1W00A

Crystal structure of mutant enzyme d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
124
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
molecule keywords STEROID DELTA-ISOMERASE
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 124
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w00A00
3ROBA 5D83A 4WWUC 4L8PA 3VGNA 1OGZA 3H51A 4HKVB 5G2GA 4HM6B 3JUQA 5JPPA 1UUWB 3DMCA 3FH1A 4HZBB 4R1KA 3JUOA 1GY7A 5STDA 3OWYA 2YFLB 3NV0A 1E3VA 5IG0A 1OGXA 4R9LA 1K41A 3F7SA 3EQQB 4ORLA 3HK4A 2F86B 4HM2B 2BMOB 1Q42A 1OHSA 3S5CA 3BB9A 4HM4B 1O7NB 4XB5A 3EN1B 1O7GB 5CLKA 3F14A 4HVNA 1NU3A 5TGNA 5AEUB 4Q53A 3EBYA 3GZRA 2Z7AA 4GB5A 3FLJA 3DM8A 1OF5B 3B4OA 1GY6A 3OXAA 1Q40A 5CF1A 1O7HB 2HMLB 3T8NA 1W01A 1UUVB 3FF2A 5CXOA 3JUPA 3KE7A 5AI1A 3JUMA 3MSOA 2STDA 3LYGA 3SOAA 1GS3A 4XDVA 4WYKB 2HMKB 3M8CA 4J9AA 4LEHA 5BXQA 1CQSA 4FCJA 4L7KA 2RGQA 2YFIB 2XSHB 3DZLA 3GZYB 3CNMA 4PEJA 1JN5B 4K1UA 5KP4A 2PZVA 1ASKA 2XSOB 5KP3A 3FKAA 3WMDA 4X2OA 2B1XB 4KVHA 1OHOA 4HM5B 2GBWB 1TUHA 3RGRA 4WP5A 2CHCA 2K54A 5AIIA 1WQLB 3KSPA 3ECFA 3BLZA 4RZMA 4XBYA 2Z76A 5AEWB 3G16A 1O7MB 1W02A 3B8LA 3T8UA 6STDA 5KP1A 1QMAA 3H3HA 3F7XA 3FGYA 4LGQA 3OX9A 5FW5A 3NUVA 4LMIA 4HJLB 5IENA 2Z77A 1EG9B 1OPYA 5IG5A 2GBXB 5BVBA 1JB4A 4XM4A 3GZBA 1DMQA 3GRDA 5DREA 4L8OA 1OUNA 1ULIB 2I9WA 2BMRB 4U13A 4HM7B 2RFRA 1W00A 3B7CA 7STDA 4FCMA 1ISKA 2UX0A 1AR0A 2BMQB 2QIYA 2XR8B 1JB2A 3JUNA 4R9KA 1C7HA 3NV0B 2HMJB 3MKIA 2JQ5A 3G0KA 2A15A 1A2KA 4STDA 1ULJB 4I4KA 1JKGB 5D82A 3NHXA 4HM0B 3OWSA 3E99A 3OWUA 4N3VA 1GYBA 1U5OA 1QJGA 4HM1B 2BNGA 3KKGA 3F40A 3F8XA 3G8ZA 1NDOB 5IEPA 3SOYA 3EJVA 3EBTA 1GY5A 3MG2A 3EC9A 4J8TA 4OUQA 3HX8A 2CKFB 3MG3A 4OVMA 1OH0A 3Q90A 2GXFA 5IERA 1IDPA 3F8HA 3FZWA 2GEYA 3K0ZA 2YFJB 4XBXA 1OF5A 3D9RA 1OHPA 3DXOA 3FSDA 3B4PA 5IG3A 2RCDA 3KZTA 5EVHA 3OV4A 3SEDA 3F9SA 3CNXA 3STDA 5IF6A 2IMJA 3K7CA 2OWPA 4HM8B 1W6YA 1VZZA 3MG1A 2QGUA 4IIAA 4K1VA 4WYKA 5AIFA 3UJMA 1JKGA 8CHOA 1STDA 1JB5A 1JN5A 1OCVA 1ZO2A 5CK6A 1ZX2A 4HM3B 3NXJA 3UNLA 3CPOA 1S5AA 2HMMB 3LZAA 3MYTA 5AIGA 3IPTA 2R4IA 1E97A 1BUQA 1EA2A 4HZ9B 1DMMA 1Z1SA 1HKXA 3DUKA 4H3UA 2F99A 3ER7A 4X2HA 1TP6A 5DRVA 3EN8A 3FF0A 3GZXB 2HMOB 1SJWA 5HGRA 3A76A 4XDWA 3I0YA 2W2CA 1NWWA 3NBRA 5IG4A 3EX9A 3CU3A 4MJDA 3NM2A 4CDLA 3EF8A 2F98A 4XBTA 1DMNA 3EHCA 5JPUA 2HMNB 2GEXA 2B24B 5IEOA 5CF2A 3VSYA 2XRXB 1Q40B 3MHEA 3RGAA 1E3RA 1O7WB 2INXA 5D81A 1O7PB 5AIHA 3HZPA 3GWRA
chains in the Genus database with same CATH superfamily
1JZDA 1YNVX 2ML6A 3ROBA 5D83A 1IVUA 3EE1A 3V98A 1W6GA 2D1WA 1K9M4 4TX4A 1RCLA 2KCDA 3NBJA 4WWUC 4L8PA 3VGNA 1SIIA 1OGZA 1QAKA 2CFWA 3AGNA 3H51A 3N9HA 4GHOA 1EQKA 3CD63 4HKVB 1VQP3 3CME3 1IQYA 5G2GA 4HM6B 3JUQA 5AYRB 1KC84 1GMRA 3CCJ3 4LSOA 1RGKA 5JPPA 1UUWB 3DMCA 2SBLA 3K9MC 3NM7A 4FR9A 3FH1A 4BTXA 3AHWA 2YX9A 4HZBB 4R1KA 5JBSA 1BIRA 1IT8A 3JUOA 3LH4A 1GY7A 5STDA 4EW5A 4ZM8A 7RNTA 4BL3A 3UB1A 2K0MA 3OWYA 3AMOA 3LXUX 1RCKA 2YFLB 2WO0A 1UW1A 2H0HA 2GSPA 1ZGXA 3NV0A 1W2ZA 3SX1A 3BIRA 5HOHA 3X42A 2V1LA 1BANA 1E3VA 2W0QA 3PYJA 1IVWA 2L1SA 5IG0A 1OGXA 4R9LA 1SPUA 2L4VA 1K41A 1MOLA 3F7SA 4GL6A 1WTHA 3EQQB 3NQZA 4RNYA 9RNTA 1BSEA 1RNBA 1RTUA 1LQMB 1K8A4 5EEOA 3D5IA 1RGHA 3KFQC 2W9PA 1LQGC 4ORLA 3OW22 1T5YA 3HK4A 4QWTA 2F86B 4HM2B 2BMOB 1Q42A 4WHAA 3X3ZA 1BSAA 1OHSA 1B2XA 1I2GA 3WOEB 3CCV3 2P09A 3S5CA 1M1K4 1QVF2 3BB9A 3LTDA 4HM4B 1O7NB 4XB5A 3BNDA 4HBRA 3IJEB 1IYYA 3EN1B 3WODG 1O7GB 2KF4A 3A5EA 2KF5A 6RNTA 5CLKA 3F14A 4HVNA 1NU3A 2KRTA 1JBRA 1I0VA 2HOHA 5TGNA 4KZ1A 1SIHA 1MNLA 3NX0A 1RGAA 5AEUB 1BGSA 2OQEC 1PU4A 3I563 3BU4A 3WA2X 4Q53A 3EBYA 1VQ63 3GZRA 2O9UX 2Z7AA 4GB5A 1YIJ3 1DETA 3SLUA 3CMA3 3FLJA 3GAXA 3DM8A 1OF5B 3B4OA 1GY6A 3G713 2Z6BA 1IQXA 1UCKA 1V58A 3OXAA 3CXC2 1Q40A 2JDIH 5CF1A 1FGRA 1EKMA 4J5GA 1O7HB 1BRSA 2HMLB 3T8NA 4JRFA 1V74A 1G0TA 2F56A 1W01A 2MF7A 1UUVB 3FF2A 3K63A 5CXOA 5GSPA 3WA3A 1N5HA 2P05A 5FGOA 2BO9B 2BIRA 3AGOA 3JUPA 5I97A 1LVNA 1BNGA 3KE7A 5AI1A 3CCR3 3JUMA 3WOFB 2C11A 1Q824 3FG3A 3MSOA 2STDA 1BSDA 1SARA 3D79A 3LYGA 3SOAA 4FMAA 1GS3A 4FCZA 2CFGA 3ZFZA 1IVVA 5LC6A 3UL6A 4XDVA 4WYKB 2HMKB 3M8CA 3QK9A 4N6TA 1KSIA 4N6OB 4N6MA 3FG4A 4J9AA 3WR2A 3CCM3 2CIUA 1W4NA 4LEHA 5BXQA 1T2IA 2OTL3 1LOYA 3D5GA 4K90B 1CQSA 1EEJA 1LOXA 1V57A 1VQQA 2F5MA 