1VZZA

Crystal structure of mutant enzyme y32f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
120
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMFADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 120
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1vzzA00
1JB2A 5STDA 1NWWA 1OUNA 3EN1B 1UUWB 3IPTA 2STDA 5IENA 4OUQA 3NV0A 4XBXA 3T8UA 3F7XA 2Z76A 4J9AA 1K41A 3KSPA 2F86B 2HMOB 5AIIA 3EX9A 3GZYB 2GEYA 3MSOA 3GWRA 5CLKA 3HZPA 5IG5A 1BUQA 1DMQA 4J8TA 5FW5A 4RZMA 5IF6A 3G16A 5IG4A 5AIGA 3F8XA 2RFRA 3GZBA 5KP1A 4CDLA 3MHEA 4WYKA 3DMCA 2OWPA 4HM7B 2HMNB 4PEJA 3OWYA 6STDA 2I9WA 2YFIB 2Z77A 3S5CA 1A2KA 2YFJB 3K7CA 4LMIA 3MG3A 2UX0A 2W2CA 1U5OA 1VZZA 2B24B 4K1UA 3FLJA 4N3VA 1UUVB 5BXQA 1NDOB 1GYBA 1JB4A 2F98A 3B8LA 4X2OA 4I4KA 5CK6A 1EG9B 1OHSA 3ER7A 3F9SA 2PZVA 1ZX2A 1GS3A 4ORLA 4WYKB 3F7SA 5AEUB 3SEDA 2HMJB 1E3VA 2BNGA 1IDPA 4XBTA 1O7NB 4WP5A 3FZWA 2XRXB 1OCVA 5BVBA 3D9RA 3JUMA 4STDA 1CQSA 3ECFA 3EJVA 3UJMA 3CNXA 2HMLB 3B4OA 4FCMA 4Q53A 2A15A 3B7CA 1E3RA 3SOYA 5HGRA 2GBWB 2XR8B 3MG2A 3SOAA 5IEOA 4HM8B 3OWSA 1WQLB 3JUNA 3KKGA 4HM5B 3JUPA 3H51A 5AEWB 3NXJA 5IEPA 5JPPA 3CPOA 5AIHA 3T8NA 3F8HA 1W6YA 1ASKA 4XB5A 2B1XB 2GEXA 1O7HB 5KP3A 1STDA 2XSOB 3HX8A 2BMOB 5DREA 3UNLA 3RGRA 3OX9A 3LZAA 3FF2A 1O7WB 3GZRA 1QJGA 1O7PB 3JUOA 4L7KA 5CF1A 1OGXA 3BLZA 4LEHA 1ULJB 1OF5B 3CU3A 4HM1B 7STDA 3EQQB 3A76A 1JN5A 4WWUC 3OXAA 3VSYA 3NUVA 2BMQB 2Z7AA 2CHCA 1OH0A 3NBRA 3Q90A 1OHPA 4XDWA 1DMMA 4HZBB 3GRDA 4HM3B 3CNMA 3EHCA 1JKGB 3KZTA 3HK4A 3JUQA 3I0YA 4L8PA 3NM2A 3NHXA 3FH1A 3DXOA 1W02A 2CKFB 8CHOA 5D82A 1OGZA 3ROBA 3F14A 3EF8A 1JN5B 2QIYA 4FCJA 1W01A 4U13A 4K1VA 1GY5A 3M8CA 4R9LA 5AIFA 3EN8A 2JQ5A 4HKVB 1OF5A 2INXA 2BMRB 1ULIB 5TGNA 1SJWA 3STDA 4H3UA 1Q40A 2RCDA 2HMKB 2YFLB 4XDVA 3RGAA 5D83A 4X2HA 5AI1A 5KP4A 5JPUA 1GY6A 3DUKA 1OHOA 3KE7A 4R1KA 1JKGA 3GZXB 3BB9A 3MYTA 1TUHA 1AR0A 3OV4A 2QGUA 1O7GB 2F99A 3EC9A 4L8OA 3H3HA 5G2GA 1DMNA 1O7MB 3MKIA 5D81A 1ZO2A 2HMMB 3DZLA 4KVHA 5IG0A 3FKAA 2RGQA 5EVHA 1E97A 3F40A 1W00A 1EA2A 1S5AA 3DM8A 4OVMA 1Q40B 4XM4A 1JB5A 4HM2B 3NV0B 4LGQA 5CF2A 4GB5A 4HVNA 3B4PA 5DRVA 4HM4B 2GXFA 3VGNA 1HKXA 3FSDA 2XSHB 4XBYA 4IIAA 4R9KA 3EBYA 3EBTA 5IERA 1C7HA 1TP6A 3OWUA 3E99A 1QMAA 3K0ZA 3FF0A 4MJDA 1Q42A 5IG3A 4HM0B 5CXOA 2R4IA 2GBXB 1ISKA 3FGYA 1NU3A 1OPYA 1Z1SA 3WMDA 2K54A 4HZ9B 4HJLB 3G8ZA 1GY7A 3G0KA 4HM6B 2IMJA 3LYGA 3MG1A
chains in the Genus database with same CATH superfamily
1JB2A 2F4YA 2OQEA 5STDA 4EV2A 1UUGB 1NWWA 1N8QA 1OUNA 3CXC2 2XGLA 3ZG0A 2P09A 3EN1B 3CC73 1G02A 1JBSA 1RSNA 1UUWB 1RGGA 3IPTA 2STDA 5IENA 1BVIA 2ML6A 4NPBA 3PZWA 1VQK3 1B2XA 3SX1A 1YI23 2P38A 3LT9A 3PCSA 4OUQA 1L5GB 2ZA4A 3NV0A 4XBXA 3T8UA 2GU1A 2Z76A 1F8NA 3F7XA 4N6NB 4J9AA 5RNTA 1K41A 3NBJA 3KSPA 3DY5A 2F86B 1Q814 1IVUA 1W7CA 1BOXA 2HMOB 2H0GA 5AIIA 3EX9A 3GZYB 5BIRA 5HOHA 6RNTA 1BNSA 1M1XB 2GEYA 4IT7A 4G1MB 3MSOA 1AY7A 1DYUA 2C10A 1MGRA 1Q824 3GWRA 4GL6A 5EQLA 5GSPA 1KWIA 5CLKA 3HZPA 1RN7A 5IG5A 1I3FA 1RGHA 1BUQA 2E2TA 3N9HA 1VQM3 2OOVA 1DMQA 2OTJ3 2CG1A 4J8TA 5FW5A 1LRAA 2P0XA 3HI7A 4HBRA 4RZMA 5IF6A 1A67A 1BNRA 1WMOA 2FXTA 3G16A 1B2SA 5IG4A 4J5KA 3G4S3 3FCSB 5AIGA 1T2IA 3A5EA 3F8XA 2RFRA 3GZBA 1N5HA 5KP1A 2CC3A 4CDLA 3CCL3 3LXUX 3MHEA 4WYKA 3DMCA 4IPBA 1LVNA 4EYCA 3QK9A 2OWPA 2W9PA 3FG1A 2HMNB 4HM7B 1IVXA 1QAFA 4PEJA 3OWYA 2C11A 6STDA 1CEWI 1NB3I 1ZS7A 2I9WA 2YFIB 2Z77A 3BU4A 4FMBA 1M904 3PGBA 3S5CA 3X42A 1A2KA 4LSOA 2YFJB 1S723 1PYLA 1RJOA 4WFOA 3G713 1W2ZA 2CH9A 1FUWA 1SQWA 2W0QA 3AHSA 1MGWA 3DGYA 3K7CA 1MWRA 3LOYA 4LMIA 1FGQA 3MG3A 2YX9A 1PU4A 2KF6A 3SYUA 2UX0A 2W2CA 1FGMA 1U5OA 4O2HA 1VZZA 2B24B 3LTCA 4K1UA 4N6UA 1UW1A 4LYLB 3LTBA 3FLJA 4OK0A 4N3VA 1TRPA 1Q9EA 1US1A 1AQZA 2JDIH 1FUSA 3BNBA 4BL3A 1YVSA 3HOHA 4BU4A 3S28A 2ZL8A 1UCLA 1UUVB 1N9EA 2W9QA 4KZ1A 5BXQA 2BIRA 1K734 4WHAA 1WTHA 1NDOB 1GYBA 1GMPA 1JB4A 3PCRA 2F98A 1GSPA 2XF3A 4HOHA 2WO0A 3B8LA 2IUJA 4FMDA 2KF5A 4X2OA 1JRQA 1K28A 1UCIA 4I4KA 1EG9B 5CK6A 1OHSA 1IYYA 2GSPA 3LTDA 3ER7A 3F9SA 2PZVA 1T3BA 1K9M4 1ZX2A 2W6JH 3I563 1GS3A 1JBTA 3N8BA 4ORLA 4N6LA 4WYKB 2MF7A 4EBGA 2FNQA 3F7SA 5AEUB 1MWTA 3SEDA 1K8A4 2HMJB 1E3VA 4RNZA 2BNGA 3IMAB 3BNEA 1IDPA 1RTUA 4XBTA 1O7NB 1QALA 1X1UA 4WP5A 3FZWA 2XRXB 1DETA 5ELUA 1LQGC 2CFWA 3D5IA 