1W00A

Crystal structure of mutant enzyme d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
124
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 124
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w00A00
1Q40A 3EJVA 3T8NA 1AR0A 1JN5B 2Z7AA 1A2KA 1C7HA 3ROBA 3HX8A 1ZO2A 3F7SA 3K7CA 5IF6A 4XBXA 5BXQA 4X2HA 3FSDA 4R9KA 4HJLB 3KE7A 3E99A 3HZPA 3EBYA 3F8XA 5DRVA 5JPPA 1OPYA 1WQLB 2YFJB 2YFLB 3FKAA 4HM2B 1E97A 2UX0A 4MJDA 1JKGA 2F99A 4L7KA 5IG3A 1ISKA 4R1KA 3GRDA 4LEHA 1GYBA 3UNLA 1DMNA 3IPTA 2XR8B 8CHOA 1OGXA 3OXAA 4HM1B 2RFRA 5BVBA 2RCDA 2INXA 1W00A 1QMAA 3WMDA 5D82A 2OWPA 3LZAA 1OHOA 2QIYA 2CHCA 3NV0B 4R9LA 4HM0B 5CF1A 5FW5A 3DUKA 2IMJA 1GY5A 3MG2A 3CNMA 5JPUA 1NWWA 4OVMA 3SOYA 1UUVB 5DREA 3ER7A 4HKVB 1O7GB 3F9SA 5IG5A 2HMMB 5IENA 3OWSA 5IEOA 3NXJA 1GY6A 4WWUC 4HM7B 4LGQA 1JN5A 2BNGA 1DMMA 3GZRA 3D9RA 3F8HA 1OH0A 4IIAA 3F14A 1ASKA 1OCVA 3CNXA 3B8LA 2STDA 4ORLA 3G8ZA 1OF5B 3CPOA 5D81A 3OWYA 3MSOA 3FLJA 3A76A 3G16A 1E3VA 3GZYB 3EC9A 5IG0A 1DMQA 3H3HA 3BLZA 3HK4A 4HVNA 3GZXB 5AIGA 3LYGA 2B24B 4HM8B 1JB4A 3KKGA 4XBYA 3S5CA 5IEPA 5AIHA 2HMKB 4GB5A 2XSOB 3DMCA 3RGAA 4U13A 3NV0A 4J9AA 5EVHA 1GS3A 1W6YA 1NDOB 2HMOB 3EF8A 4PEJA 2GEYA 3MHEA 3MG1A 4HM3B 4XDWA 3VGNA 2XRXB 3OX9A 5IG4A 5AEUB 3F40A 1EA2A 4STDA 1O7PB 3FZWA 6STDA 4RZMA 3B7CA 1W02A 3EN1B 2HMNB 3MYTA 3GWRA 3B4PA 1OUNA 1JKGB 4H3UA 5TGNA 3CU3A 1O7HB 4X2OA 5CK6A 1JB5A 1TUHA 1OF5A 3ECFA 3MG3A 4KVHA 5KP3A 3Q90A 3T8UA 2HMJB 4N3VA 3K0ZA 2XSHB 3NHXA 3JUNA 4FCMA 1ZX2A 3GZBA 5STDA 1SJWA 3F7XA 2JQ5A 3H51A 5CXOA 2F86B 5HGRA 4WP5A 3I0YA 1K41A 2YFIB 1OHSA 3JUPA 4FCJA 2I9WA 3VSYA 3SEDA 3EQQB 1CQSA 2F98A 2CKFB 2GBXB 7STDA 2BMRB 2GXFA 4LMIA 2GBWB 5AI1A 4WYKB 2R4IA 1BUQA 4J8TA 3DM8A 3FH1A 3EN8A 1OGZA 3MKIA 5D83A 3NUVA 3DZLA 