topology
3PZWA 3Q90A 1W00A 1IU7A 1YVBI 2XGLA 5LC6A 2F99A 1Q7Y4 3I553 1SIIA 4FCZA 3MG1A 4O02B 5HGRA 4GL6A 2CWTA 2SBLA 2YFIB 1IT8A 2BHMA 2W56B 3UNLA 3K9MC 4MMZB 1N8QA 2P09A 3CCL3 5CF1A 3H3HA 3G4S3 1ROAA 1CYVA 2W03A 1NU3A 3V98A 3AMOA 1C7HA 4KFFA 1GY6A 3X41A 3NBRA 1KWIA 1UI8A 2C11A 4N6LA 1IVVA 1O7MB 3NV0A 5AIIA 2W9PA 4FMBA 2CHCA 3WOFB 2CWUA 4EYCA 1AVKA 1JN5A 3KIIA 3KN4A 5IEOA 1JKGB 1KD14 1BUQA 1Z1SA 3JUOA 1FGMA 3GZBA 4I4KA 4HJLB 1ULJB 3K7CA 1NDOB 5I97A 5DREA 4XB5A 4NHFA 3UL6A 2OTL3 1VQ63 4IPBA 3ROBA 1RN7A 3S29A 3STDA 2E2VA 1VQK3 4EV5A 3RDEA 5ELJA 4EC6A 1E97A 1QAKA 1ULIB 4KVHA 1UI7A 3SOYA 2OQEC 3MKIA 4KZ1A 2W0QA 2Q07A 3LYGA 3PGBA 1GS3A 4R80A 5IG4A 3MG2A 1YIJ3 3CCJ3 3CNMA 1JJ22 3F8HA 2XFTA 2QIYA 4KFDA 3KSED 3WDGB 4LEHA 2CFGA 3IJEB 1OF5B 3B8LA 2D1WA 2RFRA 2XH9A 3U1WA 1O7WB 4CCVA 1D6YA 4WYKB 5CXOA 4MMXB 1RJOA 3Q2PA 1NJI4 3JVCA 3NQYA 5FGOA 3GRDA 3SVAA 2BO9B 1EA2A 2XFSA 1OGXA 3EN1B 5D82A 4PEJA 1UUWB 2KRTA 3NHXA 1VQ73 2CG0A 1J2BA 8CHOA 3GZRA 3N54B 3LTDA 2FXTA 1DYUA 2Z76A 2O3OA 2OQEA 1L5GB 4OK0A 3FG4A 3CPOA 2V1LA 3LT8A 4K1UA 2XF3A 2W56A 2GBWB 2INXA 3G8ZA 1W6CA 3IPTA 1M9GA 3JUQA 4MJDA 2QA43 1EKMA 1TFOA 3G0KA 1WMNA 2YFJB 1AVLA 1A67A 1K41A 2BT3A 5TGNA 2BMQB 3JUMA 1ZX2A 5A0OB 3FSDA 5AIGA 1OHOA 5D81A 1JKGA 3FCSB 2XSOB 2ZL8A 2W9QA 1ZO2A 2GU1A 5STDA 1IQ8A 2IMJA 1AV4A 1W5ZA 2GEYA 2GBXB 4QWTA 5AEWB 1K8A4 1GD3A 3O8YA 4XDVA 3DUKA 1S5AA 2CH9A 4HM8B 1MOLA 5IENA 2CWVA 3PXMA 3CC23 1IT7A 2O9UX 3EJVA 3HX8A 4TX4A 1VQP3 1SJWA 4RZMA 1QAFA 3B4PA 1OH0A 3H51A 1SIHA 4CDLA 2WOFA 1LVNA 1IVWA 3K63A 3U97A 4X2HA 1E3RA 1W2ZA 2K54A 2P05A 3EB8A 3X40A 2P38A 3EHCA 1WMPA 2BMRB 3FF0A 4OVMA 3WA2X 1W2B2 1OF5A 3DY5A 4XBYA 4WYKA 1LOXA 3CCE3 1IQXA 1M1XB 2PNCA 2STDA 2BNGA 2LQVA 2Z7AA 4NREA 3F7SA 2WGOA 3LOYA 3T0UA 6STDA 2OCTA 2C10A 3WOEB 2MF7A 3KE7A 3BLZA 5AYRB 2YFLB 4HKVB 2RCDA 2W04A 4G1MB 1EG9B 1WTHA 3NBBA 3RGAA 1MNLA 1RRHA 2GXFA 1LXEA 2CFKA 3CXC2 3MG3A 3V92A 4RNZA 5LC7A 1OHSA 4HM6B 5IG5A 2CIUA 4ORLA 4WP5A 2A15A 2OWPA 1GD4A 3SOAA 4HYZA 3BNDA 4L8PA 1YJ93 3VGNA 2E2TA 1HU9A 5EVHA 5IEPA 3T8NA 2CKFB 4EXRA 5CF2A 1O7HB 3KZTA 3LTBA 3OX9A 4K90B 1YJW3 3NXJA 1M904 4MEIA 3CCS3 3PCRA 3DGMA 3CC43 3FF2A 2CFWA 3NM2A 3EBTA 2WOHA 2OTJ3 2WGQA 3S28A 2KCDA 3SEDA 1Q824 2KXGA 5AYSC 1RKYA 1VQ83 4FCMA 1M1K4 1K9M4 1A2VA 4H3UA 5AIFA 1IVUA 3HK4A 2RSXA 3FGYA 3UL5A 3K0ZA 2D42A 2I9WA 4FMAA 4WHAA 3X42A 1STFI 4HM2B 1U8CB 2JQ5A 5DRVA 1IV7A 3RGRA 1DMQA 3LH4A 3F7XA 5IW9A 4MMYB 5CLKA 1FGTA 1Q814 4XM4A 2MC8A 3L0RA 3MYTA 3SX1A 3BNBA 2E2UA 2QEX3 1LNHA 2P0MA 4J9AA 3LZAA 1A90A 4HBRA 1O7GB 3QRDA 1YHQ3 4HM5B 3CME3 2HMOB 4AEQA 4Q53A 1JRQA 2UX0A 4HZ9B 3NM7A 3CCM3 4WFOA 3HIGA 4EBGA 1ASKA 2RGQA 1W4NA 3SLUA 2XEPA 3EE1A 3N9HA 3EBYA 3GZXB 5BXQA 1KC84 2XR8B 4OUQA 2IUJA 4LZIA 3PCSA 1RRLA 4EV2A 4RNYA 3UB1A 5JPUA 4L7KA 3DXOA 2OOVC 3BB9A 4O2HA 2YX9A 3VSYA 1VQ53 1YJN3 1CYUA 1QMAA 4R4KA 1Q42A 3CCU3 1ROVA 2PZVA 3FG1A 1TU5A 3KFQC 3NX0A 1JB2A 2GEXA 1OPYA 1Y4KA 1ISKA 3A76A 3S5CA 1OUNA 1TP6A 1VQM3 2HMMB 3V99A 3GAXA 3OW22 1FUWA 3B4OA 1OHPA 3EC9A 5BVBA 2IUKA 3B7CA 3EX9A 3G713 1OACA 5IF6A 2P0XA 3ECFA 1K28A 1UW1A 1KSIA 1NO3A 1GY7A 3F8XA 4HM7B 4O8SA 3WODG 2JDIH 