1HYFA 1OCVA 3BNDA 2KAAA 5BU4A 3G6E3 4MMYB 5BVBA 1RCLA 1BRKA 1BU4A 3X40A 2Y73A 1I8VA 3D9RA 1I70A 1TFOA 4I5QA 1M1K4 2CG0A 3AMOA 2CWVA 3JUMA 1FW7A 1QAKA 1I3IA 1N5PA 4STDA 1IK3A 1RNTA 3IJEB 1RN1A 1CQSA 3ECFA 3EJVA 1YJW3 1QVF2 1RLSA 1X1WA 1GD4A 2CFKA 2K0MA 1CYUA 1BRJA 3NM7A 3RNTA 1BSBA 3UJMA 4EXRA 5I97A 3CNXA 1TU5A 2HMLB 8RNTA 3B4OA 3KFQC 1I2FA 4FCZA 1MOLA 4FCMA 4Q53A 2AADA 2A15A 2QA43 4LZIA 1UCKA 1RDSA 3B7CA 4GSPA 1DE3A 1E3RA 4N6TA 3SOYA 3FG3A 5HGRA 1BRSA 4NREA 2CFGA 2GBWB 2XR8B 3MG2A 3SOAA 4N6V0 3V99A 5IEOA 4HM8B 4O02B 3U1WA 3OWSA 3WODG 1VQ93 4K61A 1WQLB 3CC43 1TIJA 1MWUA 3JUNA 3K9MC 2ZDJA 1BAOA 3KKGA 4BTYA 4HM5B 1VQ63 1SIHA 5EEOA 3KN4A 1HZ1A 2J8XB 2D42A 1BNFA 3AHWA 1R4YA 3JUPA 3SVAA 1B20A 2Q07A 3H51A 2CWUA 2P05A 5AEWB 3NXJA 3O8YA 5IEPA 1RRHA 1VQ43 1UCJA 5JPPA 3DH2A 1W5ZA 1B27A 3CPOA 5AIHA 3T8NA 3CCR3 1NO3A 4EC6A 4FMCA 4BL2A 1Q7HA 1UI7A 3F8HA 1SARA 2E2UA 1W6YA 1ASKA 4XB5A 2KCDA 1RKYA 3CCE3 1ROVA 2CIUA 2B1XB 2KF3A 4HAAA 2GEXA 1O7HB 3NQYA 5KP3A 1STDA 5FGOA 1VQQA 3WOFB 4FMAA 1X1YA 4NHFA 1BUJA 2SARA 1RGAA 1C54A 1BRHA 5ELJA 1EUIC 3V92A 2XSOB 3AMOB 4KFFA 3HX8A 2WOHA 2IA7A 2BMOB 3LT8A 1LXEA 4KFDA 5DREA 3UNLA 5IW9A 4BTWA 3RGRA 1NNVA 3OX9A 3LZAA 1IQXA 1V74A 2CK3H 3FF2A 2CFLA 1YJ93 3NBBA 1O7WB 3GZRA 1QJGA 3PS8A 1O7PB 3VF1A 4CJNA 1BGSA 1T5YA 1B2ZA 1T2HA 3CC23 1GOUA 4RNYA 3QRDA 3JUOA 4L7KA 5CF1A 1BRGA 2CX0A 1WNHA 4O8SA 4KFEA 1OGXA 1LOXA 4J5GA 2XEPA 3BLZA 3KIIA 2WOFA 3DGMA 4LEHA 6GSPA 5G1LA 1ULJB 1OF5B 1SPUA 3CU3A 1LNIA 3WDGB 7GSPA 3RDEA 3HIIA 1JBRA 5JBSA 3TDGA 4HM1B 4BTXA 7STDA 3EQQB 1PFPA 3A76A 3NX0A 3CCS3 1YGWA 1JN5A 4WWUC 2LYXA 3WA2X 3OXAA 2QEX3 3VSYA 2W03A 3NUVA 1RGLA 2BMQB 1FUTA 2Z7AA 1BRNL 2CHCA 1OH0A 1V58A 1JZOA 2RSXA 2F5MA 1OHPA 1TFKA 3NBRA 3Q90A 3S29A 5M18A 1I2EA 1TTOA 3BNCA 4XDWA 1GOVA 2HOHA 3CME3 1DMMA 1LOWA 2WGOA 4HZBB 1RNBA 1D6UA 3GRDA 1BSEA 1Q7Y4 1G0TA 3URPA 1BRIA 4TX4A 2P0MA 4HM3B 3CNMA 3EHCA 2Z6BA 1JKGB 3KZTA 3N54B 2AAEA 3HK4A 3CCU3 3JUQA 1EQKA 4CPKA 3I0YA 1FYSA 1U8CB 2Y74A 3DGNA 1V57A 4L8PA 3NM2A 1DVDA 4MEIA 1IT7A 3NHXA 2CW9A 3FH1A 3DXOA 3SXXA 3U97A 1ROAA 1UDII 1IV9A 1W02A 2MC8A 1Q864 1IVVA 3LMLA 3MWZA 2KF4A 2KRTA 1VQN3 3CD63 1AVLA 3ALAA 2K3DA 1KD14 1TRQA 2CKFB 4R4KA 1Y4KA 4JF8A 8CHOA 3PXMA 5D82A 3K63A 3UL6A 1NB5I 1GD3A 4DKIA 4HYZA 4QWTA 2M7OA 1VQO3 1OGZA 3ROBA 3ZFZA 5AYSC 1RCKA 4K90B 3CCM3 1IT8A 4H61A 4FR9A 3F14A 3EF8A 1YVBI 1JN5B 5A0OB 2QIYA 4FCJA 1A90A 1W01A 3KCHA 4U13A 1B21A 2L4VA 1KSIA 4K1VA 1GY5A 3T0UA 3M8CA 3I553 3CCV3 2L1SA 3OW22 2XFTA 3D3LA 4R9LA 5AIFA 2H0HA 1YJN3 3EN8A 2JQ5A 1D6ZA 1IQ8A 4HKVB 1BNEA 1W4NA 1OF5A 1JNQA 1GMQA 1I2GA 2INXA 2BMRB 2BT3A 2OCTA 1ULIB 5TGNA 4CCVA 4MMZB 2W04A 3HIGA 1TJDA 1SJWA 3STDA 4H3UA 1BNJA 3WHOA 3BIRA 1Q40A 1W2B2 1RGFA 3WA3A 2RCDA 2HMKB 2YFLB 1W6CA 2XGNA 1IV7A 4XDVA 4AKZA 2KXGA 1N8R4 3FG4A 3RGAA 4AEQA 1HU9A 5D83A 4BIRA 2OQEC 1IU7A 4X2HA 2C4BA 2GU3A 1LOYA 5AI1A 3PYJA 1MWSA 9RNTA 5JPUA 5KP4A 1PY3A 1GY6A 4N6MA 1GOYA 1UGIA 3DUKA 3CMA3 4N6OB 1YIJ3 1OHOA 3KE7A 1EKMA 4R1KA 1UI8A 1RN4A 1JKGA 3EB8A 3GZXB 2WGQA 1UGHI 3BB9A 3MYTA 4R80A 5LC6A 3GSPA 1TUHA 2W56B 1AR0A 2IY2A 5AYRB 2V1LA 3OV4A 2CX1A 5G1KA 2QGUA 1O7GB 2F99A 3EC9A 4AKYA 1G96A 2SBLA 3Q2PA 2RBIA 4L8OA 1B2UA 3H3HA 3LH4A 1DMNA 1N9JA 5G2GA 1O7MB 3V98A 4EV5A 3CCJ3 3MKIA 2UUGC 5D81A 1NJI4 3UL5A 1JJ22 2FGTA 1RGEA 1ZO2A 1IVWA 1STFI 2HMMB 1CH0A 2PNCA 3DZLA 1AVKA 2D1WA 4KVHA 5IG0A 2H0IA 2ZHXB 3FKAA 1B3SA 3WR2A 2RGQA 1WMPA 5EVHA 1E97A 3SLUA 3F40A 1D6YA 1EEJA 1CYVA 1W00A 3D5GA 3DGLA 1QVG2 2OOVC 1EA2A 1BANA 3LTAA 1S5AA 2IUKA 3DM8A 4OVMA 2BO9B 5M1AA 3AGNA 7RNTA 1A2PA 1VQ83 1Q40B 1VQP3 4XM4A 3D4AA 4RNTA 1VQL3 1JB5A 5M19A 1YGEA 2ML5A 4HM2B 3NV0B 2F56A 2O3OA 3WOEB 1X1XA 3L0RA 4LGQA 4RBNA 4EW5A 1FZUA 4GB5A 5CF2A 4HVNA 1W6GA 3B4PA 5DRVA 2RNTA 2XFSA 1BSCA 2UGIA 1GMRA 3KSED 2LQVA 3Q1CA 3Q3FA 4HM4B 4JRFA 3X3YA 2GXFA 3VGNA 1M9GA 2R41A 1HKXA 1YNVX 2IYJA 1I0XA 4KT3B 1BSAA 5LC7A 4MMXB 3X41A 3FSDA 3J7Yd 3MPHA 1JZDA 1RGCA 2XSHB 4GHOA 4XBYA 4IIAA 3CPW2 4R9KA 2F5WA 1IQYA 3EBYA 1LNHA 1WMNA 1BIRA 3EBTA 5IERA 1C7HA 2XH9A 3K5TA 2E2VA 1TP6A 1BNGA 3S67A 3OWUA 3CCQ3 1I0VA 3E99A 1QMAA 2CWTA 1SIIA 3JVCA 1RMSA 1RRLA 1AV4A 1A2VA 3D79A 3K0ZA 3FF0A 3S27A 4MJDA 3X3XA 3NQZA 1Q42A 5IG3A 1KQS2 2OTL3 1FGOA 4HM0B 1R4CA 5CXOA 2R4IA 1LOVA 2GBXB 2BHMA 3X3ZA 2BU4A 2W56A 1RHLA 1B2MA 1FGTA 3FGYA 3ZG5A 1ISKA 1FGRA 1FA3A 1J2BA 1NU3A 1VQ53 1BNIA 3DGOA 3GAXA 1OPYA 1RGKA 1YHQ3 4ILFA 1ZGXA 1OACA 1JV2B 1MNLA 1VQ73 1Z1SA 1KC84 3WMDA 2CFDA 4O3VA 3AGOA 1DVCA 1LQMB 2K54A 4HZ9B 4HJLB 3G8ZA 4ZM8A 1YIT3 3UB1A 1GY7A 3G0KA 1BSDA 3EE1A 4HM6B 2IMJA 2O9UX 3LYGA 3MG1A