1Z1SA 5CLKA 3NBRA 4K1VA 1ULIB 1Q40B 5AIFA 4XBTA 3SOAA 3JUOA 1Q42A 4CDLA 5AEWB 4K1UA 2QGUA 4HZBB 5G2GA 4L8OA 4I4KA 3B4OA 2GEXA 3KSPA 4XDVA 3DXOA 1EG9B 1S5AA 3JUQA 4Q53A 4L8PA 2RGQA 4OUQA 3G0KA 4XB5A 1QJGA 1O7WB 3OV4A 5CF2A 2Z77A 1TP6A 4HM6B 2A15A 4HM4B 2W2CA 1VZZA 1HKXA 3M8CA 4XM4A 2K54A 1U5OA 1JB2A 5IERA 4HM5B 3EX9A 4HZ9B 5KP4A 3FF2A 5AIIA 2BMQB 1UUWB 3RGRA 5KP1A 3KZTA 1GY7A 3NM2A 3OWUA 1W01A 1STDA 1ULJB 1O7MB 3EBTA 3FF0A 2HMLB 4WYKA 2Z76A 1O7NB 3JUMA 1OHPA 1NU3A 1E3RA 2B1XB 3BB9A 2PZVA 3EHCA 1IDPA 3STDA 2BMOB 3FGYA 3UJMA
chains in the Genus database with same CATH superfamily
2E2VA 1Q40A 3EJVA 3UL5A 1VQ43 1AVKA 1RGLA 2W6JH 4G1MB 1VQM3 2PNCA 1AR0A 1FGQA 3S28A 3T8NA 1JN5B 1B2ZA 2Z7AA 1A2KA 3RDEA 1C7HA 1MWUA 1LOWA 1ZGXA 3ROBA 3LOYA 1BRSA 1RGAA 1IQYA 1W7CA 1ROVA 2FGTA 3HX8A 1B2MA 1ZO2A 3F7SA 1HZ1A 2V1LA 3K7CA 1LNHA 3WR2A 4GSPA 5IF6A 2CWTA 3DY5A 4XBXA 5ELJA 5BU4A 5BXQA 1BNRA 4CJNA 1IK3A 2BIRA 4X2HA 2KF3A 1BOXA 3S67A 3FSDA 4R9KA 4HJLB 2YX9A 3G6E3 3KE7A 1X1YA 3E99A 3HZPA 3EBYA 3CC73 3F8XA 1LRAA 3Q3FA 3CCU3 1WMOA 5DRVA 2F56A 5HOHA 5JPPA 4CCVA 1BUJA 4NHFA 1OPYA 1WQLB 1GD3A 2BT3A 2YFJB 5M18A 1DVDA 2YFLB 3FKAA 1YGEA 4HM2B 1V57A 1BSEA 4HAAA 3DGYA 2LYXA 2BO9B 1E97A 3Q1CA 3NBJA 4KFDA 4N6V0 1W4NA 4LZIA 2KAAA 1BSCA 2UX0A 1EEJA 1GSPA 2FXTA 1N9EA 1B21A 1RRHA 4K61A 1JKGA 2F99A 3O8YA 4L7KA 4MJDA 5IG3A 1YHQ3 1ISKA 3CME3 1M904 1I3FA 3GRDA 4LEHA 1GYBA 4R1KA 1DMNA 2CX0A 2GU1A 3IPTA 2XR8B 3UNLA 8CHOA 1TIJA 1LQGC 1OGXA 2KF5A 5RNTA 1N8R4 2ZL8A 3D5IA 1Q7Y4 1HU9A 3OXAA 5G1KA 1IQ8A 3KN4A 4HM1B 4O02B 2RFRA 5BVBA 5M19A 1WMPA 2RCDA 2M7OA 2MF7A 2GU3A 4EC6A 2INXA 3LTDA 4FMBA 1VQ73 1YJ93 4LSOA 2GSPA 3HOHA 1MOLA 1W00A 1X1XA 1QMAA 3PXMA 2K0MA 2RNTA 1NNVA 3WMDA 1W6GA 4BIRA 5D82A 2Y73A 1TTOA 1GD4A 3UL6A 