3D3LA 3JUNA 3KKGA 2ML5A 3MPHA 4FCJA 5KP4A 3CC73 2OOVA 1E3VA 1W01A 3VF1A 3T8UA 5ELUA 3Q1CA 2WO0A 1N5HA 3F9SA 3G6E3 3TDGA 4N6TA 3GZYB 4JRFA 1FGOA 1PFPA 1VQO3 1UUVB 2QGUA 7STDA 1AR0A 5CK6A 3F14A 2B24B 3WA3A 3E99A 2M7OA 4L8OA 3CD63 3I563 3X3XA 1JB5A 1O7NB 1TUHA 4FMCA 4AKZA 1IQYA 3S27A 3CCQ3 4HVNA 1VQ93 3M8CA 1YIT3 3F40A 1KQS2 5G2GA 1O7PB 5EEOA 1Q864 3LTCA 3I0YA 4GB5A 1U5OA 3NQZA 3NUVA 4IIAA 4R1KA 4LGQA 3MWZA 1QVF2 1CQSA 5KP1A 3CMA3 1W7CA 3OV4A 3OWSA 3OWYA 4LSOA 1NB5I 1N5PA 3HI7A 3LXUX 3N8BA 4WWUC 2FNQA 5D83A 5IG0A 2B1XB 3J7Yd 1YI23 3GWRA 1JB4A 4U13A 1EQKA 1G96A 1IDPA 2LYXA 2HMLB 4N3VA 2XSHB 2XRXB 3HZPA 1FGRA 2ZDJA 3BNCA 5IERA 4HM1B 1IV9A 3FZWA 3SXXA 3DMCA 1K734 1N9EA 4BTXA 5AIHA 1DMNA 4K61A 1JNQA 1V74A 4HM0B 1Q40B 4HM3B 2F98A 4ZM8A 1DVDA 4K1VA 1QVG2 2BMOB 3CPW2 1W02A 1N8R4 3DGLA 2CW9A 2Y74A 3IMAB 4N6NB 1GYBA 1DVCA 1WMOA 3S67A 4XBTA 1YGEA 3EN8A 5FW5A 5KP3A 3FKAA 3X3YA 3MSOA 4O3VA 1VQL3 1T5YA 1F8NA 1VZZA 4AKYA 1OGZA 3K5TA 2W6JH 4FR9A 3G16A 2CFDA 3ALAA 4X2OA 3DM8A 3UJMA 2IA7A 3PYJA 1A2KA 1JV2B 1FGQA 3BNEA 2Y73A 4BTWA 2HMNB 3EQQB 1N9JA 1W6GA 4R9KA 4RBNA 4BTYA 1VQN3 2Z6BA 4JF8A 2GU3A 3OWUA 1VQ43 3AMOB 1D6UA 1IVXA 2HMKB 2CK3H 4XDWA 1HKXA 1D6ZA 1STDA 2ML6A 3FH1A 2FGTA 3NV0B 2CG1A 4N6MA 3CCR3 1GY5A 3FG3A 1SQWA 2XGNA 2R4IA 3KSPA 3NBJA 5JPPA 3JUPA 4XBXA 3OXAA 3ER7A 1JN5B 1S723 3MHEA 3PS8A 4N6UA 3LT9A 2Z77A 3QK9A 4FMDA 4N6V0 1W6YA 4N6OB 1TIJA 1WQLB 3X3ZA 3CNXA 5AI1A 3EF8A 3DGOA 2W2CA 4HZBB 5EQLA 1FA3A 1PU4A 5IG3A 1SPUA 3CU3A 4HM4B 4H61A 5AEUB 3CCV3 3DGNA 1QALA 4LMIA 1WNHA 3HIIA 5JBSA 1IK3A 4R9LA 1OCVA 2CC3A 4STDA 4J8TA 2L4VA 1CEWI 1TFKA 2HMJB 3LMLA 1NWWA 3LTAA 3WMDA 3DZLA 3D9RA 2CFLA 1Q40A 1R4CA 3FLJA 2F86B 4IT7A 1US1A 1NB3I 1QJGA 4KFEA 1DMMA 2K0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q90 A;  1W00 A;  2F99 A;  3MG1 A;  5HGR A;  2YFI B;  3UNL A;  5CF1 A;  3H3H A;  1NU3 A;  1C7H A;  1GY6 A;  3NBR A;  1O7M B;  3NV0 A;  5AII A;  2CHC A;  1JN5 A;  5IEO A;  1JKG B;  1BUQ A;  1Z1S A;  3JUO A;  3GZB A;  4I4K A;  4HJL B;  1ULJ B;  3K7C A;  1NDO B;  5DRE A;  4XB5 A;  3ROB A;  3STD A;  1E97 A;  1ULI B;  4KVH A;  3SOY A;  3MKI A;  3LYG A;  1GS3 A;  5IG4 A;  3MG2 A;  3CNM A;  3F8H A;  2QIY A;  4LEH A;  1OF5 B;  3B8L A;  2RFR A;  1O7W B;  4WYK B;  5CXO A;  3GRD A;  1EA2 A;  3EN1 B;  1OGX A;  5D82 A;  4PEJ A;  1UUW B;  3NHX A;  8CHO A;  3GZR A;  2Z76 A;  4K1U A;  3CPO A;  2GBW B;  2INX A;  3G8Z A;  3IPT A;  3JUQ A;  4MJD A;  3G0K A;  2YFJ B;  1K41 A;  5TGN A;  2BMQ B;  3JUM A;  1ZX2 A;  3FSD A;  5AIG A;  1OHO A;  5D81 A;  1JKG A;  2XSO B;  1ZO2 A;  5STD A;  2IMJ A;  2GEY A;  2GBX B;  5AEW B;  4XDV A;  3DUK A;  1S5A A;  4HM8 B;  5IEN A;  3EJV A;  3HX8 A;  1SJW A;  4RZM A;  3B4P A;  1OH0 A;  3H51 A;  4CDL A;  4X2H A;  1E3R A;  2K54 A;  3EHC A;  2BMR B;  3FF0 A;  4OVM A;  1OF5 A;  4XBY A;  4WYK A;  2STD A;  2BNG A;  2Z7A A;  3F7S A;  6STD A;  3KE7 A;  3BLZ A;  2YFL B;  4HKV B;  2RCD A;  1EG9 B;  3RGA A;  2GXF A;  3MG3 A;  1OHS A;  4HM6 B;  5IG5 A;  4ORL A;  4WP5 A;  2A15 A;  2OWP A;  3SOA A;  4L8P A;  3VGN A;  5EVH A;  5IEP A;  3T8N A;  2CKF B;  5CF2 A;  1O7H