chains in the Genus database with same CATH topology
1JB2A 2OQEA 5STDA 4EV2A 1NWWA 1N8QA 1OUNA 3CXC2 2XGLA 2P09A 3EN1B 3CC73 1UUWB 3IPTA 2STDA 5IENA 2ML6A 1VQK3 3PZWA 3SX1A 1YI23 2P38A 3LT9A 3PCSA 4OUQA 1L5GB 3NV0A 4XBXA 3T8UA 2GU1A 2Z76A 1F8NA 3F7XA 4N6NB 4J9AA 1K41A 3NBJA 3KSPA 3DY5A 2F86B 1Q814 1IVUA 1W7CA 2HMOB 5AIIA 3EX9A 3GZYB 1M1XB 2GEYA 4IT7A 4G1MB 3MSOA 1DYUA 2C10A 1Q824 3GWRA 4GL6A 5EQLA 1KWIA 5CLKA 3HZPA 1RN7A 5IG5A 1BUQA 2E2TA 3N9HA 1VQM3 2OOVA 1DMQA 2OTJ3 2CG1A 4J8TA 5FW5A 2P0XA 4RZMA 3HI7A 4HBRA 5IF6A 1A67A 1WMOA 2FXTA 3G16A 5IG4A 3G4S3 3FCSB 5AIGA 3F8XA 2RFRA 3GZBA 1N5HA 5KP1A 2CC3A 4CDLA 3CCL3 3LXUX 3MHEA 4WYKA 3DMCA 4IPBA 1LVNA 4EYCA 3QK9A 2OWPA 2W9PA 3FG1A 2HMNB 4HM7B 1IVXA 1QAFA 4PEJA 3OWYA 2C11A 6STDA 1CEWI 2Z77A 1NB3I 2I9WA 2YFIB 4FMBA 1M904 3PGBA 3S5CA 3X42A 1A2KA 4LSOA 2YFJB 1S723 4WFOA 1RJOA 3G713 1W2ZA 2CH9A 1FUWA 1SQWA 2W0QA 3K7CA 3LOYA 4LMIA 1FGQA 3MG3A 2YX9A 1PU4A 2UX0A 2W2CA 1FGMA 1U5OA 4O2HA 1VZZA 2B24B 3LTCA 4K1UA 4N6UA 1UW1A 3LTBA 3FLJA 4OK0A 4N3VA 1US1A 2JDIH 3BNBA 3S28A 2ZL8A 1UUVB 1N9EA 2W9QA 4KZ1A 5BXQA 1K734 4WHAA 1WTHA 1NDOB 1GYBA 1JB4A 3PCRA 2F98A 2XF3A 2WO0A 3B8LA 2IUJA 4FMDA 4X2OA 1JRQA 1K28A 4I4KA 5CK6A 1EG9B 1OHSA 3LTDA 3ER7A 3F9SA 2PZVA 1K9M4 1ZX2A 2W6JH 3I563 1GS3A 3N8BA 4ORLA 4N6LA 4WYKB 2MF7A 4EBGA 2FNQA 3F7SA 5AEUB 3SEDA 1K8A4 2HMJB 1E3VA 4RNZA 2BNGA 3IMAB 3BNEA 1IDPA 4XBTA 1O7NB 1QALA 4WP5A 3FZWA 2XRXB 5ELUA 2CFWA 1OCVA 3BNDA 3G6E3 4MMYB 5BVBA 3X40A 2Y73A 3D9RA 1M1K4 1TFOA 2CG0A 3AMOA 2CWVA 3JUMA 1QAKA 1N5PA 4STDA 1IK3A 3IJEB 1CQSA 3ECFA 3EJVA 1YJW3 1QVF2 1GD4A 2CFKA 2K0MA 1CYUA 3NM7A 4EXRA 3UJMA 5I97A 3CNXA 2HMLB 3B4OA 3KFQC 4FCZA 1MOLA 4FCMA 4Q53A 2A15A 2QA43 4LZIA 3B7CA 1E3RA 4N6TA 3SOYA 3FG3A 5HGRA 4NREA 2CFGA 2GBWB 2XR8B 3MG2A 3SOAA 4N6V0 3V99A 5IEOA 4HM8B 4O02B 3U1WA 3OWSA 3WODG 1VQ93 4K61A 1WQLB 3CC43 1TIJA 3JUNA 3K9MC 2ZDJA 3KKGA 4BTYA 4HM5B 1VQ63 1SIHA 5EEOA 3KN4A 2D42A 3JUPA 3SVAA 3H51A 2Q07A 2CWUA 2P05A 5AEWB 3NXJA 3O8YA 5IEPA 1RRHA 1VQ43 5JPPA 1W5ZA 3CCR3 3CPOA 5AIHA 3T8NA 1NO3A 4EC6A 4FMCA 1UI7A 3F8HA 2E2UA 1W6YA 1ASKA 4XB5A 2KCDA 1RKYA 3CCE3 1ROVA 2CIUA 2B1XB 2GEXA 1O7HB 3NQYA 5KP3A 1STDA 5FGOA 3WOFB 4FMAA 4NHFA 5ELJA 3V92A 2XSOB 3AMOB 4KFFA 3HX8A 2WOHA 2IA7A 2BMOB 3LT8A 1LXEA 4KFDA 5DREA 3UNLA 5IW9A 4BTWA 3RGRA 3OX9A 3LZAA 1IQXA 1V74A 2CK3H 3FF2A 2CFLA 1YJ93 3NBBA 1O7WB 3GZRA 1QJGA 3PS8A 1O7PB 3VF1A 1T5YA 3CC23 4RNYA 3QRDA 3JUOA 4L7KA 5CF1A 4O8SA 1WNHA 4KFEA 1OGXA 1LOXA 2XEPA 3BLZA 3KIIA 2WOFA 3DGMA 4LEHA 1ULJB 1OF5B 1SPUA 3CU3A 3WDGB 3RDEA 3HIIA 5JBSA 3TDGA 4HM1B 4BTXA 7STDA 3EQQB 1PFPA 3A76A 3NX0A 3CCS3 1JN5A 4WWUC 2LYXA 3WA2X 3OXAA 2QEX3 3VSYA 2W03A 3NUVA 2BMQB 2Z7AA 2CHCA 1OH0A 2RSXA 3NBRA 3Q90A 1OHPA 1TFKA 1TU5A 3S29A 3BNCA 3CME3 4XDWA 1DMMA 2WGOA 4HZBB 1D6UA 3GRDA 4TX4A 2P0MA 4HM3B 3CNMA 3EHCA 2Z6BA 1JKGB 3KZTA 3N54B 3HK4A 3CCU3 3JUQA 1EQKA 3I0YA 1U8CB 2Y74A 3DGNA 4L8PA 3NM2A 1DVDA 4MEIA 1IT7A 3NHXA 2CW9A 3FH1A 3DXOA 3SXXA 3U97A 1ROAA 1IV9A 1W02A 2MC8A 1Q864 1IVVA 3LMLA 3MWZA 2KRTA 1VQN3 3CD63 1AVLA 3ALAA 1KD14 2CKFB 4R4KA 1Y4KA 4JF8A 8CHOA 3PXMA 5D82A 3K63A 3UL6A 1NB5I 1GD3A 4HYZA 4QWTA 2M7OA 1VQO3 1OGZA 3ROBA 5AYSC 4K90B 3CCM3 1IT8A 4H61A 4FR9A 3F14A 3EF8A 1YVBI 1JN5B 5A0OB 2QIYA 4FCJA 1A90A 1W01A 4U13A 2L4VA 1KSIA 4K1VA 1GY5A 3T0UA 3M8CA 3I553 3CCV3 3OW22 2XFTA 3D3LA 4R9LA 5AIFA 1YJN3 3EN8A 2JQ5A 1D6ZA 1IQ8A 4HKVB 1W4NA 1OF5A 1JNQA 2INXA 2BMRB 2BT3A 2OCTA 1ULIB 5TGNA 4CCVA 4MMZB 2W04A 3HIGA 1SJWA 3STDA 4H3UA 1Q40A 1W2B2 3WA3A 2RCDA 2HMKB 2YFLB 1W6CA 2XGNA 1IV7A 4XDVA 4AKZA 2KXGA 1N8R4 3FG4A 3RGAA 4AEQA 1HU9A 5D83A 2OQEC 1IU7A 4X2HA 2GU3A 5AI1A 5KP4A 3PYJA 5JPUA 1GY6A 4N6MA 3DUKA 3CMA3 4N6OB 1YIJ3 1OHOA 3KE7A 1EKMA 4R1KA 1UI8A 3EB8A 1JKGA 3GZXB 2WGQA 3BB9A 3MYTA 4R80A 5LC6A 1TUHA 2W56B 1AR0A 5AYRB 2V1LA 3OV4A 2QGUA 1O7GB 2F99A 3EC9A 4AKYA 1G96A 2SBLA 3Q2PA 4L8OA 3H3HA 3LH4A 1DMNA 1N9JA 5G2GA 1O7MB 3V98A 