2J8XB 1GMQA 2OWPA 4AEQA 3WOEB 3CC23 3OW22 2OTJ3 1AY7A 3LZAA 1OHOA 2QIYA 1RDSA 2CHCA 3CCR3 1A2PA 3NV0B 2W56B 1BAOA 3IMAB 5LC6A 3DGLA 4R9LA 1RKYA 1EUIC 4HM0B 1US1A 5CF1A 1JBRA 2UUGC 1M9GA 5FW5A 3DUKA 3I563 2QEX3 2IMJA 1GY5A 3BU4A 3MG2A 1PFPA 1A2VA 1SPUA 3CNMA 2AADA 5JPUA 1NWWA 1BSBA 3D3LA 6GSPA 4EV2A 4OVMA 1FUWA 3SOYA 1JZOA 4CPKA 1QVF2 1UUVB 3HI7A 5DREA 3ER7A 4R4KA 4HKVB 1O7GB 3F9SA 1KQS2 4FMAA 2F4YA 3CPW2 3NM7A 1ZS7A 1FGRA 2CIUA 3WDGB 1VQK3 5IG5A 2HMMB 4K90B 5IENA 4BTWA 1VQL3 1BRNL 3OWSA 1UCIA 5IEOA 1GY6A 1GOVA 3MWZA 3NXJA 3L0RA 4MMXB 5JBSA 4WWUC 1RGKA 2P0XA 4HM7B 1FGOA 4LGQA 1JN5A 1W2ZA 1IQXA 1IV7A 4FCZA 2BNGA 2CFGA 3RNTA 1DMMA 3GZRA 1VQP3 1SQWA 2O3OA 1N5PA 3D9RA 3F8HA 1W6CA 2HOHA 3LTCA 4RBNA 2L1SA 4NREA 4EV5A 2ML6A 1BSAA 1D6UA 1FUTA 1OH0A 4IIAA 1AV4A 1RJOA 3F14A 5G1LA 3FG1A 3SVAA 1D6ZA 3WA3A 1ASKA 1SIIA 3AHSA 1JBSA 1UGHI 2CWUA 1OCVA 2L4VA 1UGIA 1YVBI 3CNXA 1PYLA 1WTHA 1RNBA 3BNDA 1I2EA 1NB3I 3B8LA 2STDA 4ORLA 3CCV3 1LOYA 1B20A 1RRLA 3ZFZA 2WOFA 3SYUA 3CC43 1JZDA 1QAFA 3G8ZA 1OF5B 3CPOA 3N8BA 3D79A 3OWYA 4QWTA 5D81A 3MSOA 1TRQA 3FLJA 1Q814 1BU4A 1PU4A 1TJDA 2KF4A 3KCHA 3A76A 2XEPA 3G16A 1NJI4 1E3VA 1IYYA 3LTBA 3D4AA 1LQMB 3GZYB 1A67A 3EC9A 1N9JA 3K5TA 2CG1A 3PZWA 4GL6A 5IG0A 1YJN3 3GAXA 1RGFA 1DMQA 4AKZA 3H3HA 1KWIA 4MMZB 1B27A 3BLZA 3HK4A 4HVNA 5BIRA 1J2BA 3GZXB 2C10A 5AIGA 1DVCA 3LYGA 3PCSA 1LVNA 1K8A4 2B24B 3VF1A 1DE3A 4GHOA 3FCSB 4FMDA 4HM8B 4N6TA 4BTYA 1LNIA 3DH2A 1JB4A 3KKGA 4XBYA 3WOFB 2RSXA 3S5CA 5IEPA 3V92A 5AIHA 2CFLA 2HMKB 1I3IA 4GB5A 3ZG0A 5FGOA 3AGNA 2XSOB 3DMCA 3DGNA 1IVWA 1VQ83 2FNQA 3RGAA 2P05A 4U13A 5IW9A 3CMA3 1NO3A 2WGOA 2W56A 3NV0A 2ZA4A 4J9AA 1I0XA 5EVHA 4O3VA 3HIIA 1GS3A 3X3ZA 1RCKA 1W6YA 1MGRA 4N6LA 1UCKA 1NDOB 2XF3A 1X1WA 2HMOB 3EF8A 1VQQA 3U1WA 