B;  3KZT A;  3OX9 A;  3NXJ A;  3FF2 A;  3NM2 A;  3EBT A;  3SED A;  4FCM A;  4H3U A;  5AIF A;  3HK4 A;  3FGY A;  3K0Z A;  2I9W A;  4HM2 B;  2JQ5 A;  5DRV A;  3RGR A;  1DMQ A;  3F7X A;  5CLK A;  4XM4 A;  3MYT A;  4J9A A;  3LZA A;  1O7G B;  4HM5 B;  2HMO B;  4Q53 A;  2UX0 A;  4HZ9 B;  1ASK A;  2RGQ A;  5BXQ A;  3EBY A;  3GZX B;  2XR8 B;  4OUQ A;  5JPU A;  4L7K A;  3DXO A;  3BB9 A;  3VSY A;  1QMA A;  1Q42 A;  2PZV A;  1JB2 A;  2GEX A;  1OPY A;  1ISK A;  3A76 A;  3S5C A;  1OUN A;  1TP6 A;  2HMM B;  3B4O A;  1OHP A;  3EC9 A;  5BVB A;  3B7C A;  3EX9 A;  5IF6 A;  3ECF A;  3F8X A;  4HM7 B;  1GY7 A;  3JUN A;  3KKG A;  4FCJ A;  5KP4 A;  1E3V A;  1W01 A;  3T8U A;  3F9S A;  3GZY B;  1UUV B;  2QGU A;  7STD A;  1AR0 A;  5CK6 A;  3F14 A;  2B24 B;  3E99 A;  4L8O A;  1JB5 A;  1O7N B;  1TUH A;  4HVN A;  3M8C A;  3F40 A;  5G2G A;  1O7P B;  3I0Y A;  4GB5 A;  1U5O A;  3NUV A;  4IIA A;  4R1K A;  4LGQ A;  1CQS A;  5KP1 A;  3OV4 A;  3OWS A;  3OWY A;  4WWU C;  5D83 A;  5IG0 A;  2B1X B;  3GWR A;  1JB4 A;  4U13 A;  1IDP A;  2HML B;  4N3V A;  2XSH B;  2XRX B;  3HZP A;  5IER A;  4HM1 B;  3FZW A;  3DMC A;  5AIH A;  1DMN A;  4HM0 B;  1Q40 B;  4HM3 B;  2F98 A;  4K1V A;  2BMO B;  1W02 A;  1GYB A;  4XBT A;  5FW5 A;  3EN8 A;  5KP3 A;  3FKA A;  3MSO A;  1VZZ A;  1OGZ A;  3G16 A;  4X2O A;  3DM8 A;  3UJM A;  1A2K A;  2HMN B;  3EQQ B;  4R9K A;  3OWU A;  2HMK B;  4XDW A;  1HKX A;  1STD A;  3FH1 A;  3NV0 B;  1GY5 A;  2R4I A;  3KSP A;  5JPP A;  3JUP A;  4XBX A;  3OXA A;  3ER7 A;  1JN5 B;  3MHE A;  2Z77 A;  1W6Y A;  1WQL B;  3CNX A;  5AI1 A;  3EF8 A;  4HZB B;  2W2C A;  5IG3 A;  3CU3 A;  4HM4 B;  5AEU B;  4LMI A;  4R9L A;  1OCV A;  4STD A;  4J8T A;  2HMJ B;  1NWW A;  3WMD A;  3DZL A;  3D9R A;  1Q40 A;  3FLJ A;  2F86 B;  1QJG A;  1DMM A; 
#chains in the Genus database with same CATH topology
 3PZW A;  3Q90 A;  1I0V A;  1W00 A;  1IU7 A;  1YVB I;  2XGL A;  5LC6 A;  2F99 A;  1Q7Y 4;  3I55 3;  1RGF A;  1BAN A;  1SII A;  2KAA A;  4FCZ A;  3MG1 A;  4O02 B;  5HGR A;  4GL6 A;  1FZU A;  2CWT A;  2SBL A;  2YFI B;  1BU4 A;  1IT8 A;  2BHM A;  1G02 A;  1YVS A;  2W56 B;  1RMS A;  3K9M C;  1BRS A;  3UNL A;  4MMZ B;  1C54 A;  1N8Q A;  2P09 A;  1A2P A;  3CCL 3;  5CF1 A;  3H3H A;  3G4S 3;  1ROA A;  1CYV A;  2W03 A;  1G0T A;  1NU3 A;  3V98 A;  3AMO A;  1T2H A;  1C7H A;  4KFF A;  1GY6 A;  3X41 A;  5M19 A;  1B2M A;  3NBR A;  1UCJ A;  1KWI A;  4BL3 A;  1GMR A;  1UI8 A;  2C11 A;  4N6L A;  1IVV A;  1O7M B;  3NV0 A;  5AII A;  2W9P A;  4FMB A;  1RN1 A;  2CHC A;  3WOF B;  2CWU A;  4EYC A;  1AVK A;  1JN5 A;  1RGL A;  3KII A;  4J5K A;  3KN4 A;  5IEO A;  1JKG B;  6GSP A;  1KD1 4;  1BUQ A;  1Z1S A;  3JUO A;  1FGM A;  3GZB A;  1BNJ A;  2F5W A;  4I4K A;  4HJL B;  1ULJ B;  3BIR A;  1NDO B;  3K7C A;  5I97 A;  1X1U A;  5DRE A;  4XB5 A;  4NHF A;  3UL6 A;  2OTL 3;  1VQ6 3;  1B20 A;  1BSB A;  4IPB A;  3ROB A;  1RN7 A;  3S29 A;  1LOY A;  3STD A;  2E2V A;  1V57 A;  1VQK 3;  4EV5 A;  3RDE A;  5ELJ A;  4EC6 A;  1E97 A;  1QAK A;  1ULI B;  4KVH A;  1UI7 A;  8RNT A;  3SOY A;  1BRN L;  2OQE C;  3MKI A;  4KZ1 A;  2W0Q A;  2Q07 A;  3LYG