4EV5A 3CCJ3 3MKIA 5D81A 1Q7Y4 1NJI4 3UL5A 1JJ22 2FGTA 1ZO2A 1IVWA 1STFI 2HMMB 2PNCA 3DZLA 1AVKA 2D1WA 4KVHA 5IG0A 3FKAA 2RGQA 1WMPA 5EVHA 1E97A 3SLUA 3F40A 1D6YA 3DGLA 1CYVA 1W00A 1QVG2 2OOVC 1EA2A 3LTAA 1S5AA 2IUKA 3DM8A 4OVMA 2BO9B 1VQ83 1Q40B 1VQP3 4XM4A 1VQL3 1JB5A 1YGEA 2ML5A 4HM2B 3NV0B 2O3OA 3WOEB 4LGQA 3L0RA 4RBNA 5CF2A 4GB5A 4HVNA 1W6GA 3B4PA 5DRVA 2XFSA 3KSED 4HM4B 2LQVA 3Q1CA 4JRFA 3X3YA 2GXFA 3VGNA 1M9GA 1HKXA 5LC7A 4MMXB 3X41A 3FSDA 3J7Yd 3MPHA 2XSHB 4XBYA 4IIAA 3CPW2 4R9KA 1IQYA 3EBYA 1LNHA 1WMNA 3EBTA 5IERA 1C7HA 2XH9A 3K5TA 2E2VA 1TP6A 3S67A 3OWUA 3CCQ3 3E99A 1QMAA 2CWTA 1SIIA 3JVCA 3K0ZA 1RRLA 1AV4A 1A2VA 3S27A 3FF0A 4MJDA 3X3XA 3NQZA 1Q42A 5IG3A 1KQS2 2OTL3 1FGOA 4HM0B 1R4CA 5CXOA 2R4IA 2GBXB 2BHMA 3X3ZA 2W56A 1FGTA 3FGYA 1ISKA 1FGRA 1FA3A 1J2BA 1NU3A 1VQ53 3DGOA 3GAXA 1OPYA 1YHQ3 1OACA 1JV2B 1MNLA 1VQ73 1Z1SA 1KC84 3WMDA 2CFDA 4O3VA 1DVCA 2K54A 4HZ9B 4HJLB 3G8ZA 4ZM8A 1YIT3 3UB1A 1GY7A 3G0KA 3EE1A 4HM6B 2IMJA 2O9UX 3LYGA 3MG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JB2 A;  5STD A;  1NWW A;  1OUN A;  3EN1 B;  1UUW B;  3IPT A;  2STD A;  5IEN A;  4OUQ A;  3NV0 A;  4XBX A;  3T8U A;  3F7X A;  2Z76 A;  4J9A A;  1K41 A;  3KSP A;  2F86 B;  2HMO B;  5AII A;  3EX9 A;  3GZY B;  2GEY A;  3MSO A;  3GWR A;  5CLK A;  3HZP A;  5IG5 A;  1BUQ A;  1DMQ A;  4J8T A;  5FW5 A;  4RZM A;  5IF6 A;  3G16 A;  5IG4 A;  5AIG A;  3F8X A;  2RFR A;  3GZB A;  5KP1 A;  4CDL A;  3MHE A;  4WYK A;  3DMC A;  2OWP A;  4HM7 B;  2HMN B;  4PEJ A;  3OWY A;  6STD A;  2I9W A;  2YFI B;  2Z77 A;  3S5C A;  1A2K A;  2YFJ B;  3K7C A;  4LMI A;  3MG3 A;  2UX0 A;  2W2C A;  1U5O A;  1VZZ A;  2B24 B;  4K1U A;  3FLJ A;  4N3V A;  1UUV B;  5BXQ A;  1NDO B;  1GYB A;  1JB4 A;  2F98 A;  3B8L A;  4X2O A;  4I4K A;  5CK6 A;  1EG9 B;  1OHS A;  3ER7 A;  3F9S A;  2PZV A;  1ZX2 A;  1GS3 A;  4ORL A;  4WYK B;  3F7S A;  5AEU B;  3SED A;  2HMJ B;  1E3V A;  2BNG A;  1IDP A;  4XBT A;  1O7N B;  4WP5 A;  3FZW A;  2XRX B;  1OCV A;  5BVB A;  3D9R A;  3JUM A;  4STD A;  1CQS A;  3ECF A;  3EJV A;  3UJM A;  3CNX A;  2HML B;  3B4O A;  4FCM A;  4Q53 A;  2A15 A;  3B7C A;  1E3R A;  3SOY A;  5HGR A;  2GBW B;  2XR8 B;  3MG2 A;  3SOA A;  5IEO A;  4HM8 B;  3OWS A;  1WQL B;  3JUN A;  3KKG A;  4HM5 B;  3JUP A;  3H51 A;  5AEW B;  3NXJ A;  5IEP A;  5JPP A;  3CPO A;  5AIH A;  3T8N A;  3F8H A;  1W6Y A;  1ASK A;  4XB5 A;  2B1X B;  2GEX A;  1O7H B;  5KP3 A;  1STD A;  2XSO B;  3HX8 A;  2BMO B;  5DRE A;  3UNL A;  3RGR A;  3OX9 A;  3LZA A;  3FF2 A;  1O7W B;  3GZR A;  1QJG A;  1O7P B;  3JUO A;  4L7K A;  5CF1 A;  1OGX A;  3BLZ A;  4LEH A;  1ULJ B;  1OF5 B;  3CU3 A;  4HM1 B;  7STD A;  3EQQ B;  3A76 A;  1JN5 A;  4WWU C;  3OXA A;  3VSY A;  3NUV A;  2BMQ B;  2Z7A A;  2CHC A;  1OH0 A;  3NBR A;  3Q90 A;  1OHP A;  4XDW A;  1DMM A;  4HZB B;  3GRD A;  4HM3 B;  3CNM A;  3EHC A;  1JKG B;  3KZT A;  3HK4 A;  3JUQ A;  3I0Y A;  4L8P A;  3NM2 A;  3NHX A;  3FH1 A;  3DXO A;  1W02 A;  2CKF B;  8CHO A;  5D82 A;  1OGZ A;  3ROB A;  3F14 A;  3EF8 A;  1JN5 B;  2QIY A;  4FCJ A;  1W01 A;  4U13 A;  4K1V A;  1GY5 A;  3M8C A;  4R9L A;  5AIF A;  3EN8 A;  2JQ5 A;  4HKV B;  1OF5 A;  2INX A;  2BMR B;  1ULI B;  5TGN A;  1SJW A;  3STD A;  4H3U A;  1Q40 A;  2RCD A;  2HMK B;  2YFL B;  4XDV A;  3RGA A;  5D83 A;  4X2H A;  5AI1 A;  5KP4 A;  5JPU A;  1GY6 A;  3DUK A;  1OHO A;  3KE7 A;  4R1K A;  1JKG A;  3GZX B;  3BB9 A;  3MYT A;  1TUH A;  1AR0 A;  3OV4 A;  2QGU A;  1O7G B;  2F99 A;  3EC9 A;  4L8O A;  3H3H A;  5G2G A;  1DMN A;  1O7M B;  3MKI A;  5D81 A;  1ZO2 A;  2HMM B;  3DZL A;  4KVH A;  5IG0 A;  3FKA A;  2RGQ A;  5EVH A;  1E97 A;  3F40 A;  1W00 A;  1EA2 A;  1S5A A;  3DM8 A;  4OVM A;  1Q40 B;  4XM4 A;  1JB5 A;  4HM2 B;  3NV0 B;  4LGQ A;  5CF2 A;  4GB5 A;  4HVN A;  3B4P A;  5DRV A;  4HM4 B;  2GXF A;  3VGN A;  1HKX A;  3FSD A;  2XSH B;  4XBY A;  4IIA A;  4R9K A;  3EBY A;  3EBT A;  5IER A;  1C7H A;  1TP6 A;  3OWU A;  3E99 A;  1QMA A;  3K0Z A;  3FF0 A;  4MJD A;  1Q42 A;  5IG3 A;  4HM0 B;  5CXO A;  2R4I A;  2GBX B;  1ISK A;  3FGY A;  1NU3 A;  1OPY A;  1Z1S A;  3WMD A;  2K54 A;  4HZ9 B;  4HJL B;  3G8Z A;  1GY7 A;  3G0K A;  4HM6 B;  2IMJ A;  3LYG A;  3MG1 A; 
#chains in the Genus database with same CATH topology