3G4S3 1ROAA 1W5ZA 4PEJA 2GEYA 3MHEA 2IY2A 3BNEA 3SLUA 3MG1A 4N6NB 1AVLA 3PYJA 4HM3B 4FR9A 2W03A 4XDWA 2XRXB 2ZHXB 3VGNA 3T0UA 3LTAA 3OX9A 5IG4A 5AEUB 1T5YA 1JRQA 3F40A 1K28A 1EA2A 1GOYA 1MGWA 4STDA 1CYVA 3N9HA 1IVUA 1O7PB 3FZWA 1IT8A 6STDA 4BU4A 4RZMA 1RMSA 2KRTA 3AMOB 3NQZA 3B7CA 5AYRB 2MC8A 1BANA 1W02A 4JRFA 3EN1B 3KIIA 2HMNB 1BNFA 1WNHA 1RGHA 1X1UA 1TU5A 3MYTA 3GWRA 1FW7A 5I97A 4N6MA 2XFTA 4BL3A 1N8QA 3B4PA 1OUNA 2E2TA 3J7Yd 3K63A 2P09A 1YGWA 1MWSA 1JKGB 1TFKA 4H3UA 1BNIA 2LQVA 2OOVA 3TDGA 2CH9A 1YIT3 1R4YA 1CEWI 4BTXA 3MPHA 5TGNA 3CU3A 3I553 1I2FA 5GSPA 3CCQ3 3SXXA 1FGTA 1WMNA 1B3SA 1YNVX 3LMLA 1EKMA 1W2B2 1O7HB 2CWVA 1YIJ3 3EE1A 4X2OA 5CK6A 1JB5A 1TUHA 2C4BA 2KF6A 1OF5A 5ELUA 3ECFA 3MG3A 1Q824 4KVHA 5KP3A 1RLSA 3Q90A 3T8UA 1DETA 2HMJB 1BIRA 3K0ZA 4N3VA 2IUJA 3X40A 2SARA 2D1WA 2XSHB 4MEIA 3NHXA 1IVXA 2KCDA 3JUNA 3A5EA 4KFFA 1U8CB 1OACA 3LT8A 3K9MC 1UI7A 3QRDA 1T3BA 4NPBA 4RNTA 1S723 1YVSA 4FCMA 1RGEA 4N6OB 3V99A 1ZX2A 3NBBA 1Y4KA 4J5KA 3GZBA 2W04A 3LXUX 5STDA 2OQEC 1SJWA 1K734 1Q9EA 3F7XA 3IJEB 2JQ5A 3CCM3 1VQO3 1SARA 1I70A 3H51A 4R80A 5CXOA 2QA43 1LXEA 3FG4A 2F86B 3D5GA 5HGRA 3X41A 1FUSA 4WP5A 4WHAA 2C11A 3I0YA 6RNTA 1K41A 2YFIB 1OHSA 3JUPA 1JV2B 3DGOA 2H0HA 4FCJA 2I9WA 3VSYA 3AHWA 3CCJ3 2CW9A 1KC84 1JNQA 1BRIA 3PGBA 5EEOA 3SEDA 1UI8A 3EQQB 1BNGA 2IYJA 4RNYA 1CQSA 4O8SA 1DYUA 2F98A 2XGLA 3PCRA 1GMRA 4KZ1A 2CKFB 2GBXB 3X42A 4WFOA 1UUGB 2BMRB 3ALAA 2GXFA 2Q07A 7STDA 4LMIA 1F8NA 3EB8A 1M1K4 1RNTA 2GBWB 5M1AA 1UCLA 5AI1A 2R41A 4RNZA 4WYKB 1I0VA 1BRJA 3U97A 2R4IA 1QVG2 1BUQA 1FA3A 1QALA 1G96A 2ML5A 1UW1A 1TFOA 3DM8A 3FH1A 1STFI 3EN8A 4J8TA 2F5MA 3CXC2 2OQEA 1OGZA 4N6UA 2OCTA 3MKIA 5D83A 1KD14 1CH0A 2WGQA 3LH4A 1JJ22 3NUVA 2CK3H 4DKIA 1RCLA 3GSPA 1KSIA 2KXGA 3DZLA 