A;  1B21 A;  3PGB A;  1GS3 A;  4R80 A;  5IG4 A;  1AY7 A;  3Q3F A;  1TJD A;  3MG2 A;  1YIJ 3;  3CCJ 3;  4BU4 A;  3CNM A;  1JJ2 2;  3F8H A;  2XFT A;  2QIY A;  4KFD A;  3KSE D;  3WDG B;  4LEH A;  2CFG A;  3IJE B;  1OF5 B;  3B8L A;  2D1W A;  2RFR A;  2XH9 A;  3U1W A;  1O7W B;  4CCV A;  1D6Y A;  4WYK B;  5CXO A;  4MMX B;  1RJO A;  2R41 A;  2K3D A;  3Q2P A;  1FUT A;  1NJI 4;  3JVC A;  3NQY A;  5FGO A;  3GRD A;  3SVA A;  2BO9 B;  1EA2 A;  2XFS A;  1OGX A;  3DGY A;  3EN1 B;  5D82 A;  4PEJ A;  1RLS A;  1UUW B;  2KRT A;  3NHX A;  1VQ7 3;  2CG0 A;  1J2B A;  1BUJ A;  8CHO A;  3GZR A;  1LOW A;  3N54 B;  3LTD A;  1GMP A;  1DYU A;  2FXT A;  2Z76 A;  2O3O A;  2OQE A;  1L5G B;  4OK0 A;  1BSC A;  1NNV A;  3FG4 A;  3CPO A;  2V1L A;  3LT8 A;  4K1U A;  2XF3 A;  5BU4 A;  2W56 A;  2GBW B;  2INX A;  2ZA4 A;  2H0G A;  3G8Z A;  1W6C A;  4ILF A;  3IPT A;  5GSP A;  1M9G A;  3JUQ A;  4MJD A;  2QA4 3;  1EKM A;  1TFO A;  3G0K A;  1UCL A;  1WMN A;  2YFJ B;  1I3F A;  1X1Y A;  1AVL A;  1A67 A;  1K41 A;  1GOU A;  2BT3 A;  4BL2 A;  5TGN A;  6RNT A;  2BMQ B;  3HOH A;  3JUM A;  1UGH I;  5G1L A;  1ZX2 A;  5A0O B;  3A5E A;  2L1S A;  3FSD A;  5AIG A;  1OHO A;  5D81 A;  1JKG A;  3FCS B;  2XSO B;  2ZL8 A;  2W9Q A;  1ZO2 A;  2GU1 A;  1B2U A;  3KCH A;  5STD A;  1IQ8 A;  2IMJ A;  1AV4 A;  1I0X A;  1W5Z A;  1PY3 A;  2GEY A;  2GBX B;  4QWT A;  5AEW B;  1K8A 4;  1GD3 A;  1SAR A;  3O8Y A;  4XDV A;  3DUK A;  1S5A A;  2CH9 A;  4HM8 B;  2AAE A;  1MOL A;  2KF3 A;  2CWV A;  3PXM A;  5IEN A;  1B2Z A;  1RCL A;  3CC2 3;  1IT7 A;  1BSD A;  2O9U X;  3EJV A;  3HX8 A;  4TX4 A;  1VQP 3;  2ZHX B;  1SJW A;  4RZM A;  1QAF A;  3B4P A;  1OH0 A;  1FW7 A;  3H51 A;  1SIH A;  4CDL A;  9RNT A;  2WOF A;  3D5G A;  1LVN A;  1IVW A;  3K63 A;  3U97 A;  4X2H A;  1BGS A;  1E3R A;  1W2Z A;  2K54 A;  2P05 A;  3EB8 A;  1I2F A;  2P38 A;  3EHC A;  5M1A A;  3X40 A;  1WMP A;  2BMR B;  3FF0 A;  4OVM A;  3WA2 X;  1W2B 2;  1OF5 A;  1LQM B;  3DY5 A;  4CJN A;  4XBY A;  1BNR A;  4WYK A;  1LOX A;  1MWR A;  3CCE 3;  1IQX A;  1M1X B;  2PNC A;  2STD A;  2BNG A;  2LQV A;  2Z7A A;  4NRE A;  3F7S A;  2WGO A;  1T3B A;  3LOY A;  3T0U A;  6STD A;  2OCT A;  2C10 A;  2HOH A;  1BNG A;  3WOE B;  2MF7 A;  3KE7 A;  3BLZ A;  5AYR B;  2YFL B;  4HKV B;  2RCD A;  1BSA A;  2W04 A;  4G1M B;  1EG9 B;  1WTH A;  4HAA A;  1UDI I;  3WR2 A;  3NBB A;  1MWU A;  3RGA A;  2CX0 A;  1MNL A;  1RRH A;  2GXF A;  1DET A;  1LXE A;  2CFK A;  3CXC 2;  3MG3 A;  3V92 A;  4RNZ A;  5LC7 A;  1OHS A;  4HM6 B;  1MWS A;  5IG5 A;  2CIU A;  4ORL A;  4WP5 A;  2A15 A;  2OWP A;  1GD4 A;  1Q7H A;  3SOA A;  1RGC A;  4HYZ A;  3BND A;  4L8P A;  1RDS A;  2H0H A;  3VGN A;  1YJ9 3;  2E2T A;  1HU9 A;  5EVH A;  5IEP A;  3T8N A;  2CKF B;  4EXR A;  1VQQ A;  5CF2 A;  1O7H B;  2RNT A;  3KZT A;  3LTB A;  3OX9 A;  3D4A A;  4K90 B;  1YJW 3;  3NXJ A;  1M90 4;  2KF5 A;  1BRG A;  4MEI A;  3CCS 3;  3PCR A;  3DGM A;  1T2I A;  3CC4 3;  3FF2 A;  2CFW A;  3NM2 A;  3EBT A;  2WOH A;  2OTJ 3;  2WGQ A;  3S28 A;  1UCK A;  2KCD A;  3SED A;  2C4B A;  1Q82 4;  2KXG A;  5AYS C;  1JBR A;  1JBS A;  1CH0 A;  1ZS7 A;  