3L0RA 4FCJA 4FMBA 2WOFA 4L7KA 4MEIA 3PZWA 3U1WA 2RGQA 1WMOA 2YFIB 2XSHB 3DZLA 3GZYB 3CNMA 4PEJA 1JN5B 3D3LA 4K1UA 5AYSC 2RBIA 5KP4A 3V99A 1YHQ3 2PZVA 3DGMA 1BSBA 2M7OA 3FG1A 4RNTA 1ASKA 1LNHA 2XSOB 5KP3A 1RGLA 3FKAA 1FGMA 1RKYA 1I8VA 3WMDA 1UUGB 1T3BA 1TRQA 4X2OA 2B1XB 4KVHA 1OHOA 1VQM3 4HM5B 2GBWB 1Q7Y4 1TUHA 3RGRA 4O3VA 1BRGA 1BU4A 2ZA4A 2OCTA 4WP5A 4KT3B 2CHCA 2KF3A 1RN4A 2K54A 5AIIA 2KF6A 1WQLB 1UI7A 1D6YA 2LYXA 1IT7A 3V92A 4EV2A 1VQO3 2ZL8A 3KSPA 1UGHI 2CWVA 2GU1A 3ECFA 2AADA 3BLZA 3NQYA 3S27A 1BRNL 4AEQA 1KWIA 4RZMA 2MC8A 2J8XB 2UGIA 4BU4A 1BNFA 1MGWA 2RNTA 1YVBI 4XBYA 2XEPA 1BNEA 1YVSA 1I3IA 5EQLA 1KQS2 1AY7A 1CEWI 1PY3A 4ILFA 1WMPA 2Z76A 5AEWB 3MWZA 3G16A 3DGYA 1GOYA 1O7MB 1ROAA 1W02A 1DE3A 1CYUA 2FGTA 1GMQA 1UCJA 3B8LA 4N6V0 1FA3A 1Q7HA 4RNZA 3T8UA 2WOHA 6STDA 5KP1A 1QMAA 2QEX3 1B2SA 3CC73 1CH0A 3F7XA 3H3HA 3FGYA 3ALAA 1AQZA 4K61A 4LGQA 2SARA 3OX9A 5FW5A 3NUVA 3URPA 3G6E3 4LMIA 3X41A 1MWUA 3RDEA 4HJLB 5IENA 1QALA 1PFPA 1UCIA 2Z77A 3PS8A 1EG9B 1B3SA 1R4YA 1RHLA 2F5WA 2GU3A 3KSED 5LC7A 1D6ZA 1IV7A 3DGLA 3ZG0A 3CCE3 1OPYA 2OOVA 1RJOA 2CG1A 5G1KA 5IG5A 2ML5A 2GBXB 3CPW2 3GSPA 4AKYA 5AIHA 1NJI4 1A67A 2UUGC 5BVBA 1JB4A 1NNVA 4FMDA 2O3OA 4XM4A 1RGFA 1TU5A 3KN4A 3SVAA 1LXEA 1BNJA 1RN7A 3LTAA 2H0IA 3LTBA 1C54A 3GZBA 1DMQA 3GRDA 5DREA 4N6NB 3HIGA 4L8OA 2W9QA 1B2UA 1OUNA 1Q864 1UDII 4N6LA 1JNQA 1ULIB 4EXRA 2IY2A 3S67A 2I9WA 5A0OB 4O02B 3S29A 1FGTA 1VQ53 2BMRB 3N54B 1IU7A 1A2PA 1RGCA 3HI7A 4U13A 2BHMA 4HM7B 2RFRA 1W00A 1JRQA 1IK3A 1R4CA 2W56A 2LQVA 2E2TA 1HYFA 3B7CA 7STDA 1RRLA 4FCMA 1ISKA 2UX0A 2W6JH 3PXMA 5ELUA 1AR0A 2BMQB 2QIYA 1U8CB 2XR8B 3DGNA 1JB2A 3AMOB 3DY5A 3JUNA 1VQK3 4R9KA 1C7HA 3NV0B 2HMJB 3MKIA 2E2VA 2JQ5A 3BNEA 3G0KA 2A15A 4KFEA 3LT9A 1A2KA 4STDA 4O2HA 1ULJB 4I4KA 1YGWA 1UI8A 1JKGB 3CCU3 3KIIA 3T0UA 1DVDA 5BU4A 4LZIA 1MWSA 3LOYA 5D82A 3NHXA 4HM0B 3OWSA 1VQ73 1OACA 2K3DA 1HZ1A 2E2UA 1M1XB 4OK0A 3HOHA 3BNCA 3SXXA 7GSPA 1Q814 3E99A 3OWUA 4MMYB 1FW7A 1UGIA 1TFOA 1I2EA 3VF1A 4N3VA 2QA43 5M18A 1GOUA 1GYBA 1U5OA 1QVG2 4BTWA 3MPHA 2OQEA 1QJGA 3N8BA 3DGOA 2BNGA 4HM1B 2IUJA 4MMZB 2OTJ3 3KKGA 1TIJA 2BU4A 3F40A 3F8XA 3G8ZA 3QRDA 1NDOB 4BTYA 3DH2A 4H61A 4NHFA 3SOYA 5IEPA 1VQ83 3EJVA 2IA7A 3EBTA 3X3XA 1GY5A 2ZDJA 3MG2A 3EC9A 5ELJA 5BIRA 1W6CA 1LRAA 3LT8A 1YJN3 1RNTA 4J8TA 3Q3FA 4OUQA 3RNTA 2P38A 1DYUA 3NBBA 1TJDA 3HX8A 2CKFB 1SQWA 4HYZA 5M1AA 2WGQA 3MG3A 4OVMA 1OH0A 1W7CA 3Q90A 2IUKA 2GXFA 1ROVA 5IERA 4FMCA 1M904 1GD3A 1I70A 2ZHXB 1IDPA 1IV9A 2CFDA 3F8HA 3X40A 1Y4KA 1JBTA 3FZWA 1ZS7A 2XFTA 1NO3A 2GEYA 4R4KA 1DVCA 1FGOA 3K0ZA 4CJNA 1BRIA 2YFJB 4XBXA 1OF5A 4BIRA 3D9RA 1OHPA 2XGNA 3AHSA 1IQ8A 1B20A 1M9GA 1RMSA 1B21A 2KXGA 3LMLA 3DXOA 3FSDA 3B4PA 5IG3A 1LOWA 2RCDA 3KZTA 2CX1A 5EVHA 2Y73A 1RGEA 1I2FA 3Q2PA 1BOXA 1Q9EA 3OV4A 5M19A 3SEDA 1PYLA 2PNCA 3U97A 4HAAA 3X3YA 1S723 1N8R4 1RSNA 4MMXB 2CX0A 3F9SA 3CCQ3 1X1XA 3CNXA 3STDA 2CG0A 5IF6A 2IMJA 1MGRA 3K7CA 1UCLA 1G96A 3EB8A 2OWPA 4HM8B 4EC6A 4KFDA 1GOVA 1W6YA 1VZZA 4BL2A 2W04A 3ZG5A 2XFSA 3MG1A 1L5GB 2QGUA 2C4BA 4IIAA 1N9JA 4K1VA 1X1YA 4WYKA 5AIFA 1TRPA 1I3FA 1YJ93 1BRJA 1US1A 3UJMA 1JKGA 3K5TA 2KAAA 4DKIA 1G02A 1TTOA 1BUJA 3D4AA 1BRHA 1LOVA 8CHOA 1STDA 6GSPA 1AV4A 1YIT3 4CCVA 2IYJA 2XGLA 1MWRA 1RGGA 1N9EA 1JB5A 2CWTA 2Y74A 3KCHA 1JN5A 1IVXA 1OCVA 1ZO2A 1X1UA 3PGBA 4NREA 1RRHA 5CK6A 1YI23 1JZOA 2Q07A 1GMPA 1FYSA 1ZX2A 5G1LA 1F8NA 1A2VA 1N8QA 4HM3B 5RNTA 3NXJA 4G1MB 2CH9A 3UNLA 3CPOA 4GSPA 1S5AA 8RNTA 1YJW3 1JV2B 2HMMB 3LZAA 3MYTA 3S28A 4JF8A 4O8SA 5AIGA 3IPTA 2R4IA 3O8YA 3FCSB 1E97A 1A90A 1BUQA 4J5KA 1EA2A 2CWUA 3WDGB 4HZ9B 3CCS3 1WNHA 1DMMA 1Z1SA 1B2ZA 1AVLA 1HKXA 1AVKA 3DUKA 4EYCA 3CC23 4H3UA 1K28A 4EV5A 3IMAB 2FXTA 4CPKA 2RSXA 2F99A 1VQL3 4AKZA 1LNIA 1K734 1JBSA 3JVCA 3TDGA 3ER7A 3PCSA 2D42A 1FUSA 4X2HA 2CW9A 1TP6A 5DRVA 3EN8A 3FF0A 3GZXB 2FNQA 2HMOB 3SYUA 1SJWA 3UL5A 1BNSA 1W2B2 4I5QA 1KD14 1NB5I 5HGRA 2W03A 1RLSA 3Q1CA 1B27A 2P0MA 3A76A 4LYLB 1BNRA 4HOHA 4XDWA 1EUIC 3I0YA 1GD4A 1RDSA 1FUTA 2CFKA 1QAFA 3I553 1TFKA 1CYVA 2W2CA 2F4YA 3BNBA 4IT7A 1NWWA 3NBRA 1W5ZA 3EX9A 3CU3A 4KFFA 4MJDA 5IG4A 3NM2A 4CDLA 1FGQA 4IPBA 3CCL3 1JJ22 4WFOA 2BT3A 1VQN3 4NPBA 3EF8A 2CFLA 1I0XA 1VQ43 5IW9A 1X1WA 2F98A 1B2MA 1FZUA 3LTCA 4XBTA 1D6UA 1DMNA 1T2HA 3EHCA 2CK3H 5JPUA 3J7Yd 2CC3A 1VQ93 1RN1A 2HMNB 1FUWA 1NB3I 1WMNA 4R80A 2GEXA 1BRKA 2AAEA 2B24B 3PCRA 3HIIA 4RBNA 5IEOA 5CF2A 3VSYA 1J2BA 2XRXB 1BNIA 1BVIA 4EBGA 4N6UA 1Q40B 3CC43 3MHEA 2R41A 2OOVC 2XH9A 1BAOA 3RGAA 1E3RA 3WHOA 3G4S3 1MWTA 2P0XA 1YGEA 1GSPA 1N5PA 1O7WB 2C10A 2H0GA 2INXA 2XF3A 2W56B 1HU9A 1STFI 1O7PB 5D81A 2WGOA 1BSCA 3HZPA 3GWRA