 1JB2 A;  2F4Y A;  2OQE A;  5STD A;  4EV2 A;  1UUG B;  1NWW A;  1N8Q A;  1OUN A;  3CXC 2;  2XGL A;  3ZG0 A;  2P09 A;  3EN1 B;  3CC7 3;  1G02 A;  1JBS A;  1RSN A;  1UUW B;  1RGG A;  3IPT A;  2STD A;  5IEN A;  1BVI A;  2ML6 A;  4NPB A;  3PZW A;  1VQK 3;  1B2X A;  3SX1 A;  1YI2 3;  2P38 A;  3LT9 A;  3PCS A;  4OUQ A;  1L5G B;  2ZA4 A;  3NV0 A;  4XBX A;  3T8U A;  2GU1 A;  2Z76 A;  1F8N A;  3F7X A;  4N6N B;  4J9A A;  5RNT A;  1K41 A;  3NBJ A;  3KSP A;  3DY5 A;  2F86 B;  1Q81 4;  1IVU A;  1W7C A;  1BOX A;  2HMO B;  2H0G A;  5AII A;  3EX9 A;  3GZY B;  5BIR A;  5HOH A;  6RNT A;  1BNS A;  1M1X B;  2GEY A;  4IT7 A;  4G1M B;  3MSO A;  1AY7 A;  1DYU A;  2C10 A;  1MGR A;  1Q82 4;  3GWR A;  4GL6 A;  5EQL A;  5GSP A;  1KWI A;  5CLK A;  3HZP A;  1RN7 A;  5IG5 A;  1I3F A;  1RGH A;  1BUQ A;  2E2T A;  3N9H A;  1VQM 3;  2OOV A;  1DMQ A;  2OTJ 3;  2CG1 A;  4J8T A;  5FW5 A;  1LRA A;  2P0X A;  3HI7 A;  4HBR A;  4RZM A;  5IF6 A;  1A67 A;  1BNR A;  1WMO A;  2FXT A;  3G16 A;  1B2S A;  5IG4 A;  4J5K A;  3G4S 3;  3FCS B;  5AIG A;  1T2I A;  3A5E A;  3F8X A;  2RFR A;  3GZB A;  1N5H A;  5KP1 A;  2CC3 A;  4CDL A;  3CCL 3;  3LXU X;  3MHE A;  4WYK A;  3DMC A;  4IPB A;  1LVN A;  4EYC A;  3QK9 A;  2OWP A;  2W9P A;  3FG1 A;  2HMN B;  4HM7 B;  1IVX A;  1QAF A;  4PEJ A;  3OWY A;  2C11 A;  6STD A;  1CEW I;  1NB3 I;  1ZS7 A;  2I9W A;  2YFI B;  2Z77 A;  3BU4 A;  4FMB A;  1M90 4;  3PGB A;  3S5C A;  3X42 A;  1A2K A;  4LSO A;  2YFJ B;  1S72 3;  1PYL A;  1RJO A;  4WFO A;  3G71 3;  1W2Z A;  2CH9 A;  1FUW A;  1SQW A;  2W0Q A;  3AHS A;  1MGW A;  3DGY A;  3K7C A;  1MWR A;  3LOY A;  4LMI A;  1FGQ A;  3MG3 A;  2YX9 A;  1PU4 A;  2KF6 A;  3SYU A;  2UX0 A;  2W2C A;  1FGM A;  1U5O A;  4O2H A;  1VZZ A;  2B24 B;  3LTC A;  4K1U A;  4N6U A;  1UW1 A;  4LYL B;  3LTB A;  3FLJ A;  4OK0 A;  4N3V A;  1TRP A;  1Q9E A;  1US1 A;  1AQZ A;  2JDI H;  1FUS A;  3BNB A;  4BL3 A;  1YVS A;  3HOH A;  4BU4 A;  3S28 A;  2ZL8 A;  1UCL A;  1UUV B;  1N9E A;  2W9Q A;  4KZ1 A;  5BXQ A;  2BIR A;  1K73 4;  4WHA A;  1WTH A;  1NDO B;  1GYB A;  1GMP A;  1JB4 A;  3PCR A;  2F98 A;  1GSP A;  2XF3 A;  4HOH A;  2WO0 A;  3B8L A;  2IUJ A;  4FMD A;  2KF5 A;  4X2O A;  1JRQ A;  1K28 A;  1UCI A;  4I4K A;  1EG9 B;  5CK6 A;  1OHS A;  1IYY A;  2GSP A;  3LTD A;  3ER7 A;  3F9S A;  2PZV A;  1T3B A;  1K9M 4;  1ZX2 A;  2W6J H;  3I56 3;  1GS3 A;  1JBT A;  3N8B A;  4ORL A;  4N6L A;  4WYK B;  2MF7 A;  4EBG A;  2FNQ A;  3F7S A;  5AEU B;  1MWT A;  3SED A;  1K8A 4;  2HMJ B;  1E3V A;  4RNZ A;  2BNG A;  3IMA B;  3BNE A;  1IDP A;  1RTU A;  4XBT A;  1O7N B;  1QAL A;  1X1U A;  4WP5 A;  3FZW A;  2XRX B;  1DET A;  5ELU A;  1LQG C;  2CFW A;  3D5I A;  1HYF A;  1OCV A;  3BND A;  2KAA A;  5BU4 A;  3G6E 3;  4MMY B;  5BVB A;  1RCL A;  1BRK A;  1BU4 A;  3X40 A;  2Y73 A;  1I8V A;  3D9R A;  1I70 A;  1TFO A;  4I5Q A;  1M1K 4;  2CG0 A;  3AMO A;  2CWV A;  3JUM A;  1FW7 A;  1QAK A;  1I3I A;  1N5P A;  4STD A;  1IK3 A;  1RNT A;  3IJE B;  1RN1 A;  1CQS A;  3ECF A;  3EJV A;  1YJW 3;  1QVF 2;  1RLS A;  1X1W A;  1GD4 A;  2CFK A;  2K0M A;  1CYU A;  1BRJ A;  3NM7 A;  3RNT A;  1BSB A;  3UJM A;  4EXR A;  5I97 A;  3CNX A;  1TU5 A;  2HML B;  8RNT A;  3B4O A;  3KFQ C;  1I2F A;  4FCZ A;  1MOL A;  4FCM A;  4Q53 A;  2AAD A;  2A15 A;  2QA4 3;  4LZI A;  1UCK A;  1RDS A;  3B7C A;  4GSP A;  1DE3 A;  1E3R A;  4N6T A;  3SOY A;  3FG3 A;  5HGR A;  1BRS A;  4NRE A;  2CFG A;  2GBW B;  2XR8 B;  3MG2 A;  3SOA A;  4N6V 0;  3V99 A;  5IEO A;  4HM8 B;  4O02 B;  3U1W A;  3OWS A;  3WOD G;  1VQ9 3;  4K61 A;  1WQL B;  3CC4 3;  1TIJ A;  1MWU A;  3JUN A;  3K9M C;  2ZDJ A;  1BAO A;  3KKG A;  4BTY A;  4HM5 B;  1VQ6 3;  1SIH A;  5EEO A;  3KN4 A;  1HZ1 A;  2J8X B;  2D42 A;  1BNF A;  3AHW A;  1R4Y A;  3JUP A;  3SVA A;  1B20 A;  2Q07 A;  3H51 A;  2CWU A;  2P05 A;  5AEW B;  3NXJ A;  3O8Y A;  5IEP A;  1RRH A;  1VQ4 3;  1UCJ A;  5JPP A;  3DH2 A;  1W5Z A;  1B27 A;  3CPO A;  5AIH A;  3T8N A;  3CCR 3;  1NO3 A;  4EC6 A;  4FMC A;  4BL2 A;  1Q7H A;  1UI7 A;  3F8H A;  1SAR A;  2E2U A;  1W6Y A;  1ASK A;  4XB5 A;  2KCD A;  1RKY A;  3CCE 3;  1ROV A;  2CIU A;  2B1X B;  2KF3 A;  4HAA A;  2GEX A;  1O7H B;  3NQY A;  5KP3 A;  1STD A;  5FGO A;  1VQQ A;  3WOF