1Z1SA 1IU7A 2F5WA 3NQYA 1BNEA 4MMYB 5CLKA 1GMPA 1B2SA 1T2HA 1HYFA 1FGMA 2WO0A 3NBRA 1MNLA 1PY3A 4I5QA 2OOVC 4K1VA 1ULIB 1Q40B 1UCJA 1RN4A 5AIFA 3AMOA 4XBTA 3SOAA 1B2XA 1I2GA 3JUOA 3BNBA 1Q42A 2E2UA 2K3DA 1AQZA 1FYSA 8RNTA 9RNTA 3UB1A 3CCE3 1Q864 4CDLA 4AKYA 3CCS3 4FMCA 5AEWB 2D42A 2H0IA 3CCL3 1VQ53 4JF8A 3NX0A 3URPA 2XGNA 2QGUA 4K1UA 4HZBB 4TX4A 2ZDJA 1LOVA 2BU4A 1L5GB 5G2GA 4L8OA 3DGMA 3AGOA 4I4KA 3X3YA 1BRHA 1V74A 1BRGA 1RGGA 1BNSA 3B4OA 4EW5A 2CC3A 2CFWA 2GEXA 1I8VA 3KSPA 1UDII 1BRKA 1D6YA 1GOUA 4XDVA 1TRPA 3SX1A 3DXOA 3WODG 1EG9B 1S5AA 1EQKA 3JUQA 1RN7A 2XH9A 4Q53A 4L8PA 2JDIH 1SIHA 3N54B 1FZUA 2RGQA 3KFQC 1A90A 1G0TA 3HIGA 3G0KA 4OUQA 2Y74A 4XB5A 1T2IA 1QJGA 3FG3A 3WHOA 1CYUA 1O7WB 2IUKA 1BVIA 3OV4A 2CX1A 5CF2A 2Z77A 1N5HA 4HYZA 1JBTA 1TP6A 4HM6B 4EXRA 2P38A 2A15A 2IA7A 4HM4B 1VQ93 3BIRA 3G713 4O2HA 2W2CA 5AYSC 1VZZA 2CFDA 1HKXA 3M8CA 4XM4A 4ZM8A 2K54A 1VQN3 4BL2A 1U5OA 2CFKA 1JB2A 4HOHA 3S29A 1C54A 5IERA 2SBLA 2BHMA 4H61A 1RSNA 3BNCA 4HM5B 2UGIA 3EX9A 4IPBA 4HZ9B 2H0GA 2W9PA 4J5GA 5KP4A 2O9UX 3FF2A 1YJW3 5AIIA 1NB5I 2BMQB 1UUWB 3X3XA 1YI23 1G02A 1RGCA 3JVCA 4KT3B 4OK0A 4KFEA 1BNJA 1BGSA 3RGRA 1Q7HA 3PS8A 5KP1A 1M1XB 3KZTA 3ZG5A 4HBRA 1GY7A 1LOXA 3V98A 1RN1A 3NM2A 4EYCA 3OWUA 1B2UA 1W01A 2W9QA 4ILFA 2P0MA 2WOHA 4LYLB 1STDA 1RTUA 1ULJB 1O7MB 3EBTA 3FF0A 2HMLB 2OTL3 5LC7A 2RBIA 2CG0A 3LT9A 7RNTA 1MWRA 3KSED 3CD63 3WA2X 2XFSA 3QK9A 4WYKA 3S27A 1MWTA 2Z76A 7GSPA 1O7NB 3JUMA 1OHPA 1IV9A 1NU3A 5A0OB 2AAEA 5EQLA 4IT7A 1V58A 1VQ63 2W0QA 2Z6BA 1QAKA 1E3RA 2B1XB 3BB9A 2PZVA 3EHCA 1R4CA 4EBGA 1IDPA 3STDA 1RHLA 2BMOB 3FGYA 3Q2PA 3UJMA 1BSDA 1IVVA 1IT7A 1K9M4
chains in the Genus database with same CATH topology