chains in the Genus database with same CATH topology
2ML6A 3ROBA 5D83A 1IVUA 3EE1A 3V98A 1W6GA 2D1WA 1K9M4 4TX4A 2KCDA 3NBJA 4WWUC 4L8PA 3VGNA 1SIIA 1OGZA 1QAKA 2CFWA 3H51A 1EQKA 3N9HA 3CD63 4HKVB 1VQP3 3CME3 1IQYA 5G2GA 4HM6B 3JUQA 5AYRB 1KC84 3CCJ3 5JPPA 1UUWB 3DMCA 2SBLA 3K9MC 3NM7A 4FR9A 3FH1A 4BTXA 2YX9A 4HZBB 4R1KA 5JBSA 1IT8A 3JUOA 3LH4A 1GY7A 5STDA 4ZM8A 3UB1A 2K0MA 3OWYA 3AMOA 3LXUX 2YFLB 2WO0A 1UW1A 3NV0A 1W2ZA 3SX1A 3X42A 2V1LA 1E3VA 2W0QA 3PYJA 1IVWA 5IG0A 1VQK3 1OGXA 4R9LA 1SPUA 2L4VA 1K41A 1MOLA 3F7SA 4GL6A 1WTHA 3EQQB 3NQZA 4RNYA 1K8A4 5EEOA 3KFQC 2W9PA 4ORLA 3OW22 1T5YA 3HK4A 4QWTA 2F86B 4HM2B 2BMOB 1Q42A 4WHAA 3X3ZA 1OHSA 3WOEB 3CCV3 2P09A 3S5CA 1M1K4 1QVF2 3BB9A 3LTDA 4HM4B 1O7NB 4XB5A 3BNDA 4HBRA 3IJEB 3EN1B 3WODG 1O7GB 5CLKA 3F14A 4HVNA 1NU3A 2KRTA 5TGNA 4KZ1A 1SIHA 1MNLA 3NX0A 5AEUB 2OQEC 3I563 1PU4A 3WA2X 4Q53A 3EBYA 1VQ63 3GZRA 2O9UX 2Z7AA 4GB5A 1YIJ3 3CMA3 3SLUA 3FLJA 3GAXA 3DM8A 1OF5B 3B4OA 1GY6A 3G713 2Z6BA 1IQXA 3OXAA 3CXC2 1Q40A 2JDIH 5CF1A 1FGRA 1EKMA 1O7HB 2HMLB 3T8NA 4JRFA 1V74A 1W01A 2MF7A 1UUVB 3FF2A 3K63A 5CXOA 3WA3A 1N5HA 2P05A 5FGOA 2BO9B 3JUPA 5I97A 1LVNA 3KE7A 5AI1A 3CCR3 3JUMA 3WOFB 2C11A 3FG3A 3MSOA 2STDA 3LYGA 3SOAA 4FMAA 1GS3A 4FCZA 2CFGA 1IVVA 5LC6A 3UL6A 4XDVA 4WYKB 2HMKB 3M8CA 3QK9A 4N6TA 1KSIA 4N6OB 4N6MA 3FG4A 4J9AA 3CCM3 2CIUA 1W4NA 4LEHA 5BXQA 2OTL3 4K90B 1CQSA 1LOXA 4FMBA 4FCJA 4MEIA 3L0RA 4L7KA 3U1WA 2WOFA 3PZWA 2RGQA 1WMOA 2YFIB 2XSHB 3DZLA 3GZYB 3CNMA 4PEJA 1JN5B 3D3LA 4K1UA 5AYSC 5KP4A 1YHQ3 3V99A 2PZVA 3DGMA 3FG1A 2M7OA 1ASKA 1LNHA 2XSOB 5KP3A 3FKAA 1FGMA 1RKYA 3WMDA 4X2OA 2B1XB 4KVHA 1OHOA 1VQM3 4HM5B 2GBWB 1Q7Y4 1TUHA 3RGRA 4O3VA 2OCTA 4WP5A 2CHCA 2K54A 5AIIA 1WQLB 1UI7A 1D6YA 2LYXA 1IT7A 3V92A 4EV2A 1VQO3 2ZL8A 3KSPA 2CWVA 2GU1A 3ECFA 3BLZA 3NQYA 3S27A 4AEQA 1KWIA 4RZMA 2MC8A 1YVBI 4XBYA 2XEPA 5EQLA 1KQS2 1CEWI 1WMPA 2Z76A 5AEWB 3MWZA 3G16A 1O7MB 1ROAA 1W02A 1CYUA 2FGTA 4N6V0 3B8LA 1FA3A 4RNZA 3T8UA 2WOHA 6STDA 5KP1A 1QMAA 2QEX3 3CC73 3H3HA 3F7XA 4K61A 3FGYA 3ALAA 4LGQA 4LSOA 3G6E3 1Q824 3OX9A 5FW5A 3NUVA 4LMIA 3X41A 3RDEA 4HJLB 5IENA 1QALA 1PFPA 2Z77A 3PS8A 1EG9B 2GU3A 3KSED 5LC7A 1D6ZA 1IV7A 3DGLA 3CCE3 1OPYA 2OOVA 1RJOA 2CG1A 5IG5A 2ML5A 2GBXB 3CPW2 4AKYA 5AIHA 1NJI4 1A67A 5BVBA 1JB4A 4FMDA 4XM4A 2O3OA 1TU5A 3KN4A 3SVAA 1LXEA 1RN7A 3LTAA 3LTBA 3GZBA 1DMQA 3GRDA 5DREA 4N6NB 3HIGA 4L8OA 2W9QA 1OUNA 1Q864 4N6LA 1JNQA 1ULIB 4EXRA 3S67A 2I9WA 5A0OB 4O02B 3S29A 1FGTA 1VQ53 2BMRB 3N54B 1IU7A 3HI7A 4U13A 2BHMA 4HM7B 2RFRA 1W00A 1JRQA 1IK3A 1R4CA 2W56A 2LQVA 2E2TA 3B7CA 7STDA 1RRLA 4FCMA 1ISKA 2UX0A 2W6JH 3PXMA 5ELUA 1AR0A 2BMQB 2QIYA 1U8CB 2XR8B 3DGNA 1JB2A 3AMOB 3DY5A 3JUNA 4R9KA 1C7HA 3NV0B 2HMJB 3MKIA 2E2VA 2JQ5A 3BNEA 3G0KA 2A15A 4KFEA 3LT9A 1A2KA 4STDA 4O2HA 1ULJB 4I4KA 1UI8A 1JKGB 3CCU3 3KIIA 3T0UA 1DVDA 4LZIA 3LOYA 5D82A 3NHXA 4HM0B 3OWSA 1VQ73 1OACA 2E2UA 1M1XB 4OK0A 3BNCA 3SXXA 1Q814 3E99A 3OWUA 4MMYB 1TFOA 3VF1A 4N3VA 2QA43 1QVG2 1GYBA 1U5OA 4BTWA 3MPHA 2OQEA 1QJGA 3N8BA 3DGOA 2BNGA 4HM1B 2IUJA 4MMZB 2OTJ3 3KKGA 1TIJA 3QRDA 3F40A 3F8XA 3G8ZA 4BTYA 1NDOB 4H61A 4NHFA 5IEPA 3SOYA 1VQ83 3EJVA 2IA7A 3EBTA 3X3XA 1GY5A 2ZDJA 3MG2A 3EC9A 5ELJA 1W6CA 3LT8A 1YJN3 4J8TA 4OUQA 2P38A 1DYUA 3NBBA 3HX8A 2CKFB 1SQWA 4HYZA 2WGQA 3MG3A 4OVMA 1OH0A 1W7CA 3Q90A 2IUKA 2GXFA 1ROVA 5IERA 4FMCA 1M904 1GD3A 1IDPA 1IV9A 2CFDA 3F8HA 3X40A 1Y4KA 3FZWA 2XFTA 1NO3A 2GEYA 4R4KA 1DVCA 1FGOA 3K0ZA 2YFJB 4XBXA 1OF5A 3D9RA 1OHPA 2XGNA 1IQ8A 1M9GA 2KXGA 3LMLA 3DXOA 3FSDA 3B4PA 5IG3A 2RCDA 3KZTA 5EVHA 2Y73A 3Q2PA 3OV4A 3SEDA 2PNCA 1S723 3U97A 3X3YA 1N8R4 4MMXB 3F9SA 3CCQ3 3CNXA 3STDA 2CG0A 5IF6A 2IMJA 3K7CA 1G96A 3EB8A 2OWPA 4HM8B 4EC6A 4KFDA 1W6YA 1VZZA 2W04A 2XFSA 3MG1A 1L5GB 2QGUA 4IIAA 1N9JA 4K1VA 4WYKA 5AIFA 1YJ93 1US1A 3UJMA 1JKGA 3K5TA 8CHOA 1STDA 1YIT3 1AV4A 4CCVA 2XGLA 1N9EA 1JB5A 2CWTA 2Y74A 1JN5A 1IVXA 1OCVA 1ZO2A 