B;  4FMA A;  1X1Y A;  4NHF A;  1BUJ A;  2SAR A;  1RGA A;  1C54 A;  1BRH A;  5ELJ A;  1EUI C;  3V92 A;  2XSO B;  3AMO B;  4KFF A;  3HX8 A;  2WOH A;  2IA7 A;  2BMO B;  3LT8 A;  1LXE A;  4KFD A;  5DRE A;  3UNL A;  5IW9 A;  4BTW A;  3RGR A;  1NNV A;  3OX9 A;  3LZA A;  1IQX A;  1V74 A;  2CK3 H;  3FF2 A;  2CFL A;  1YJ9 3;  3NBB A;  1O7W B;  3GZR A;  1QJG A;  3PS8 A;  1O7P B;  3VF1 A;  4CJN A;  1BGS A;  1T5Y A;  1B2Z A;  1T2H A;  3CC2 3;  1GOU A;  4RNY A;  3QRD A;  3JUO A;  4L7K A;  5CF1 A;  1BRG A;  2CX0 A;  1WNH A;  4O8S A;  4KFE A;  1OGX A;  1LOX A;  4J5G A;  2XEP A;  3BLZ A;  3KII A;  2WOF A;  3DGM A;  4LEH A;  6GSP A;  5G1L A;  1ULJ B;  1OF5 B;  1SPU A;  3CU3 A;  1LNI A;  3WDG B;  7GSP A;  3RDE A;  3HII A;  1JBR A;  5JBS A;  3TDG A;  4HM1 B;  4BTX A;  7STD A;  3EQQ B;  1PFP A;  3A76 A;  3NX0 A;  3CCS 3;  1YGW A;  1JN5 A;  4WWU C;  2LYX A;  3WA2 X;  3OXA A;  2QEX 3;  3VSY A;  2W03 A;  3NUV A;  1RGL A;  2BMQ B;  1FUT A;  2Z7A A;  1BRN L;  2CHC A;  1OH0 A;  1V58 A;  1JZO A;  2RSX A;  2F5M A;  1OHP A;  1TFK A;  3NBR A;  3Q90 A;  3S29 A;  5M18 A;  1I2E A;  1TTO A;  3BNC A;  4XDW A;  1GOV A;  2HOH A;  3CME 3;  1DMM A;  1LOW A;  2WGO A;  4HZB B;  1RNB A;  1D6U A;  3GRD A;  1BSE A;  1Q7Y 4;  1G0T A;  3URP A;  1BRI A;  4TX4 A;  2P0M A;  4HM3 B;  3CNM A;  3EHC A;  2Z6B A;  1JKG B;  3KZT A;  3N54 B;  2AAE A;  3HK4 A;  3CCU 3;  3JUQ A;  1EQK A;  4CPK A;  3I0Y A;  1FYS A;  1U8C B;  2Y74 A;  3DGN A;  1V57 A;  4L8P A;  3NM2 A;  1DVD A;  4MEI A;  1IT7 A;  3NHX A;  2CW9 A;  3FH1 A;  3DXO A;  3SXX A;  3U97 A;  1ROA A;  1UDI I;  1IV9 A;  1W02 A;  2MC8 A;  1Q86 4;  1IVV A;  3LML A;  3MWZ A;  2KF4 A;  2KRT A;  1VQN 3;  3CD6 3;  1AVL A;  3ALA A;  2K3D A;  1KD1 4;  1TRQ A;  2CKF B;  4R4K A;  1Y4K A;  4JF8 A;  8CHO A;  3PXM A;  5D82 A;  3K63 A;  3UL6 A;  1NB5 I;  1GD3 A;  4DKI A;  4HYZ A;  4QWT A;  2M7O A;  1VQO 3;  1OGZ A;  3ROB A;  3ZFZ A;  5AYS C;  1RCK A;  4K90 B;  3CCM 3;  1IT8 A;  4H61 A;  4FR9 A;  3F14 A;  3EF8 A;  1YVB I;  1JN5 B;  5A0O B;  2QIY A;  4FCJ A;  1A90 A;  1W01 A;  3KCH A;  4U13 A;  1B21 A;  2L4V A;  1KSI A;  4K1V A;  1GY5 A;  3T0U A;  3M8C A;  3I55 3;  3CCV 3;  2L1S A;  3OW2 2;  2XFT A;  3D3L A;  4R9L A;  5AIF A;  2H0H A;  1YJN 3;  3EN8 A;  2JQ5 A;  1D6Z A;  1IQ8 A;  4HKV B;  1BNE A;  1W4N A;  1OF5 A;  1JNQ A;  1GMQ A;  1I2G A;  2INX A;  2BMR B;  2BT3 A;  2OCT A;  1ULI B;  5TGN A;  4CCV A;  4MMZ B;  2W04 A;  3HIG A;  1TJD A;  1SJW A;  3STD A;  4H3U A;  1BNJ A;  3WHO A;  3BIR A;  1Q40 A;  1W2B 2;  1RGF A;  3WA3 A;  2RCD A;  2HMK B;  2YFL B;  1W6C A;  2XGN A;  1IV7 A;  4XDV A;  4AKZ A;  2KXG A;  1N8R 4;  3FG4 A;  3RGA A;  4AEQ A;  1HU9 A;  5D83 A;  4BIR A;  2OQE C;  1IU7 A;  4X2H A;  2C4B A;  2GU3 A;  1LOY A;  5AI1 A;  3PYJ A;  1MWS A;  9RNT A;  5JPU A;  5KP4 A;  1PY3 A;  1GY6 A;  4N6M A;  1GOY A;  1UGI A;  3DUK A;  3CMA 3;  4N6O B;  1YIJ 3;  1OHO A;  3KE7 A;  1EKM A;  4R1K A;  1UI8 A;  1RN4 A;  1JKG A;  3EB8 A;  3GZX B;  2WGQ A;  1UGH I;  3BB9 A;  3MYT A;  4R80 A;  5LC6 A;  3GSP A;  1TUH A;  2W56 B;  1AR0 A;  2IY2 A;  5AYR B;  2V1L A;  3OV4 A;  2CX1 A;  5G1K A;  2QGU A;  1O7G B;  2F99 A;  3EC9 A;  4AKY A;  1G96 A;  2SBL A;  3Q2P A;  2RBI A;  4L8O A;  1B2U A;  3H3H A;  3LH4 A;  1DMN A;  1N9J A;  5G2G A;  1O7M B;  3V98 A;  4EV5 A;  3CCJ 3;  3MKI A;  2UUG C;  5D81 A;  1NJI 4;  3UL5 A;  1JJ2 2;  2FGT A;  1RGE A;  1ZO2 A;  1IVW A;  1STF I;  2HMM B;  1CH0 A;  2PNC A;  3DZL A;  1AVK A;  2D1W A;  4KVH A;  5IG0 A;  2H0I A;  2ZHX B;  3FKA A;  1B3S A;  3WR2 A;  2RGQ A;  1WMP A;  5EVH A;  1E97 A;  3SLU A;  3F40 A;  1D6Y A;  1EEJ A;  1CYV A;  1W00 A;  3D5G A;  3DGL A;  1QVG 2;  2OOV C;  1EA2 A;  1BAN A;  3LTA A;  1S5A A;  2IUK A;  3DM8 A;  4OVM A;  2BO9 B;  5M1A A;  3AGN A;  7RNT A;  1A2P A;  1VQ8 3;  1Q40 B;  1VQP 3;  4XM4 A;  3D4A A;  4RNT A;  1VQL 3;  1JB5 A;  5M19 A;  1YGE A;  2ML5 A;  4HM2 B;  3NV0 B;  2F56 A;  2O3O A;  3WOE B;  1X1X A;  3L0R A;  4LGQ A;  4RBN A;  4EW5 A;  1FZU A;  4GB5 A;  5CF2 A;  4HVN A;  1W6G A;  3B4P A;  5DRV A;  2RNT A;  2XFS A;  1BSC A;  2UGI A;  1GMR A;  3KSE D;  2LQV A;  3Q1C A;  3Q3F A;  4HM4 B;  4JRF A;  3X3Y A;  2GXF A;  3VGN A;  1M9G A;  2R41 A;  1HKX A;  1YNV X;  