2E2VA 1Q40A 3EJVA 3UL5A 1VQ43 1AVKA 2W6JH 4G1MB 1VQM3 2PNCA 1AR0A 1FGQA 3S28A 3T8NA 1JN5B 2Z7AA 1A2KA 3RDEA 1C7HA 3ROBA 3LOYA 1IQYA 1W7CA 1ROVA 2FGTA 3HX8A 1ZO2A 3F7SA 2V1LA 3K7CA 1LNHA 5IF6A 2CWTA 3DY5A 4XBXA 5ELJA 5BXQA 1IK3A 4X2HA 3S67A 3FSDA 4R9KA 4HJLB 2YX9A 3G6E3 3KE7A 3E99A 3HZPA 3EBYA 3CC73 3F8XA 3CCU3 1WMOA 5DRVA 5JPPA 4CCVA 4NHFA 1OPYA 1WQLB 1GD3A 2BT3A 2YFJB 1DVDA 2YFLB 3FKAA 1YGEA 4HM2B 2LYXA 2BO9B 1E97A 3Q1CA 3NBJA 4KFDA 4N6V0 1W4NA 4LZIA 2UX0A 2FXTA 1N9EA 4K61A 1RRHA 4MJDA 1JKGA 2F99A 3O8YA 4L7KA 5IG3A 1YHQ3 1ISKA 3CME3 1M904 4R1KA 3GRDA 4LEHA 1GYBA 3UNLA 1DMNA 2GU1A 3IPTA 2XR8B 8CHOA 1TIJA 1OGXA 1N8R4 2ZL8A 1Q7Y4 1HU9A 3OXAA 1IQ8A 3KN4A 4HM1B 4O02B 2RFRA 5BVBA 1WMPA 2RCDA 2M7OA 2MF7A 2GU3A 4EC6A 2INXA 3LTDA 4FMBA 1VQ73 1YJ93 4LSOA 1MOLA 1W00A 1QMAA 3PXMA 2K0MA 3WMDA 1W6GA 5D82A 2Y73A 1GD4A 3UL6A 2OWPA 4AEQA 3WOEB 3CC23 3OW22 2OTJ3 3LZAA 1OHOA 2QIYA 2CHCA 3CCR3 3NV0B 2W56B 3IMAB 5LC6A 3DGLA 4R9LA 1RKYA 4HM0B 1US1A 5CF1A 5FW5A 1M9GA 3DUKA 3I563 2QEX3 2IMJA 1GY5A 3MG2A 1PFPA 1A2VA 1SPUA 3CNMA 5JPUA 1NWWA 3D3LA 4EV2A 4OVMA 1FUWA 3SOYA 1QVF2 1UUVB 3HI7A 5DREA 3ER7A 4R4KA 4HKVB 1O7GB 3F9SA 1KQS2 4FMAA 3CPW2 3NM7A 1FGRA 2CIUA 3WDGB 1VQK3 5IG5A 2HMMB 4K90B 5IENA 4BTWA 1VQL3 3OWSA 5IEOA 1GY6A 3MWZA 3NXJA 5JBSA 3L0RA 4MMXB 4WWUC 2P0XA 4HM7B 1FGOA 4LGQA 1JN5A 1W2ZA 1IQXA 1IV7A 4FCZA 2BNGA 2CFGA 1DMMA 3GZRA 1VQP3 1SQWA 2O3OA 1N5PA 3D9RA 3F8HA 1W6CA 3LTCA 4RBNA 4NREA 4EV5A 2ML6A 1D6UA 1OH0A 4IIAA 1AV4A 1RJOA 3F14A 3FG1A 3SVAA 1D6ZA 3WA3A 1ASKA 1SIIA 2CWUA 1OCVA 2L4VA 1YVBI 3CNXA 1WTHA 3BNDA 1NB3I 3B8LA 2STDA 4ORLA 3CCV3 1RRLA 2WOFA 3CC43 1QAFA 3G8ZA 1OF5B 3CPOA 3N8BA 4QWTA 3OWYA 5D81A 3MSOA 3FLJA 1Q814 1PU4A 3A76A 2XEPA 3G16A 1NJI4 1E3VA 3LTBA 3GZYB 1A67A 3EC9A 1N9JA 3K5TA 2CG1A 3PZWA 4GL6A 5IG0A 1YJN3 3GAXA 4AKZA 1DMQA 3H3HA 1KWIA 