3PGBA 4NREA 5CK6A 1RRHA 1YI23 2Q07A 1ZX2A 1F8NA 1A2VA 1N8QA 4HM3B 3NXJA 4G1MB 2CH9A 3UNLA 3CPOA 1S5AA 1YJW3 1JV2B 2HMMB 3LZAA 3MYTA 3S28A 4JF8A 4O8SA 5AIGA 3IPTA 2R4IA 3O8YA 3FCSB 1E97A 1A90A 1BUQA 1EA2A 2CWUA 3WDGB 4HZ9B 3CCS3 1WNHA 1DMMA 1Z1SA 1HKXA 1AVLA 4EYCA 1AVKA 3DUKA 3CC23 4H3UA 1K28A 4EV5A 3IMAB 2FXTA 2RSXA 2F99A 1VQL3 4AKZA 1K734 3JVCA 3TDGA 3ER7A 3PCSA 2D42A 4X2HA 2CW9A 1TP6A 5DRVA 3EN8A 3FF0A 3GZXB 2FNQA 2HMOB 1SJWA 3UL5A 1W2B2 1KD14 1NB5I 5HGRA 2W03A 3Q1CA 2P0MA 3A76A 4XDWA 3I0YA 1GD4A 2CFKA 1QAFA 3I553 1TFKA 1CYVA 2W2CA 3BNBA 4IT7A 1NWWA 3NBRA 1W5ZA 3EX9A 3CU3A 4KFFA 4MJDA 5IG4A 3NM2A 4CDLA 1FGQA 4IPBA 3CCL3 1JJ22 4WFOA 2BT3A 1VQN3 3EF8A 2CFLA 1VQ43 5IW9A 2F98A 3LTCA 4XBTA 1D6UA 1DMNA 3EHCA 2CK3H 5JPUA 3J7Yd 2CC3A 1VQ93 2HMNB 1FUWA 1NB3I 1WMNA 4R80A 2GEXA 3PCRA 2B24B 5IEOA 3HIIA 4RBNA 1J2BA 5CF2A 3VSYA 2XRXB 4EBGA 4N6UA 1Q40B 3CC43 3MHEA 2OOVC 2XH9A 3RGAA 1E3RA 3G4S3 2P0XA 1YGEA 1N5PA 1O7WB 2C10A 2INXA 2XF3A 2W56B 1HU9A 1STFI 1O7PB 5D81A 2WGOA 3HZPA 3GWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ROB A;  5D83 A;  4WWU C;  4L8P A;  3VGN A;  1OGZ A;  3H51 A;  4HKV B;  5G2G A;  4HM6 B;  3JUQ A;  5JPP A;  1UUW B;  3DMC A;  3FH1 A;  4HZB B;  4R1K A;  3JUO A;  1GY7 A;  5STD A;  3OWY A;  2YFL B;  3NV0 A;  1E3V A;  5IG0 A;  1OGX A;  4R9L A;  1K41 A;  3F7S A;  3EQQ B;  4ORL A;  3HK4 A;  2F86 B;  4HM2 B;  2BMO B;  1Q42 A;  1OHS A;  3S5C A;  3BB9 A;  4HM4 B;  1O7N B;  4XB5 A;  3EN1 B;  1O7G B;  5CLK A;  3F14 A;  4HVN A;  1NU3 A;  5TGN A;  5AEU B;  4Q53 A;  3EBY A;  3GZR A;  2Z7A A;  4GB5 A;  3FLJ A;  3DM8 A;  1OF5 B;  3B4O A;  1GY6 A;  3OXA A;  1Q40 A;  5CF1 A;  1O7H B;  2HML B;  3T8N A;  1W01 A;  1UUV B;  3FF2 A;  5CXO A;  3JUP A;  3KE7 A;  5AI1 A;  3JUM A;  3MSO A;  2STD A;  3LYG A;  3SOA A;  1GS3 A;  4XDV A;  4WYK B;  2HMK B;  3M8C A;  4J9A A;  4LEH A;  5BXQ A;  1CQS A;  4FCJ A;  4L7K A;  2RGQ A;  2YFI B;  2XSH B;  3DZL A;  3GZY B;  3CNM A;  4PEJ A;  1JN5 B;  4K1U A;  5KP4 A;  2PZV A;  1ASK A;  2XSO B;  5KP3 A;  3FKA A;  3WMD A;  4X2O A;  2B1X B;  4KVH A;  1OHO A;  4HM5 B;  2GBW B;  1TUH A;  3RGR A;  4WP5 A;  2CHC A;  2K54 A;  5AII A;  1WQL B;  3KSP A;  3ECF A;  3BLZ A;  4RZM A;  4XBY A;  2Z76 A;  5AEW B;  3G16 A;  1O7M B;  1W02 A;  3B8L A;  3T8U A;  6STD A;  5KP1 A;  1QMA A;  3H3H A;  3F7X A;  3FGY A;  4LGQ A;  3OX9 A;  5FW5 A;  3NUV A;  4LMI A;  4HJL B;  5IEN A;  2Z77 A;  1EG9 B;  1OPY A;  5IG5 A;  2GBX B;  5BVB A;  1JB4 A;  4XM4 A;  3GZB A;  1DMQ A;  3GRD A;  5DRE A;  4L8O A;  1OUN A;  1ULI B;  2I9W A;  2BMR B;  4U13 A;  4HM7 B;  2RFR A;  1W00 A;  3B7C A;  7STD A;  4FCM A;  1ISK A;  2UX0 A;  1AR0 A;  2BMQ B;  2QIY A;  2XR8 B;  1JB2 A;  3JUN A;  4R9K A;  1C7H A;  3NV0 B;  2HMJ B;  3MKI A;  2JQ5 A;  3G0K A;  2A15 A;  1A2K A;  4STD A;  1ULJ B;  4I4K A;  1JKG B;  5D82 A;  3NHX A;  4HM0 B;  3OWS A;  3E99 A;  3OWU A;  4N3V A;  1GYB A;  1U5O A;  1QJG A;  4HM1 B;  2BNG A;  3KKG A;  3F40 A;  3F8X A;  3G8Z A;  1NDO B;  5IEP A;  3SOY A;  3EJV A;  3EBT A;  1GY5 A;  3MG2 A;  3EC9 A;  4J8T A;  4OUQ A;  3HX8 A;  2CKF B;  3MG3 A;  4OVM A;  1OH0 A;  3Q90 A;  2GXF A;  5IER A;  1IDP A;  3F8H A;  3FZW A;  2GEY A;  3K0Z A;  2YFJ B;  4XBX A;  1OF5 A;  3D9R A;  1OHP A;  3DXO A;  3FSD A;  3B4P A;  5IG3 A;  2RCD A;  3KZT A;  5EVH A;  3OV4 A;  3SED A;  3F9S A;  3CNX A;  3STD A;  5IF6 A;  2IMJ A;  3K7C A;  2OWP A;  4HM8 B;  1W6Y A;  1VZZ A;  3MG1 A;  2QGU A;  4IIA A;  4K1V A;  4WYK A;  5AIF A;  3UJM A;  1JKG A;  8CHO A;  1STD A;  1JB5 A;  1JN5 A;  1OCV A;  1ZO2 A;  5CK6 A;  1ZX2 A;  4HM3 B;  3NXJ A;  3UNL A;  3CPO A;  1S5A A;  2HMM B;  3LZA A;  3MYT A;  5AIG A;  3IPT A;  2R4I A;  1E97 A;  1BUQ A;  1EA2 A;  4HZ9 B;  1DMM A;  1Z1S A;  1HKX A;  3DUK A;  4H3U A;  2F99 A;  3ER7 A;  4X2H A;  1TP6 A;  5DRV A;  3EN8 A;  3FF0 A;  3GZX B;  2HMO B;  1SJW A;  5HGR A;  3A76 A;  4XDW A;  3I0Y A;  2W2C A;  1NWW A;  3NBR A;  5IG4 A;  3EX9 A;  3CU3 A;  4MJD A;  3NM2 A;  4CDL A;  3EF8 A;  2F98 A;  4XBT A;  1DMN A;  3EHC A;  5JPU A;  2HMN B;  2GEX A;  2B24 B;  5IEO A;  5CF2 A;  3VSY A;  2XRX B;  1Q40 B;  3MHE A;  3RGA A;  1E3R A;  1O7W B;  2INX A;  5D81 A;  1O7P B;  5AIH A;  3HZP A;  3GWR A; 