2IYJ A;  1I0X A;  4KT3 B;  1BSA A;  5LC7 A;  4MMX B;  3X41 A;  3FSD A;  3J7Y d;  3MPH A;  1JZD A;  1RGC A;  2XSH B;  4GHO A;  4XBY A;  4IIA A;  3CPW 2;  4R9K A;  2F5W A;  1IQY A;  3EBY A;  1LNH A;  1WMN A;  1BIR A;  3EBT A;  5IER A;  1C7H A;  2XH9 A;  3K5T A;  2E2V A;  1TP6 A;  1BNG A;  3S67 A;  3OWU A;  3CCQ 3;  1I0V A;  3E99 A;  1QMA A;  2CWT A;  1SII A;  3JVC A;  1RMS A;  1RRL A;  1AV4 A;  1A2V A;  3D79 A;  3K0Z A;  3FF0 A;  3S27 A;  4MJD A;  3X3X A;  3NQZ A;  1Q42 A;  5IG3 A;  1KQS 2;  2OTL 3;  1FGO A;  4HM0 B;  1R4C A;  5CXO A;  2R4I A;  1LOV A;  2GBX B;  2BHM A;  3X3Z A;  2BU4 A;  2W56 A;  1RHL A;  1B2M A;  1FGT A;  3FGY A;  3ZG5 A;  1ISK A;  1FGR A;  1FA3 A;  1J2B A;  1NU3 A;  1VQ5 3;  1BNI A;  3DGO A;  3GAX A;  1OPY A;  1RGK A;  1YHQ 3;  4ILF A;  1ZGX A;  1OAC A;  1JV2 B;  1MNL A;  1VQ7 3;  1Z1S A;  1KC8 4;  3WMD A;  2CFD A;  4O3V A;  3AGO A;  1DVC A;  1LQM B;  2K54 A;  4HZ9 B;  4HJL B;  3G8Z A;  4ZM8 A;  1YIT 3;  3UB1 A;  1GY7 A;  3G0K A;  1BSD A;  3EE1 A;  4HM6 B;  2IMJ A;  2O9U X;  3LYG A;  3MG1 A; 
#chains in the Genus database with same CATH homology
 1JB2 A;  2OQE A;  5STD A;  4EV2 A;  1NWW A;  1N8Q A;  1OUN A;  3CXC 2;  2XGL A;  2P09 A;  3EN1 B;  3CC7 3;  1UUW B;  3IPT A;  2STD A;  5IEN A;  2ML6 A;  1VQK 3;  3PZW A;  3SX1 A;  1YI2 3;  2P38 A;  3LT9 A;  3PCS A;  4OUQ A;  1L5G B;  3NV0 A;  4XBX A;  3T8U A;  2GU1 A;  2Z76 A;  1F8N A;  3F7X A;  4N6N B;  4J9A A;  1K41 A;  3NBJ A;  3KSP A;  3DY5 A;  2F86 B;  1Q81 4;  1IVU A;  1W7C A;  2HMO B;  5AII A;  3EX9 A;  3GZY B;  1M1X B;  2GEY A;  4IT7 A;  4G1M B;  3MSO A;  1DYU A;  2C10 A;  1Q82 4;  3GWR A;  4GL6 A;  5EQL A;  1KWI A;  5CLK A;  3HZP A;  1RN7 A;  5IG5 A;  1BUQ A;  2E2T A;  3N9H A;  1VQM 3;  2OOV A;  1DMQ A;  2OTJ 3;  2CG1 A;  4J8T A;  5FW5 A;  2P0X A;  4RZM A;  3HI7 A;  4HBR A;  5IF6 A;  1A67 A;  1WMO A;  2FXT A;  3G16 A;  5IG4 A;  3G4S 3;  3FCS B;  5AIG A;  3F8X A;  2RFR A;  3GZB A;  1N5H A;  5KP1 A;  2CC3 A;  4CDL A;  3CCL 3;  3LXU X;  3MHE A;  4WYK A;  3DMC A;  4IPB A;  1LVN A;  4EYC A;  3QK9 A;  2OWP A;  2W9P A;  3FG1 A;  2HMN B;  4HM7 B;  1IVX A;  1QAF A;  4PEJ A;  3OWY A;  2C11 A;  6STD A;  1CEW I;  2Z77 A;  1NB3 I;  2I9W A;  2YFI B;  4FMB A;  1M90 4;  3PGB A;  3S5C A;  3X42 A;  1A2K A;  4LSO A;  2YFJ B;  1S72 3;  4WFO A;  1RJO A;  3G71 3;  1W2Z A;  2CH9 A;  1FUW A;  1SQW A;  2W0Q A;  3K7C A;  3LOY A;  4LMI A;  1FGQ A;  3MG3 A;  2YX9 A;  1PU4 A;  2UX0 A;  2W2C A;  1FGM A;  1U5O A;  4O2H A;  1VZZ A;  2B24 B;  3LTC A;  4K1U A;  4N6U A;  1UW1 A;  3LTB A;  3FLJ A;  4OK0 A;  4N3V A;  1US1 A;  2JDI H;  3BNB A;  3S28 A;  2ZL8 A;  1UUV B;  1N9E A;  2W9Q A;  4KZ1 A;  5BXQ A;  1K73 4;  4WHA A;  1WTH A;  1NDO B;  1GYB A;  1JB4 A;  3PCR A;  2F98 A;  2XF3 A;  2WO0 A;  3B8L A;  2IUJ A;  4FMD A;  4X2O A;  1JRQ A;  1K28 A;  4I4K A;  5CK6 A;  1EG9 B;  1OHS A;  3LTD A;  3ER7 A;  3F9S A;  2PZV A;  1K9M 4;  1ZX2 A;  2W6J H;  3I56 3;  1GS3 A;  3N8B A;  4ORL A;  4N6L A;  4WYK B;  2MF7 A;  4EBG A;  2FNQ A;  3F7S A;  5AEU B;  3SED A;  1K8A 4;  2HMJ B;  1E3V A;  4RNZ A;  2BNG A;  3IMA B;  3BNE A;  1IDP A;  4XBT A;  1O7N B;  1QAL A;  4WP5 A;  3FZW A;  2XRX B;  5ELU A;  2CFW A;  1OCV A;  3BND A;  3G6E 3;  4MMY B;  5BVB A;  3X40 A;  2Y73 A;  3D9R A;  1M1K 4;  1TFO A;  2CG0 A;  3AMO A;  2CWV A;  3JUM A;  1QAK A;  1N5P A;  4STD A;  1IK3 A;  3IJE B;  1CQS A;  3ECF A;  3EJV A;  1YJW 3;  1QVF 2;  1GD4 A;  2CFK A;  2K0M A;  1CYU A;  3NM7 A;  4EXR A;  3UJM A;  5I97 A;  3CNX A;  2HML B;  3B4O A;  3KFQ C;  4FCZ A;  1MOL A;  4FCM A;  4Q53 A;  2A15 A;  2QA4 3;  4LZI A;  3B7C A;  1E3R A;  4N6T A;  3SOY A;  3FG3 A;  5HGR A;  4NRE A;  2CFG A;  2GBW B;  2XR8 B;  3MG2 A;  3SOA A;  4N6V 0;  3V99 A;  5IEO A;  4HM8 B;  4O02 B;  3U1W A;  3OWS A;  3WOD G;  1VQ9 3;  4K61 A;  1WQL B;  3CC4 3;  1TIJ A;  3JUN A;  3K9M C;  2ZDJ A;  3KKG A;  4BTY A;  4HM5 B;  1VQ6 3;  1SIH A;  5EEO A;  3KN4 A;  2D42 A;  3JUP A;  3SVA A;  3H51 A;  2Q07 A;  2CWU A;  2P05 A;  5AEW B;  3NXJ A;  3O8Y A;  5IEP A;  1RRH A;  1VQ4 3;  5JPP A;  1W5Z A;  3CCR 3;  3CPO A;  5AIH A;  3T8N A;  1NO3 A;  4EC6 A;  4FMC A;  1UI7 A;  3F8H A;  2E2U A;  1W6Y A;  1ASK A;  4XB5 A;  2KCD A;  1RKY A;  