1RKY A;  1VQ8 3;  1RN4 A;  4FCM A;  1M1K 4;  3AGN A;  1A2V A;  1K9M 4;  4H3U A;  5AIF A;  1IVU A;  3HK4 A;  2RSX A;  3FGY A;  3UL5 A;  3GSP A;  3K0Z A;  2D42 A;  2I9W A;  4FMA A;  4WHA A;  3X42 A;  1STF I;  1BRJ A;  4HM2 B;  1U8C B;  2JQ5 A;  5DRV A;  1BNI A;  1IV7 A;  1RSN A;  3RGR A;  1DMQ A;  3LH4 A;  3F7X A;  5IW9 A;  4MMY B;  1Q9E A;  1FGT A;  5CLK A;  1Q81 4;  4XM4 A;  2MC8 A;  3L0R A;  3MYT A;  3SX1 A;  2J8X B;  3BNB A;  1RGK A;  1X1W A;  2E2U A;  2QEX 3;  1LNH A;  2P0M A;  4J9A A;  3LZA A;  1A90 A;  4HBR A;  1O7G B;  3QRD A;  1YHQ 3;  4HM5 B;  3CME 3;  2HMO B;  4AEQ A;  4Q53 A;  1JRQ A;  1GOV A;  2UX0 A;  4HZ9 B;  3NM7 A;  3CCM 3;  1BIR A;  4WFO A;  3HIG A;  4EBG A;  1ASK A;  2RGQ A;  1W4N A;  3SLU A;  2XEP A;  3EE1 A;  3N9H A;  3EBY A;  3GZX B;  3ZG0 A;  5BXQ A;  1KC8 4;  2XR8 B;  4OUQ A;  2IUJ A;  4BIR A;  4LZI A;  3PCS A;  1RRL A;  4EV2 A;  4RNY A;  3UB1 A;  5JPU A;  4L7K A;  3DXO A;  2OOV C;  3BB9 A;  4O2H A;  2YX9 A;  3VSY A;  1VQ5 3;  1YJN 3;  1EUI C;  1CYU A;  1QMA A;  4R4K A;  1Q42 A;  3CCU 3;  1I8V A;  1ROV A;  2PZV A;  3FG1 A;  3KFQ C;  3NX0 A;  3SYU A;  1TU5 A;  1X1X A;  1JB2 A;  1BAO A;  2GEX A;  1OPY A;  1Y4K A;  1ISK A;  3A76 A;  3S5C A;  1OUN A;  1TP6 A;  1VQM 3;  2HMM B;  3V99 A;  3GAX A;  3OW2 2;  1FUW A;  1I2E A;  3B4O A;  1OHP A;  3EC9 A;  5BVB A;  4NPB A;  2IUK A;  3B7C A;  3EX9 A;  3G71 3;  1ZGX A;  1BRK A;  1OAC A;  5IF6 A;  4RNT A;  2P0X A;  3ECF A;  1K28 A;  1UW1 A;  1KSI A;  1NO3 A;  1GY7 A;  3F8X A;  4HM7 B;  4LYL B;  4O8S A;  3WOD G;  1BNE A;  1RGH A;  2JDI H;  3D3L A;  2ML5 A;  1B2X A;  3JUN A;  3KKG A;  3MPH A;  4FCJ A;  5KP4 A;  3CC7 3;  2OOV A;  1E3V A;  1JZO A;  1RNB A;  1W01 A;  1I2G A;  3VF1 A;  3T8U A;  5ELU A;  1RNT A;  3Q1C A;  2WO0 A;  1N5H A;  3F9S A;  3G6E 3;  3TDG A;  1FYS A;  1RGE A;  4N6T A;  3GZY B;  4JRF A;  1FGO A;  2UUG C;  3AGO A;  1PFP A;  1VQO 3;  1UUV B;  2QGU A;  7STD A;  7GSP A;  1AR0 A;  5CK6 A;  3F14 A;  2B24 B;  3WA3 A;  1B3S A;  1TTO A;  2M7O A;  3E99 A;  4L8O A;  3CD6 3;  3I56 3;  3X3X A;  1JB5 A;  1DE3 A;  1O7N B;  1TUH A;  4FMC A;  4AKZ A;  1MWT A;  1IQY A;  1IYY A;  3S27 A;  3CCQ 3;  4HVN A;  1VQ9 3;  1GSP A;  3M8C A;  3ZG5 A;  1YIT 3;  3F40 A;  1KQS 2;  4GSP A;  1O7P B;  5G2G A;  5EEO A;  1Q86 4;  3LTC A;  3I0Y A;  4GB5 A;  1U5O A;  1AQZ A;  1BVI A;  3NQZ A;  3NUV A;  4IIA A;  4R1K A;  5HOH A;  4LGQ A;  3MWZ A;  1QVF 2;  1CQS A;  4J5G A;  5KP1 A;  3CMA 3;  1W7C A;  3AHW A;  3OV4 A;  3OWS A;  3OWY A;  4LSO A;  1NB5 I;  1N5P A;  3HI7 A;  3LXU X;  3N8B A;  4WWU C;  2FNQ A;  5D83 A;  5IG0 A;  2B1X B;  3J7Y d;  1YI2 3;  3GWR A;  1JB4 A;  4U13 A;  1EQK A;  1G96 A;  1IDP A;  2LYX A;  1I70 A;  2HML B;  3URP A;  4N3V A;  2XSH B;  2XRX B;  3HZP A;  2IY2 A;  1FGR A;  2ZDJ A;  3BNC A;  5IER A;  4CPK A;  1BSE A;  4HM1 B;  1IV9 A;  3FZW A;  1LNI A;  2CX1 A;  3SXX A;  3DMC A;  1K73 4;  5BIR A;  1N9E A;  1RHL A;  3AHS A;  5AIH A;  4BTX A;  1DMN A;  4K61 A;  3WHO A;  1JNQ A;  5M18 A;  1V74 A;  1R4Y A;  4HM0 B;  1Q40 B;  1RGG A;  4HM3 B;  1LRA A;  2F98 A;  4ZM8 A;  1DVD A;  4K1V A;  7RNT A;  