#chains in the Genus database with same CATH topology
 1JZD A;  1YNV X;  2ML6 A;  3ROB A;  5D83 A;  1IVU A;  3EE1 A;  3V98 A;  1W6G A;  2D1W A;  1K9M 4;  4TX4 A;  1RCL A;  2KCD A;  3NBJ A;  4WWU C;  4L8P A;  3VGN A;  1SII A;  1OGZ A;  1QAK A;  2CFW A;  3AGN A;  3H51 A;  3N9H A;  4GHO A;  1EQK A;  3CD6 3;  4HKV B;  1VQP 3;  3CME 3;  1IQY A;  5G2G A;  4HM6 B;  3JUQ A;  5AYR B;  1KC8 4;  1GMR A;  3CCJ 3;  4LSO A;  1RGK A;  5JPP A;  1UUW B;  3DMC A;  2SBL A;  3K9M C;  3NM7 A;  4FR9 A;  3FH1 A;  4BTX A;  3AHW A;  2YX9 A;  4HZB B;  4R1K A;  5JBS A;  1BIR A;  1IT8 A;  3JUO A;  3LH4 A;  1GY7 A;  5STD A;  4EW5 A;  4ZM8 A;  7RNT A;  4BL3 A;  3UB1 A;  2K0M A;  3OWY A;  3AMO A;  3LXU X;  1RCK A;  2YFL B;  2WO0 A;  1UW1 A;  2H0H A;  2GSP A;  1ZGX A;  3NV0 A;  1W2Z A;  3SX1 A;  3BIR A;  5HOH A;  3X42 A;  2V1L A;  1BAN A;  1E3V A;  2W0Q A;  3PYJ A;  1IVW A;  2L1S A;  5IG0 A;  1OGX A;  4R9L A;  1SPU A;  2L4V A;  1K41 A;  1MOL A;  3F7S A;  4GL6 A;  1WTH A;  3EQQ B;  3NQZ A;  4RNY A;  9RNT A;  1BSE A;  1RNB A;  1RTU A;  1LQM B;  1K8A 4;  5EEO A;  3D5I A;  1RGH A;  3KFQ C;  2W9P A;  1LQG C;  4ORL A;  3OW2 2;  1T5Y A;  3HK4 A;  4QWT A;  2F86 B;  4HM2 B;  2BMO B;  1Q42 A;  4WHA A;  3X3Z A;  1BSA A;  1OHS A;  1B2X A;  1I2G A;  3WOE B;  3CCV 3;  2P09 A;  3S5C A;  1M1K 4;  1QVF 2;  3BB9 A;  3LTD A;  4HM4 B;  1O7N B;  4XB5 A;  3BND A;  4HBR A;  3IJE B;  1IYY A;  3EN1 B;  3WOD G;  1O7G B;  2KF4 A;  3A5E A;  2KF5 A;  6RNT A;  5CLK A;  3F14 A;  4HVN A;  1NU3 A;  2KRT A;  1JBR A;  1I0V A;  2HOH A;  5TGN A;  4KZ1 A;  1SIH A;  1MNL A;  3NX0 A;  1RGA A;  5AEU B;  1BGS A;  2OQE C;  1PU4 A;  3I56 3;  3BU4 A;  3WA2 X;  4Q53 A;  3EBY A;  1VQ6 3;  3GZR A;  2O9U X;  2Z7A A;  4GB5 A;  1YIJ 3;  1DET A;  3SLU A;  3CMA 3;  3FLJ A;  3GAX A;  3DM8 A;  1OF5 B;  3B4O A;  1GY6 A;  3G71 3;  2Z6B A;  1IQX A;  1UCK A;  1V58 A;  3OXA A;  3CXC 2;  1Q40 A;  2JDI H;  5CF1 A;  1FGR A;  1EKM A;  4J5G A;  1O7H B;  1BRS A;  2HML B;  3T8N A;  4JRF A;  1V74 A;  1G0T A;  2F56 A;  1W01 A;  2MF7 A;  1UUV B;  3FF2 A;  3K63 A;  5CXO A;  5GSP A;  3WA3 A;  1N5H A;  2P05 A;  5FGO A;  2BO9 B;  2BIR A;  3AGO A;  3JUP A;  5I97 A;  1LVN A;  1BNG A;  3KE7 A;  5AI1 A;  3CCR 3;  3JUM A;  3WOF B;  2C11 A;  1Q82 4;  3FG3 A;  3MSO A;  2STD A;  1BSD A;  1SAR A;  3D79 A;  3LYG A;  3SOA A;  4FMA A;  1GS3 A;  4FCZ A;  2CFG A;  3ZFZ A;  1IVV A;  5LC6 A;  3UL6 A;  4XDV A;  4WYK B;  2HMK B;  3M8C A;  3QK9 A;  4N6T A;  1KSI A;  4N6O B;  4N6M A;  3FG4 A;  4J9A A;  3WR2 A;  3CCM 3;  2CIU A;  1W4N A;  4LEH A;  5BXQ A;  1T2I A;  2OTL 3;  1LOY A;  3D5G A;  4K90 B;  1CQS A;  1EEJ A;  1LOX A;  1V57 A;  1VQQ A;  2F5M A;  3L0R A;  4FCJ A;  4FMB A;  2WOF A;  4L7K A;  4MEI A;  3PZW A;  3U1W A;  2RGQ A;  1WMO A;  2YFI B;  2XSH B;  3DZL A;  3GZY B;  3CNM A;  4PEJ A;  1JN5 B;  3D3L A;  4K1U A;  5AYS C;  2RBI A;  5KP4 A;  3V99 A;  1YHQ 3;  2PZV A;  3DGM A;  1BSB A;  2M7O A;  3FG1 A;  4RNT A;  1ASK A;  1LNH A;  2XSO B;  5KP3 A;  1RGL A;  3FKA A;  1FGM A;  1RKY A;  1I8V A;  3WMD A;  1UUG B;  1T3B A;  1TRQ A;  4X2O A;  2B1X B;  4KVH A;  1OHO A;  1VQM 3;  4HM5 B;  2GBW B;  1Q7Y 4;  1TUH A;  3RGR A;  4O3V A;  1BRG A;  1BU4 A;  2ZA4 A;  2OCT A;  4WP5 A;  4KT3 B;  2CHC A;  2KF3 A;  1RN4 A;  2K54 A;  5AII A;  2KF6 A;  1WQL B;  1UI7 A;  1D6Y A;  2LYX A;  1IT7 A;  3V92 A;  4EV2 A;  1VQO 3;  2ZL8 A;  3KSP A;  1UGH I;  2CWV A;  2GU1 A;  3ECF A;  2AAD A;  3BLZ A;  3NQY A;  3S27 A;  1BRN L;  4AEQ A;  1KWI A;  4RZM A;  2MC8 A;  2J8X B;  2UGI A;  4BU4 A;  1BNF A;  1MGW A;  2RNT A;  1YVB I;  4XBY A;  2XEP A;  1BNE A;  1YVS A;  1I3I A;  5EQL A;  1KQS 2;  1AY7 A;  1CEW I;  1PY3 A;  4ILF A;  1WMP A;  2Z76 A;  5AEW B;  3MWZ A;  3G16 A;  3DGY A;  1GOY A;  1O7M B;  1ROA A;  1W02 A;  1DE3 A;  1CYU A;  2FGT A;  1GMQ A;  1UCJ A;  3B8L A;  4N6V 0;  1FA3 A;  1Q7H A;  4RNZ A;  3T8U A;  2WOH A;  6STD A;  5KP1 A;  1QMA A;  2QEX 3;  1B2S A;  3CC7 3;  1CH0 A;  3F7X A;  3H3H A;  3FGY A;  3ALA A;  1AQZ A;  4K61 A;  4LGQ A;  2SAR A;  3OX9 A;  5FW5 A;  3NUV A;  3URP A;  3G6E 3;  4LMI A;  3X41 A;  1MWU A;  3RDE A;  4HJL B;  5IEN A;  1QAL A;  1PFP A;  1UCI A;  2Z77 A;  3PS8 A;  1EG9 B;  1B3S A;  1R4Y A;  1RHL A;  2F5W A;  2GU3 A;  3KSE D;  