4MMZB 3BLZA 3HK4A 4HVNA 1J2BA 3GZXB 2C10A 5AIGA 1DVCA 3LYGA 3PCSA 1LVNA 1K8A4 2B24B 3VF1A 3FCSB 4FMDA 4HM8B 4N6TA 4BTYA 1JB4A 3KKGA 4XBYA 3WOFB 2RSXA 3S5CA 5IEPA 3V92A 5AIHA 2CFLA 2HMKB 4GB5A 5FGOA 2XSOB 3DMCA 3DGNA 1IVWA 1VQ83 2FNQA 3RGAA 2P05A 4U13A 5IW9A 3CMA3 1NO3A 2WGOA 2W56A 3NV0A 4J9AA 5EVHA 4O3VA 3HIIA 1GS3A 3X3ZA 1W6YA 4N6LA 1NDOB 2XF3A 2HMOB 3EF8A 3U1WA 3G4S3 1ROAA 1W5ZA 4PEJA 2GEYA 3MHEA 3BNEA 3SLUA 3MG1A 4N6NB 1AVLA 3PYJA 4HM3B 4FR9A 2W03A 4XDWA 2XRXB 3VGNA 3T0UA 3LTAA 3OX9A 5IG4A 5AEUB 1T5YA 1JRQA 3F40A 1K28A 1EA2A 4STDA 1CYVA 3N9HA 1IVUA 1O7PB 3FZWA 1IT8A 6STDA 4RZMA 2KRTA 3AMOB 3NQZA 3B7CA 5AYRB 2MC8A 1W02A 4JRFA 3EN1B 3KIIA 2HMNB 1TU5A 1WNHA 3MYTA 3GWRA 5I97A 4N6MA 2XFTA 1N8QA 3B4PA 1OUNA 2E2TA 3J7Yd 3K63A 2P09A 1JKGB 1TFKA 4H3UA 2OOVA 2LQVA 3TDGA 2CH9A 1YIT3 1CEWI 4BTXA 3MPHA 5TGNA 3CU3A 3I553 3CCQ3 3SXXA 1FGTA 1WMNA 3LMLA 1EKMA 1W2B2 1O7HB 2CWVA 1YIJ3 3EE1A 4X2OA 5CK6A 1JB5A 1TUHA 5ELUA 1OF5A 3ECFA 3MG3A 1Q824 4KVHA 5KP3A 3Q90A 3T8UA 2HMJB 4N3VA 3K0ZA 3X40A 2IUJA 2XSHB 2D1WA 4MEIA 3NHXA 1IVXA 2KCDA 3JUNA 4KFFA 1U8CB 1OACA 3LT8A 3K9MC 1UI7A 3QRDA 1S723 4FCMA 3V99A 4N6OB 1ZX2A 3NBBA 1Y4KA 3GZBA 2W04A 3LXUX 5STDA 2OQEC 1SJWA 1K734 3F7XA 3IJEB 2JQ5A 3CCM3 1VQO3 3H51A 5CXOA 4R80A 2QA43 1LXEA 3FG4A 2F86B 5HGRA 3X41A 4WP5A 4WHAA 2C11A 3I0YA 1K41A 2YFIB 1OHSA 3JUPA 1JV2B 3DGOA 4FCJA 2I9WA 3VSYA 3CCJ3 1KC84 2CW9A 1JNQA 3PGBA 5EEOA 3SEDA 1UI8A 3EQQB 4RNYA 1CQSA 4O8SA 1DYUA 2F98A 2XGLA 3PCRA 4KZ1A 2CKFB 2GBXB 4WFOA 3ALAA 2BMRB 7STDA 2GXFA 2Q07A 4LMIA 1F8NA 3EB8A 1M1K4 2GBWB 5AI1A 4RNZA 4WYKB 3U97A 1QVG2 2R4IA 1BUQA 1FA3A 1QALA 1G96A 2ML5A 1UW1A 1TFOA 3DM8A 3FH1A 1STFI 3EN8A 4J8TA 3CXC2 2OQEA 1OGZA 4N6UA 2OCTA 3MKIA 5D83A 1KD14 2WGQA 3LH4A 1JJ22 3NUVA 2CK3H 