2BMO B;  3CPW 2;  1JZD A;  1QVG 2;  2SAR A;  1W02 A;  2UGI A;  1N8R 4;  3DGL A;  2AAD A;  2CW9 A;  1TRQ A;  2Y74 A;  3IMA B;  2H0I A;  4N6N B;  1GYB A;  2BIR A;  1DVC A;  1WMO A;  2F4Y A;  3S67 A;  4XBT A;  1FUS A;  1UUG B;  1YGE A;  3EN8 A;  5FW5 A;  5KP3 A;  1HYF A;  3FKA A;  3MSO A;  3X3Y A;  4O3V A;  1VQL 3;  1T5Y A;  1F8N A;  1RTU A;  1VZZ A;  4AKY A;  1OGZ A;  3K5T A;  2W6J H;  4FR9 A;  2F5M A;  3G16 A;  2BU4 A;  2CFD A;  3ALA A;  1B27 A;  4X2O A;  1YGW A;  3DM8 A;  3UJM A;  2IA7 A;  3PYJ A;  1UGI A;  1A2K A;  1JV2 B;  1FGQ A;  3BNE A;  1I3I A;  1EEJ A;  2Y73 A;  4BTW A;  1UCI A;  1GMQ A;  2HMN B;  3EQQ B;  1N9J A;  1W6G A;  4R9K A;  4RBN A;  4BTY A;  1BRH A;  1RCK A;  1VQN 3;  2Z6B A;  1B2S A;  4JF8 A;  2GU3 A;  3D79 A;  3OWU A;  5G1K A;  1VQ4 3;  3AMO B;  1D6U A;  1IVX A;  1LQG C;  1RGA A;  1GOY A;  2HMK B;  2CK3 H;  4XDW A;  1HKX A;  1D6Z A;  1STD A;  2KF6 A;  2KF4 A;  2FGT A;  2ML6 A;  3FH1 A;  3NV0 B;  4N6M A;  2CG1 A;  1GY5 A;  3FG3 A;  3CCR 3;  1SQW A;  2XGN A;  2R4I A;  3KSP A;  3NBJ A;  5JPP A;  1BRI A;  1YNV X;  3ZFZ A;  2IYJ A;  3JUP A;  1MGW A;  4XBX A;  3OXA A;  3ER7 A;  1JN5 B;  1S72 3;  2RBI A;  3MHE A;  3PS8 A;  4N6U A;  3LT9 A;  2Z77 A;  3QK9 A;  4FMD A;  4N6V 0;  1W6Y A;  4N6O B;  1PYL A;  1TIJ A;  1WQL B;  3X3Z A;  3CNX A;  5AI1 A;  3EF8 A;  3DGO A;  5RNT A;  2W2C A;  4HZB B;  3DH2 A;  5EQL A;  1FA3 A;  1PU4 A;  1HZ1 A;  1MGR A;  5IG3 A;  1SPU A;  2GSP A;  3CU3 A;  4HM4 B;  4H61 A;  4EW5 A;  5AEU B;  1LOV A;  3CCV 3;  3DGN A;  1QAL A;  4KT3 B;  4LMI A;  1WNH A;  3HII A;  5JBS A;  1IK3 A;  3BU4 A;  4R9L A;  1OCV A;  2CC3 A;  4STD A;  4J8T A;  4GHO A;  2L4V A;  1CEW I;  1BNS A;  1TFK A;  2HMJ B;  1NWW A;  3D5I A;  3LML A;  3LTA A;  4I5Q A;  3WMD A;  1V58 A;  3DZL A;  3D9R A;  2CFL A;  1Q40 A;  4DKI A;  1JBT A;  1R4C A;  3FLJ A;  2F56 A;  2F86 B;  4IT7 A;  3RNT A;  1BOX A;  4HOH A;  1US1 A;  1NB3 I;  1QJG A;  4KFE A;  1BNF A;  1TRP A;  1DMM A;  2K0M A; 
#chains in the Genus database with same CATH homology
 3PZW A;  3Q90 A;  1W00 A;  1IU7 A;  1YVB I;  2XGL A;  5LC6 A;  2F99 A;  1Q7Y 4;  3I55 3;  1SII A;  4FCZ A;  3MG1 A;  4O02 B;  5HGR A;  4GL6 A;  2CWT A;  2SBL A;  2YFI B;  1IT8 A;  2BHM A;  2W56 B;  3UNL A;  3K9M C;  4MMZ B;  1N8Q A;  2P09 A;  3CCL 3;  5CF1 A;  3H3H A;  3G4S 3;  1ROA A;  1CYV A;  2W03 A;  1NU3 A;  3V98 A;  3AMO A;  1C7H A;  4KFF A;  1GY6 A;  3X41 A;  3NBR A;  1KWI A;  1UI8 A;  2C11 A;  4N6L A;  1IVV A;  1O7M B;  3NV0 A;  5AII A;  2W9P A;  4FMB A;  2CHC A;  3WOF B;  2CWU A;  4EYC A;  1AVK A;  1JN5 A;  3KII A;  3KN4 A;  5IEO A;  1JKG B;  1KD1 4;  1BUQ A;  1Z1S A;  3JUO A;  1FGM A;  3GZB A;  4I4K A;  4HJL B;  1ULJ B;  3K7C A;  1NDO B;  5I97 A;  5DRE A;  4XB5 A;  4NHF A;  3UL6 A;  2OTL 3;  1VQ6 3;  4IPB A;  3ROB A;  1RN7 A;  3S29 A;  3STD A;  2E2V A;  1VQK 3;  4EV5 A;  3RDE A;  5ELJ A;  4EC6 A;  1E97 A;  1QAK A;  1ULI B;  4KVH A;  1UI7 A;  3SOY A;  2OQE C;  3MKI A;  4KZ1 A;  2W0Q A;  2Q07 A;  3LYG A;  3PGB A;  1GS3 A;  4R80 A;  5IG4 A;  3MG2 A;  1YIJ 3;  3CCJ 3;  3CNM A;  1JJ2 2;  3F8H A;  2XFT A;  2QIY A;  