5LC7 A;  1D6Z A;  1IV7 A;  3DGL A;  3ZG0 A;  3CCE 3;  1OPY A;  2OOV A;  1RJO A;  2CG1 A;  5G1K A;  5IG5 A;  2ML5 A;  2GBX B;  3CPW 2;  3GSP A;  4AKY A;  5AIH A;  1NJI 4;  1A67 A;  2UUG C;  5BVB A;  1JB4 A;  1NNV A;  4FMD A;  2O3O A;  4XM4 A;  1RGF A;  1TU5 A;  3KN4 A;  3SVA A;  1LXE A;  1BNJ A;  1RN7 A;  3LTA A;  2H0I A;  3LTB A;  1C54 A;  3GZB A;  1DMQ A;  3GRD A;  5DRE A;  4N6N B;  3HIG A;  4L8O A;  2W9Q A;  1B2U A;  1OUN A;  1Q86 4;  1UDI I;  4N6L A;  1JNQ A;  1ULI B;  4EXR A;  2IY2 A;  3S67 A;  2I9W A;  5A0O B;  4O02 B;  3S29 A;  1FGT A;  1VQ5 3;  2BMR B;  3N54 B;  1IU7 A;  1A2P A;  1RGC A;  3HI7 A;  4U13 A;  2BHM A;  4HM7 B;  2RFR A;  1W00 A;  1JRQ A;  1IK3 A;  1R4C A;  2W56 A;  2LQV A;  2E2T A;  1HYF A;  3B7C A;  7STD A;  1RRL A;  4FCM A;  1ISK A;  2UX0 A;  2W6J H;  3PXM A;  5ELU A;  1AR0 A;  2BMQ B;  2QIY A;  1U8C B;  2XR8 B;  3DGN A;  1JB2 A;  3AMO B;  3DY5 A;  3JUN A;  1VQK 3;  4R9K A;  1C7H A;  3NV0 B;  2HMJ B;  3MKI A;  2E2V A;  2JQ5 A;  3BNE A;  3G0K A;  2A15 A;  4KFE A;  3LT9 A;  1A2K A;  4STD A;  4O2H A;  1ULJ B;  4I4K A;  1YGW A;  1UI8 A;  1JKG B;  3CCU 3;  3KII A;  3T0U A;  1DVD A;  5BU4 A;  4LZI A;  1MWS A;  3LOY A;  5D82 A;  3NHX A;  4HM0 B;  3OWS A;  1VQ7 3;  1OAC A;  2K3D A;  1HZ1 A;  2E2U A;  1M1X B;  4OK0 A;  3HOH A;  3BNC A;  3SXX A;  7GSP A;  1Q81 4;  3E99 A;  3OWU A;  4MMY B;  1FW7 A;  1UGI A;  1TFO A;  1I2E A;  3VF1 A;  4N3V A;  2QA4 3;  5M18 A;  1GOU A;  1GYB A;  1U5O A;  1QVG 2;  4BTW A;  3MPH A;  2OQE A;  1QJG A;  3N8B A;  3DGO A;  2BNG A;  4HM1 B;  2IUJ A;  4MMZ B;  2OTJ 3;  3KKG A;  1TIJ A;  2BU4 A;  3F40 A;  3F8X A;  3G8Z A;  3QRD A;  1NDO B;  4BTY A;  3DH2 A;  4H61 A;  4NHF A;  3SOY A;  5IEP A;  1VQ8 3;  3EJV A;  2IA7 A;  3EBT A;  3X3X A;  1GY5 A;  2ZDJ A;  3MG2 A;  3EC9 A;  5ELJ A;  5BIR A;  1W6C A;  1LRA A;  3LT8 A;  1YJN 3;  1RNT A;  4J8T A;  3Q3F A;  4OUQ A;  3RNT A;  2P38 A;  1DYU A;  3NBB A;  1TJD A;  3HX8 A;  2CKF B;  1SQW A;  4HYZ A;  5M1A A;  2WGQ A;  3MG3 A;  4OVM A;  1OH0 A;  1W7C A;  3Q90 A;  2IUK A;  2GXF A;  1ROV A;  5IER A;  4FMC A;  1M90 4;  1GD3 A;  1I70 A;  2ZHX B;  1IDP A;  1IV9 A;  2CFD A;  3F8H A;  3X40 A;  1Y4K A;  1JBT A;  3FZW A;  1ZS7 A;  2XFT A;  1NO3 A;  2GEY A;  4R4K A;  1DVC A;  1FGO A;  3K0Z A;  4CJN A;  1BRI A;  2YFJ B;  4XBX A;  1OF5 A;  4BIR A;  3D9R A;  1OHP A;  2XGN A;  3AHS A;  1IQ8 A;  1B20 A;  1M9G A;  1RMS A;  1B21 A;  2KXG A;  3LML A;  3DXO A;  3FSD A;  3B4P A;  5IG3 A;  1LOW A;  2RCD A;  3KZT A;  2CX1 A;  5EVH A;  2Y73 A;  1RGE A;  1I2F A;  3Q2P A;  1BOX A;  1Q9E A;  3OV4 A;  5M19 A;  3SED A;  1PYL A;  2PNC A;  3U97 A;  4HAA A;  3X3Y A;  1S72 3;  1N8R 4;  1RSN A;  4MMX B;  2CX0 A;  3F9S A;  3CCQ 3;  1X1X A;  3CNX A;  3STD A;  2CG0 A;  5IF6 A;  2IMJ A;  1MGR A;  3K7C A;  1UCL A;  1G96 A;  3EB8 A;  2OWP A;  4HM8 B;  4EC6 A;  4KFD A;  1GOV A;  1W6Y A;  1VZZ A;  4BL2 A;  2W04 A;  3ZG5 A;  2XFS A;  3MG1 A;  1L5G B;  2QGU A;  2C4B A;  4IIA A;  1N9J A;  4K1V A;  1X1Y A;  4WYK A;  5AIF A;  1TRP A;  1I3F A;  1YJ9 3;  1BRJ A;  1US1 A;  3UJM A;  1JKG A;  3K5T A;  2KAA A;  4DKI A;  1G02 A;  1TTO A;  1BUJ A;  3D4A A;  1BRH A;  1LOV A;  8CHO A;  1STD A;  6GSP A;  1AV4 A;  1YIT 3;  4CCV A;  2IYJ A;  2XGL A;  1MWR A;  1RGG A;  1N9E A;  1JB5 A;  2CWT A;  2Y74 A;  3KCH A;  1JN5 A;  1IVX A;  1OCV A;  1ZO2 A;  1X1U A;  3PGB A;  4NRE A;  1RRH A;  5CK6 A;  1YI2 3;  1JZO A;  2Q07 A;  1GMP A;  1FYS A;  1ZX2 A;  5G1L A;  1F8N A;  1A2V A;  1N8Q A;  4HM3 B;  5RNT A;  3NXJ A;  4G1M B;  2CH9 A;  3UNL A;  3CPO A;  4GSP A;  1S5A A;  8RNT A;  1YJW 3;  1JV2 B;  2HMM B;  3LZA A;  3MYT A;  3S28 A;  4JF8 A;  4O8S A;  5AIG A;  3IPT A;  2R4I A;  3O8Y A;  3FCS B;  1E97 A;  1A90 A;  1BUQ A;  4J5K A;  1EA2 A;  2CWU A;  3WDG B;  4HZ9 B;  3CCS 3;  1WNH A;  1DMM A;  1Z1S A;  1B2Z A;  1AVL A;  1HKX A;  1AVK A;  3DUK A;  4EYC A;  3CC2 3;  4H3U A;  1K28 A;  4EV5 A;  3IMA B;  2FXT A;  4CPK A;  2RSX A;  2F99 A;  1VQL 3;  4AKZ A;  1LNI A;  1K73 4;  1JBS A;  3JVC A;  3TDG A;  3ER7 A;  3PCS A;  2D42 A;  1FUS A;  4X2H A;  2CW9 A;  1TP6 A;  5DRV A;  3EN8 A;  3FF0 A;  3GZX B;  2FNQ A;  2HMO B;  3SYU A;  1SJW A;  3UL5 A;  1BNS A;  1W2B 2;  4I5Q A;  1KD1 4;  1NB5 I;  