3CCE 3;  1ROV A;  2CIU A;  2B1X B;  2GEX A;  1O7H B;  3NQY A;  5KP3 A;  1STD A;  5FGO A;  3WOF B;  4FMA A;  4NHF A;  5ELJ A;  3V92 A;  2XSO B;  3AMO B;  4KFF A;  3HX8 A;  2WOH A;  2IA7 A;  2BMO B;  3LT8 A;  1LXE A;  4KFD A;  5DRE A;  3UNL A;  5IW9 A;  4BTW A;  3RGR A;  3OX9 A;  3LZA A;  1IQX A;  1V74 A;  2CK3 H;  3FF2 A;  2CFL A;  1YJ9 3;  3NBB A;  1O7W B;  3GZR A;  1QJG A;  3PS8 A;  1O7P B;  3VF1 A;  1T5Y A;  3CC2 3;  4RNY A;  3QRD A;  3JUO A;  4L7K A;  5CF1 A;  4O8S A;  1WNH A;  4KFE A;  1OGX A;  1LOX A;  2XEP A;  3BLZ A;  3KII A;  2WOF A;  3DGM A;  4LEH A;  1ULJ B;  1OF5 B;  1SPU A;  3CU3 A;  3WDG B;  3RDE A;  3HII A;  5JBS A;  3TDG A;  4HM1 B;  4BTX A;  7STD A;  3EQQ B;  1PFP A;  3A76 A;  3NX0 A;  3CCS 3;  1JN5 A;  4WWU C;  2LYX A;  3WA2 X;  3OXA A;  2QEX 3;  3VSY A;  2W03 A;  3NUV A;  2BMQ B;  2Z7A A;  2CHC A;  1OH0 A;  2RSX A;  3NBR A;  3Q90 A;  1OHP A;  1TFK A;  1TU5 A;  3S29 A;  3BNC A;  3CME 3;  4XDW A;  1DMM A;  2WGO A;  4HZB B;  1D6U A;  3GRD A;  4TX4 A;  2P0M A;  4HM3 B;  3CNM A;  3EHC A;  2Z6B A;  1JKG B;  3KZT A;  3N54 B;  3HK4 A;  3CCU 3;  3JUQ A;  1EQK A;  3I0Y A;  1U8C B;  2Y74 A;  3DGN A;  4L8P A;  3NM2 A;  1DVD A;  4MEI A;  1IT7 A;  3NHX A;  2CW9 A;  3FH1 A;  3DXO A;  3SXX A;  3U97 A;  1ROA A;  1IV9 A;  1W02 A;  2MC8 A;  1Q86 4;  1IVV A;  3LML A;  3MWZ A;  2KRT A;  1VQN 3;  3CD6 3;  1AVL A;  3ALA A;  1KD1 4;  2CKF B;  4R4K A;  1Y4K A;  4JF8 A;  8CHO A;  3PXM A;  5D82 A;  3K63 A;  3UL6 A;  1NB5 I;  1GD3 A;  4HYZ A;  4QWT A;  2M7O A;  1VQO 3;  1OGZ A;  3ROB A;  5AYS C;  4K90 B;  3CCM 3;  1IT8 A;  4H61 A;  4FR9 A;  3F14 A;  3EF8 A;  1YVB I;  1JN5 B;  5A0O B;  2QIY A;  4FCJ A;  1A90 A;  1W01 A;  4U13 A;  2L4V A;  1KSI A;  4K1V A;  1GY5 A;  3T0U A;  3M8C A;  3I55 3;  3CCV 3;  3OW2 2;  2XFT A;  3D3L A;  4R9L A;  5AIF A;  1YJN 3;  3EN8 A;  2JQ5 A;  1D6Z A;  1IQ8 A;  4HKV B;  1W4N A;  1OF5 A;  1JNQ A;  2INX A;  2BMR B;  2BT3 A;  2OCT A;  1ULI B;  5TGN A;  4CCV A;  4MMZ B;  2W04 A;  3HIG A;  1SJW A;  3STD A;  4H3U A;  1Q40 A;  1W2B 2;  3WA3 A;  2RCD A;  2HMK B;  2YFL B;  1W6C A;  2XGN A;  1IV7 A;  4XDV A;  4AKZ A;  2KXG A;  1N8R 4;  3FG4 A;  3RGA A;  4AEQ A;  1HU9 A;  5D83 A;  2OQE C;  1IU7 A;  4X2H A;  2GU3 A;  5AI1 A;  5KP4 A;  3PYJ A;  5JPU A;  1GY6 A;  4N6M A;  3DUK A;  3CMA 3;  4N6O B;  1YIJ 3;  1OHO A;  3KE7 A;  1EKM A;  4R1K A;  1UI8 A;  3EB8 A;  1JKG A;  3GZX B;  2WGQ A;  3BB9 A;  3MYT A;  4R80 A;  5LC6 A;  1TUH A;  2W56 B;  1AR0 A;  5AYR B;  2V1L A;  3OV4 A;  2QGU A;  1O7G B;  2F99 A;  3EC9 A;  4AKY A;  1G96 A;  2SBL A;  3Q2P A;  4L8O A;  3H3H A;  3LH4 A;  1DMN A;  1N9J A;  5G2G A;  1O7M B;  3V98 A;  4EV5 A;  3CCJ 3;  3MKI A;  5D81 A;  1Q7Y 4;  1NJI 4;  3UL5 A;  1JJ2 2;  2FGT A;  1ZO2 A;  1IVW A;  1STF I;  2HMM B;  2PNC A;  3DZL A;  1AVK A;  2D1W A;  4KVH A;  5IG0 A;  3FKA A;  2RGQ A;  1WMP A;  5EVH A;  1E97 A;  3SLU A;  3F40 A;  1D6Y A;  3DGL A;  1CYV A;  1W00 A;  1QVG 2;  2OOV C;  1EA2 A;  3LTA A;  1S5A A;  2IUK A;  3DM8 A;  4OVM A;  2BO9 B;  1VQ8 3;  1Q40 B;  1VQP 3;  4XM4 A;  1VQL 3;  1JB5 A;  1YGE A;  2ML5 A;  4HM2 B;  3NV0 B;  2O3O A;  3WOE B;  4LGQ A;  3L0R A;  4RBN A;  5CF2 A;  4GB5 A;  4HVN A;  1W6G A;  3B4P A;  5DRV A;  2XFS A;  3KSE D;  4HM4 B;  2LQV A;  3Q1C A;  4JRF A;  3X3Y A;  2GXF A;  3VGN A;  1M9G A;  1HKX A;  5LC7 A;  4MMX B;  3X41 A;  3FSD A;  3J7Y d;  3MPH A;  2XSH B;  4XBY A;  4IIA A;  3CPW 2;  4R9K A;  1IQY A;  3EBY A;  1LNH A;  1WMN A;  3EBT A;  5IER A;  1C7H A;  2XH9 A;  3K5T A;  2E2V A;  1TP6 A;  3S67 A;  3OWU A;  3CCQ 3;  3E99 A;  1QMA A;  2CWT A;  1SII A;  3JVC A;  3K0Z A;  1RRL A;  1AV4 A;  1A2V A;  3S27 A;  3FF0 A;  4MJD A;  3X3X A;  3NQZ A;  1Q42 A;  5IG3 A;  1KQS 2;  2OTL 3;  1FGO A;  4HM0 B;  1R4C A;  5CXO A;  2R4I A;  2GBX B;  2BHM A;  3X3Z A;  2W56 A;  1FGT A;  3FGY A;  1ISK A;  1FGR A;  1FA3 A;  1J2B A;  1NU3 A;  1VQ5 3;  3DGO A;  3GAX A;  1OPY A;  1YHQ 3;  1OAC A;  1JV2 B;  1MNL A;  1VQ7 3;  1Z1S A;  1KC8 4;  3WMD A;  2CFD A;  4O3V A;  1DVC A;  2K54 A;  4HZ9 B;  4HJL B;  3G8Z A;  4ZM8 A;  1YIT 3;  3UB1 A;  1GY7 A;  3G0K A;  3EE1 A;  4HM6 B;  2IMJ A;  2O9U X;  3LYG A;  3MG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...