4KFD A;  3KSE D;  3WDG B;  4LEH A;  2CFG A;  3IJE B;  1OF5 B;  3B8L A;  2D1W A;  2RFR A;  2XH9 A;  3U1W A;  1O7W B;  4CCV A;  1D6Y A;  4WYK B;  5CXO A;  4MMX B;  1RJO A;  3Q2P A;  1NJI 4;  3JVC A;  3NQY A;  5FGO A;  3GRD A;  3SVA A;  2BO9 B;  1EA2 A;  2XFS A;  1OGX A;  3EN1 B;  5D82 A;  4PEJ A;  1UUW B;  2KRT A;  3NHX A;  1VQ7 3;  2CG0 A;  1J2B A;  8CHO A;  3GZR A;  3N54 B;  3LTD A;  2FXT A;  1DYU A;  2Z76 A;  2O3O A;  2OQE A;  1L5G B;  4OK0 A;  3FG4 A;  3CPO A;  2V1L A;  3LT8 A;  4K1U A;  2XF3 A;  2W56 A;  2GBW B;  2INX A;  3G8Z A;  1W6C A;  3IPT A;  1M9G A;  3JUQ A;  4MJD A;  2QA4 3;  1EKM A;  1TFO A;  3G0K A;  1WMN A;  2YFJ B;  1AVL A;  1A67 A;  1K41 A;  2BT3 A;  5TGN A;  2BMQ B;  3JUM A;  1ZX2 A;  5A0O B;  3FSD A;  5AIG A;  1OHO A;  5D81 A;  1JKG A;  3FCS B;  2XSO B;  2ZL8 A;  2W9Q A;  1ZO2 A;  2GU1 A;  5STD A;  1IQ8 A;  2IMJ A;  1AV4 A;  1W5Z A;  2GEY A;  2GBX B;  4QWT A;  5AEW B;  1K8A 4;  1GD3 A;  3O8Y A;  4XDV A;  3DUK A;  1S5A A;  2CH9 A;  4HM8 B;  1MOL A;  5IEN A;  2CWV A;  3PXM A;  3CC2 3;  1IT7 A;  2O9U X;  3EJV A;  3HX8 A;  4TX4 A;  1VQP 3;  1SJW A;  4RZM A;  1QAF A;  3B4P A;  1OH0 A;  3H51 A;  1SIH A;  4CDL A;  2WOF A;  1LVN A;  1IVW A;  3K63 A;  3U97 A;  4X2H A;  1E3R A;  1W2Z A;  2K54 A;  2P05 A;  3EB8 A;  3X40 A;  2P38 A;  3EHC A;  1WMP A;  2BMR B;  3FF0 A;  4OVM A;  3WA2 X;  1W2B 2;  1OF5 A;  3DY5 A;  4XBY A;  4WYK A;  1LOX A;  3CCE 3;  1IQX A;  1M1X B;  2PNC A;  2STD A;  2BNG A;  2LQV A;  2Z7A A;  4NRE A;  3F7S A;  2WGO A;  3LOY A;  3T0U A;  6STD A;  2OCT A;  2C10 A;  3WOE B;  2MF7 A;  3KE7 A;  3BLZ A;  5AYR B;  2YFL B;  4HKV B;  2RCD A;  2W04 A;  4G1M B;  1EG9 B;  1WTH A;  3NBB A;  3RGA A;  1MNL A;  1RRH A;  2GXF A;  1LXE A;  2CFK A;  3CXC 2;  3MG3 A;  3V92 A;  4RNZ A;  5LC7 A;  1OHS A;  4HM6 B;  5IG5 A;  2CIU A;  4ORL A;  4WP5 A;  2A15 A;  2OWP A;  1GD4 A;  3SOA A;  4HYZ A;  3BND A;  4L8P A;  1YJ9 3;  3VGN A;  2E2T A;  1HU9 A;  5EVH A;  5IEP A;  3T8N A;  2CKF B;  4EXR A;  5CF2 A;  1O7H B;  3KZT A;  3LTB A;  3OX9 A;  4K90 B;  1YJW 3;  3NXJ A;  1M90 4;  4MEI A;  3CCS 3;  3PCR A;  3DGM A;  3CC4 3;  3FF2 A;  2CFW A;  3NM2 A;  3EBT A;  2WOH A;  2OTJ 3;  2WGQ A;  3S28 A;  2KCD A;  3SED A;  1Q82 4;  2KXG A;  5AYS C;  1RKY A;  1VQ8 3;  4FCM A;  1M1K 4;  1K9M 4;  1A2V A;  4H3U A;  5AIF A;  1IVU A;  3HK4 A;  2RSX A;  3FGY A;  3UL5 A;  3K0Z A;  2D42 A;  2I9W A;  4FMA A;  4WHA A;  3X42 A;  1STF I;  4HM2 B;  1U8C B;  2JQ5 A;  5DRV A;  1IV7 A;  3RGR A;  1DMQ A;  3LH4 A;  3F7X A;  5IW9 A;  4MMY B;  5CLK A;  1FGT A;  1Q81 4;  4XM4 A;  2MC8 A;  3L0R A;  3MYT A;  3SX1 A;  3BNB A;  2E2U A;  2QEX 3;  1LNH A;  2P0M A;  4J9A A;  3LZA A;  1A90 A;  4HBR A;  1O7G B;  3QRD A;  1YHQ 3;  4HM5 B;  3CME 3;  2HMO B;  4AEQ A;  4Q53 A;  1JRQ A;  2UX0 A;  4HZ9 B;  3NM7 A;  3CCM 3;  4WFO A;  3HIG A;  4EBG A;  1ASK A;  2RGQ A;  1W4N A;  3SLU A;  2XEP A;  3EE1 A;  3N9H A;  3EBY A;  3GZX B;  5BXQ A;  1KC8 4;  2XR8 B;  4OUQ A;  2IUJ A;  4LZI A;  3PCS A;  1RRL A;  4EV2 A;  4RNY A;  3UB1 A;  5JPU A;  4L7K A;  3DXO A;  2OOV C;  3BB9 A;  4O2H A;  2YX9 A;  3VSY