5HGR A;  2W03 A;  1RLS A;  3Q1C A;  1B27 A;  2P0M A;  3A76 A;  4LYL B;  1BNR A;  4HOH A;  4XDW A;  1EUI C;  3I0Y A;  1GD4 A;  1RDS A;  1FUT A;  2CFK A;  1QAF A;  3I55 3;  1TFK A;  1CYV A;  2W2C A;  2F4Y A;  3BNB A;  4IT7 A;  1NWW A;  3NBR A;  1W5Z A;  3EX9 A;  3CU3 A;  4KFF A;  4MJD A;  5IG4 A;  3NM2 A;  4CDL A;  1FGQ A;  4IPB A;  3CCL 3;  1JJ2 2;  4WFO A;  2BT3 A;  1VQN 3;  4NPB A;  3EF8 A;  2CFL A;  1I0X A;  1VQ4 3;  5IW9 A;  1X1W A;  2F98 A;  1B2M A;  1FZU A;  3LTC A;  4XBT A;  1D6U A;  1DMN A;  1T2H A;  3EHC A;  2CK3 H;  5JPU A;  3J7Y d;  2CC3 A;  1VQ9 3;  1RN1 A;  2HMN B;  1FUW A;  1NB3 I;  1WMN A;  4R80 A;  2GEX A;  1BRK A;  2AAE A;  2B24 B;  3PCR A;  3HII A;  4RBN A;  5IEO A;  5CF2 A;  3VSY A;  1J2B A;  2XRX B;  1BNI A;  1BVI A;  4EBG A;  4N6U A;  1Q40 B;  3CC4 3;  3MHE A;  2R41 A;  2OOV C;  2XH9 A;  1BAO A;  3RGA A;  1E3R A;  3WHO A;  3G4S 3;  1MWT A;  2P0X A;  1YGE A;  1GSP A;  1N5P A;  1O7W B;  2C10 A;  2H0G A;  2INX A;  2XF3 A;  2W56 B;  1HU9 A;  1STF I;  1O7P B;  5D81 A;  2WGO A;  1BSC A;  3HZP A;  3GWR A; 
#chains in the Genus database with same CATH homology
 2ML6 A;  3ROB A;  5D83 A;  1IVU A;  3EE1 A;  3V98 A;  1W6G A;  2D1W A;  1K9M 4;  4TX4 A;  2KCD A;  3NBJ A;  4WWU C;  4L8P A;  3VGN A;  1SII A;  1OGZ A;  1QAK A;  2CFW A;  3H51 A;  1EQK A;  3N9H A;  3CD6 3;  4HKV B;  1VQP 3;  3CME 3;  1IQY A;  5G2G A;  4HM6 B;  3JUQ A;  5AYR B;  1KC8 4;  3CCJ 3;  5JPP A;  1UUW B;  3DMC A;  2SBL A;  3K9M C;  3NM7 A;  4FR9 A;  3FH1 A;  4BTX A;  2YX9 A;  4HZB B;  4R1K A;  5JBS A;  1IT8 A;  3JUO A;  3LH4 A;  1GY7 A;  5STD A;  4ZM8 A;  3UB1 A;  2K0M A;  3OWY A;  3AMO A;  3LXU X;  2YFL B;  2WO0 A;  1UW1 A;  3NV0 A;  1W2Z A;  3SX1 A;  3X42 A;  2V1L A;  1E3V A;  2W0Q A;  3PYJ A;  1IVW A;  5IG0 A;  1VQK 3;  1OGX A;  4R9L A;  1SPU A;  2L4V A;  1K41 A;  1MOL A;  3F7S A;  4GL6 A;  1WTH A;  3EQQ B;  3NQZ A;  4RNY A;  1K8A 4;  5EEO A;  3KFQ C;  2W9P A;  4ORL A;  3OW2 2;  1T5Y A;  3HK4 A;  4QWT A;  2F86 B;  4HM2 B;  2BMO B;  1Q42 A;  4WHA A;  3X3Z A;  1OHS A;  3WOE B;  3CCV 3;  2P09 A;  3S5C A;  1M1K 4;  1QVF 2;  3BB9 A;  3LTD A;  4HM4 B;  1O7N B;  4XB5 A;  3BND A;  4HBR A;  3IJE B;  3EN1 B;  3WOD G;  1O7G B;  5CLK A;  3F14 A;  4HVN A;  1NU3 A;  2KRT A;  5TGN A;  4KZ1 A;  1SIH A;  1MNL A;  3NX0 A;  5AEU B;  2OQE C;  3I56 3;  1PU4 A;  3WA2 X;  4Q53 A;  3EBY A;  1VQ6 3;  3GZR A;  2O9U X;  2Z7A A;  4GB5 A;  1YIJ 3;  3CMA 3;  3SLU A;  3FLJ A;  3GAX A;  3DM8 A;  1OF5 B;  3B4O A;  1GY6 A;  3G71 3;  2Z6B A;  1IQX A;  3OXA A;  3CXC 2;  1Q40 A;  2JDI H;  5CF1 A;  1FGR A;  1EKM A;  1O7H B;  2HML B;  3T8N A;  4JRF A;  1V74 A;  1W01 A;  2MF7 A;  1UUV B;  3FF2 A;  3K63 A;  5CXO A;  3WA3 A;  1N5H A;  2P05 A;  5FGO A;  2BO9 B;  3JUP A;  5I97 A;  1LVN A;  3KE7 A;  5AI1 A;  3CCR 3;  3JUM A;  3WOF B;  2C11 A;  3FG3 A;  3MSO A;  2STD A;  3LYG A;  3SOA A;  4FMA A;  1GS3 A;  4FCZ A;  2CFG A;  1IVV A;  5LC6 A;  3UL6 A;  4XDV A;  4WYK B;  2HMK B;  3M8C A;  3QK9 A;  4N6T A;  1KSI A;  4N6O B;  4N6M A;  3FG4 A;  4J9A A;  3CCM 3;  2CIU A;  1W4N A;  4LEH A;  5BXQ A;  2OTL 3;  4K90 B;  1CQS A;  1LOX A;  4FMB A;  4FCJ A;  4MEI A;  3L0R A;  4L7K A;  3U1W A;  2WOF A;  3PZW A;  2RGQ A;  1WMO A;  2YFI B;  2XSH B;  3DZL A;  3GZY B;  3CNM A;  4PEJ A;  1JN5 B;  3D3L A;  4K1U A;  5AYS C;  5KP4 A;  1YHQ 3;  3V99 A;  2PZV A;  3DGM A;  3FG1 A;  2M7O A;  1ASK A;  1LNH A;  2XSO B;  5KP3 A;  3FKA A;  1FGM A;  1RKY A;  3WMD A;  4X2O A;  2B1X B;  4KVH A;  1OHO A;  1VQM 3;  4HM5 B;  2GBW B;  1Q7Y 4;  1TUH A;  3RGR A;  4O3V A;  2OCT A;  4WP5 A;  2CHC A;  2K54 A;  5AII A;  1WQL B;  1UI7 A;  1D6Y A;  2LYX A;  1IT7 A;  3V92 A;  4EV2 A;  1VQO 3;  2ZL8 A;  3KSP A;  2CWV A;  2GU1 A;  3ECF A;  3BLZ A;  3NQY A;  3S27 A;  4AEQ A;  1KWI A;  4RZM A;  2MC8 A;  1YVB I;  4XBY A;  2XEP A;  5EQL A;  1KQS 2;  1CEW I;  1WMP A;  2Z76 A;  5AEW B;  3MWZ A;  3G16 A;  1O7M B;  1ROA A;  1W02 A;  1CYU A;  2FGT A;  4N6V 0;  3B8L A;  1FA3 A;  4RNZ A;  3T8U A;  2WOH A;  6STD A;  5KP1 A;  1QMA A;  2QEX 3;  3CC7 3;  3H3H A;  3F7X A;  4K61 A;  3FGY A;  3ALA A;  4LGQ A;  4LSO A;  3G6E 3;  1Q82 4;  3OX9 A;  5FW5 A;  3NUV A;  4LMI A;  3X41 A;  3RDE A;  4HJL B;  5IEN A;  1QAL A;  1PFP A;  2Z77 A;  3PS8 A;  1EG9 B;  2GU3 A;  3KSE D;  5LC7 A;  1D6Z A;  1IV7 A;  3DGL A;  3CCE 3;  1OPY A;  2OOV A;  1RJO A;  2CG1 A;  5IG5 A;  2ML5 A;  2GBX B;  3CPW 2;  4AKY A;  5AIH A;  1NJI 4;  1A67 A;  5BVB A;  1JB4 A;  4FMD A;  4XM4 A;  2O3O A;  1TU5 A;  3KN4 A;  3SVA A;  1LXE A;  1RN7 A;  3LTA A;  3LTB A;  3GZB A;  1DMQ A;  3GRD A;  5DRE A;  4N6N B;  3HIG A;  4L8O A;  2W9Q A;  1OUN A;  1Q86 4;  4N6L A;  1JNQ A;  1ULI B;  4EXR A;  3S67 A;  2I9W A;  5A0O B;  4O02 B;  3S29 A;  1FGT A;  1VQ5 3;  2BMR B;  3N54 B;  1IU7 A;  3HI7 A;  4U13 A;  2BHM A;  4HM7 B;  2RFR A;  1W00 A;  1JRQ A;  1IK3 A;  1R4C A;  2W56 A;  2LQV A;  2E2T A;  3B7C A;  7STD A;  1RRL A;  4FCM A;  1ISK A;  2UX0 A;  2W6J H;  3PXM A;  5ELU A;  1AR0 A;  2BMQ B;  2QIY A;  1U8C B;  2XR8 B;  3DGN A;  1JB2 A;  3AMO B;  3DY5 A;  3JUN A;  4R9K A;  1C7H A;  3NV0 B;  2HMJ B;  3MKI A;  2E2V A;  2JQ5 A;  3BNE A;  3G0K A;  2A15 A;  4KFE A;  3LT9 A;  1A2K A;  4STD A;  4O2H A;  1ULJ B;  4I4K A;  1UI8 A;  1JKG B;  3CCU 3;  3KII A;  3T0U A;  1DVD A;  4LZI A;  3LOY A;  5D82 A;  3NHX A;  4HM0 B;  3OWS A;  1VQ7 3;  1OAC A;  2E2U A;  1M1X B;  4OK0 A;  3BNC A;  3SXX A;  1Q81 4;  3E99 A;  3OWU A;  4MMY B;  1TFO A;  3VF1 A;  4N3V A;  2QA4 3;  1QVG 2;  1GYB A;  1U5O A;  4BTW A;  3MPH A;  2OQE A;  1QJG A;  3N8B A;  3DGO A;  2BNG A;  4HM1 B;  2IUJ A;  4MMZ B;  2OTJ 3;  3KKG A;  1TIJ A;  3QRD A;  3F40 A;  3F8X A;  3G8Z A;  4BTY A;  1NDO B;  4H61 A;  4NHF A;  5IEP A;  3SOY A;  1VQ8 3;  3EJV A;  2IA7 A;  3EBT A;  3X3X A;  1GY5 A;  2ZDJ A;  3MG2 A;  3EC9 A;  5ELJ A;  1W6C A;  3LT8 A;  1YJN 3;  4J8T A;  4OUQ A;  2P38 A;  1DYU A;  3NBB A;  3HX8 A;  2CKF B;  1SQW A;  4HYZ A;  2WGQ A;  3MG3 A;  4OVM A;  1OH0 A;  1W7C A;  3Q90 A;  2IUK A;  2GXF A;  1ROV A;  5IER A;  4FMC A;  1M90 4;  1GD3 A;  1IDP A;  1IV9 A;  2CFD A;  3F8H A;  3X40 A;  1Y4K A;  3FZW A;  2XFT A;  1NO3 A;  2GEY A;  4R4K A;  1DVC A;  1FGO A;  3K0Z A;  2YFJ B;  4XBX A;  1OF5 A;  3D9R A;  1OHP A;  2XGN A;  1IQ8 A;  1M9G A;  2KXG A;  3LML A;  3DXO A;  3FSD A;  3B4P A;  5IG3 A;  2RCD A;  3KZT A;  5EVH A;  2Y73 A;  3Q2P A;  3OV4 A;  3SED A;  2PNC A;  1S72 3;  3U97 A;  3X3Y A;  1N8R 4;  4MMX B;  3F9S A;  3CCQ 3;  3CNX A;  3STD A;  2CG0 A;  5IF6 A;  2IMJ A;  3K7C A;  1G96 A;  3EB8 A;  2OWP A;  4HM8 B;  4EC6 A;  4KFD A;  1W6Y A;  1VZZ A;  2W04 A;  2XFS A;  3MG1 A;  1L5G B;  2QGU A;  4IIA A;  1N9J A;  4K1V A;  4WYK A;  5AIF A;  1YJ9 3;  1US1 A;  3UJM A;  1JKG A;  3K5T A;  8CHO A;  1STD A;  1YIT 3;  1AV4 A;  4CCV A;  2XGL A;  1N9E A;  1JB5 A;  2CWT A;  2Y74 A;  1JN5 A;  1IVX A;  1OCV A;  1ZO2 A;  3PGB A;  4NRE A;  5CK6 A;  1RRH A;  1YI2 3;  2Q07 A;  1ZX2 A;  1F8N A;  1A2V A;  1N8Q A;  4HM3 B;  3NXJ A;  4G1M B;  2CH9 A;  3UNL A;  3CPO A;  1S5A A;  1YJW 3;  1JV2 B;  2HMM B;  3LZA A;  3MYT A;  3S28 A;  4JF8 A;  4O8S A;  5AIG A;  3IPT A;  2R4I A;  3O8Y A;  3FCS B;  1E97 A;  1A90 A;  1BUQ A;  1EA2 A;  2CWU A;  3WDG B;  4HZ9 B;  3CCS 3;  1WNH A;  1DMM A;  1Z1S A;  1HKX A;  1AVL A;  4EYC A;  1AVK A;  3DUK A;  3CC2 3;  4H3U A;  1K28 A;  4EV5 A;  3IMA B;  2FXT A;  2RSX A;  2F99 A;  1VQL 3;  4AKZ A;  1K73 4;  3JVC A;  3TDG A;  3ER7 A;  3PCS A;  2D42 A;  4X2H A;  2CW9 A;  1TP6 A;  5DRV A;  3EN8 A;  3FF0 A;  3GZX B;  2FNQ A;  2HMO B;  1SJW A;  3UL5 A;  1W2B 2;  1KD1 4;  1NB5 I;  5HGR A;  2W03 A;  3Q1C A;  2P0M A;  3A76 A;  4XDW A;  3I0Y A;  1GD4 A;  2CFK A;  1QAF A;  3I55 3;  1TFK A;  1CYV A;  2W2C A;  3BNB A;  4IT7 A;  1NWW A;  3NBR A;  1W5Z A;  3EX9 A;  3CU3 A;  4KFF A;  4MJD A;  5IG4 A;  3NM2 A;  4CDL A;  1FGQ A;  4IPB A;  3CCL 3;  1JJ2 2;  4WFO A;  2BT3 A;  1VQN 3;  3EF8 A;  2CFL A;  1VQ4 3;  5IW9 A;  2F98 A;  3LTC A;  4XBT A;  1D6U A;  1DMN A;  3EHC A;  2CK3 H;  5JPU A;  3J7Y d;  2CC3 A;  1VQ9 3;  2HMN B;  1FUW A;  1NB3 I;  1WMN A;  4R80 A;  2GEX A;  3PCR A;  2B24 B;  5IEO A;  3HII A;  4RBN A;  1J2B A;  5CF2 A;  3VSY A;  2XRX B;  4EBG A;  4N6U A;  1Q40 B;  3CC4 3;  3MHE A;  2OOV C;  2XH9 A;  3RGA A;  1E3R A;  3G4S 3;  2P0X A;  1YGE A;  1N5P A;  1O7W B;  2C10 A;  2INX A;  2XF3 A;  2W56 B;  1HU9 A;  1STF I;  1O7P B;  5D81 A;  2WGO A;  3HZP A;  3GWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...