A;  1VQ5 3;  1YJN 3;  1CYU A;  1QMA A;  4R4K A;  1Q42 A;  3CCU 3;  1ROV A;  2PZV A;  3FG1 A;  1TU5 A;  3KFQ C;  3NX0 A;  1JB2 A;  2GEX A;  1OPY A;  1Y4K A;  1ISK A;  3A76 A;  3S5C A;  1OUN A;  1TP6 A;  1VQM 3;  2HMM B;  3V99 A;  3GAX A;  3OW2 2;  1FUW A;  3B4O A;  1OHP A;  3EC9 A;  5BVB A;  2IUK A;  3B7C A;  3EX9 A;  3G71 3;  1OAC A;  5IF6 A;  2P0X A;  3ECF A;  1K28 A;  1UW1 A;  1KSI A;  1NO3 A;  1GY7 A;  3F8X A;  4HM7 B;  4O8S A;  3WOD G;  2JDI H;  3D3L A;  3JUN A;  3KKG A;  2ML5 A;  3MPH A;  4FCJ A;  5KP4 A;  3CC7 3;  2OOV A;  1E3V A;  1W01 A;  3VF1 A;  3T8U A;  5ELU A;  3Q1C A;  2WO0 A;  1N5H A;  3F9S A;  3G6E 3;  3TDG A;  4N6T A;  3GZY B;  4JRF A;  1FGO A;  1PFP A;  1VQO 3;  1UUV B;  2QGU A;  7STD A;  1AR0 A;  5CK6 A;  3F14 A;  2B24 B;  3WA3 A;  3E99 A;  2M7O A;  4L8O A;  3CD6 3;  3I56 3;  3X3X A;  1JB5 A;  1O7N B;  1TUH A;  4FMC A;  4AKZ A;  1IQY A;  3S27 A;  3CCQ 3;  4HVN A;  1VQ9 3;  3M8C A;  1YIT 3;  3F40 A;  1KQS 2;  5G2G A;  1O7P B;  5EEO A;  1Q86 4;  3LTC A;  3I0Y A;  4GB5 A;  1U5O A;  3NQZ A;  3NUV A;  4IIA A;  4R1K A;  4LGQ A;  3MWZ A;  1QVF 2;  1CQS A;  5KP1 A;  3CMA 3;  1W7C A;  3OV4 A;  3OWS A;  3OWY A;  4LSO A;  1NB5 I;  1N5P A;  3HI7 A;  3LXU X;  3N8B A;  4WWU C;  2FNQ A;  5D83 A;  5IG0 A;  2B1X B;  3J7Y d;  1YI2 3;  3GWR A;  1JB4 A;  4U13 A;  1EQK A;  1G96 A;  1IDP A;  2LYX A;  2HML B;  4N3V A;  2XSH B;  2XRX B;  3HZP A;  1FGR A;  2ZDJ A;  3BNC A;  5IER A;  4HM1 B;  1IV9 A;  3FZW A;  3SXX A;  3DMC A;  1K73 4;  1N9E A;  4BTX A;  5AIH A;  1DMN A;  4K61 A;  1JNQ A;  1V74 A;  4HM0 B;  1Q40 B;  4HM3 B;  2F98 A;  4ZM8 A;  1DVD A;  4K1V A;  1QVG 2;  2BMO B;  3CPW 2;  1W02 A;  1N8R 4;  3DGL A;  2CW9 A;  2Y74 A;  3IMA B;  4N6N B;  1GYB A;  1DVC A;  1WMO A;  3S67 A;  4XBT A;  1YGE A;  3EN8 A;  5FW5 A;  5KP3 A;  3FKA A;  3X3Y A;  3MSO A;  4O3V A;  1VQL 3;  1T5Y A;  1F8N A;  1VZZ A;  4AKY A;  1OGZ A;  3K5T A;  2W6J H;  4FR9 A;  3G16 A;  2CFD A;  3ALA A;  4X2O A;  3DM8 A;  3UJM A;  2IA7 A;  3PYJ A;  1A2K A;  1JV2 B;  1FGQ A;  3BNE A;  2Y73 A;  4BTW A;  2HMN B;  3EQQ B;  1N9J A;  1W6G A;  4R9K A;  4RBN A;  4BTY A;  1VQN 3;  2Z6B A;  4JF8 A;  2GU3 A;  3OWU A;  1VQ4 3;  3AMO B;  1D6U A;  1IVX A;  2HMK B;  2CK3 H;  4XDW A;  1HKX A;  1D6Z A;  1STD A;  2ML6 A;  3FH1 A;  2FGT A;  3NV0 B;  2CG1 A;  4N6M A;  3CCR 3;  1GY5 A;  3FG3 A;  1SQW A;  2XGN A;  2R4I A;  3KSP A;  3NBJ A;  5JPP A;  3JUP A;  4XBX A;  3OXA A;  3ER7 A;  1JN5 B;  1S72 3;  3MHE A;  3PS8 A;  4N6U A;  3LT9 A;  2Z77 A;  3QK9 A;  4FMD A;  4N6V 0;  1W6Y A;  4N6O B;  1TIJ A;  1WQL B;  3X3Z A;  3CNX A;  5AI1 A;  3EF8 A;  3DGO A;  2W2C A;  4HZB B;  5EQL A;  1FA3 A;  1PU4 A;  5IG3 A;  1SPU A;  3CU3 A;  4HM4 B;  4H61 A;  5AEU B;  3CCV 3;  3DGN A;  1QAL A;  4LMI A;  1WNH A;  3HII A;  5JBS A;  1IK3 A;  4R9L A;  1OCV A;  2CC3 A;  4STD A;  4J8T A;  2L4V A;  1CEW I;  1TFK A;  2HMJ B;  3LML A;  1NWW A;  3LTA A;  3WMD A;  3DZL A;  3D9R A;  2CFL A;  1Q40 A;  1R4C A;  3FLJ A;  2F86 B;  4IT7 A;  1US1 A;  1NB3 I;  1QJG A;  4KFE A;  1DMM A;  2K0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...