1KSIA 2KXGA 3DZLA 1Z1SA 1IU7A 3NQYA 4MMYB 5CLKA 2WO0A 1FGMA 3NBRA 1MNLA 2OOVC 4K1VA 1ULIB 1Q40B 5AIFA 3AMOA 4XBTA 3SOAA 3JUOA 3BNBA 1Q42A 2E2UA 1Q864 3CCE3 3UB1A 4CDLA 4AKYA 3CCS3 4FMCA 5AEWB 2D42A 3CCL3 1VQ53 4JF8A 3NX0A 2XGNA 2QGUA 4K1UA 4HZBB 4TX4A 2ZDJA 1L5GB 5G2GA 4L8OA 3DGMA 4I4KA 3X3YA 1V74A 3B4OA 2CC3A 2CFWA 2GEXA 3KSPA 1D6YA 4XDVA 3X42A 3SX1A 3DXOA 3WODG 1EG9B 1S5AA 1EQKA 3JUQA 1RN7A 2XH9A 4Q53A 4L8PA 2JDIH 1SIHA 3N54B 3KFQC 2RGQA 1A90A 3HIGA 4OUQA 3G0KA 2Y74A 4XB5A 3FG3A 1QJGA 1CYUA 1O7WB 2IUKA 3OV4A 5CF2A 2Z77A 1N5HA 4HYZA 1TP6A 4HM6B 4EXRA 2P38A 2A15A 2IA7A 4HM4B 1VQ93 3G713 4O2HA 2W2CA 5AYSC 1VZZA 2CFDA 1HKXA 3M8CA 4XM4A 4ZM8A 2K54A 1VQN3 1U5OA 2CFKA 1JB2A 3S29A 5IERA 2SBLA 2BHMA 4H61A 3BNCA 4HM5B 3EX9A 4IPBA 4HZ9B 2W9PA 5KP4A 2O9UX 3FF2A 1YJW3 5AIIA 1NB5I 2BMQB 1UUWB 3X3XA 1YI23 3JVCA 4OK0A 4KFEA 3RGRA 3PS8A 5KP1A 1M1XB 3KZTA 4HBRA 1GY7A 1LOXA 3V98A 4EYCA 3NM2A 3OWUA 1W01A 2W9QA 2P0MA 2WOHA 1STDA 1ULJB 1O7MB 3EBTA 3FF0A 2HMLB 2OTL3 5LC7A 2CG0A 3LT9A 3KSED 3CD63 3WA2X 2XFSA 3QK9A 4WYKA 3S27A 2Z76A 1O7NB 3JUMA 1OHPA 1IV9A 1NU3A 5A0OB 5EQLA 4IT7A 1VQ63 2W0QA 2Z6BA 1QAKA 1E3RA 2B1XB 3BB9A 2PZVA 3EHCA 1R4CA 4EBGA 1IDPA 3STDA 2BMOB 3FGYA 3Q2PA 3UJMA 1IVVA 1IT7A 1K9M4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q40 A;  3EJV A;  3T8N A;  1AR0 A;  1JN5 B;  2Z7A A;  1A2K A;  1C7H A;  3ROB A;  3HX8 A;  1ZO2 A;  3F7S A;  3K7C A;  5IF6 A;  4XBX A;  5BXQ A;  4X2H A;  3FSD A;  4R9K A;  4HJL B;  3KE7 A;  3E99 A;  3HZP A;  3EBY A;  3F8X A;  5DRV A;  5JPP A;  1OPY A;  1WQL B;  2YFJ B;  2YFL B;  3FKA A;  4HM2 B;  1E97 A;  2UX0 A;  4MJD A;  1JKG A;  2F99 A;  4L7K A;  5IG3 A;  1ISK A;  4R1K A;  3GRD A;  4LEH A;  1GYB A;  3UNL A;  1DMN A;  3IPT A;  2XR8 B;  8CHO A;  1OGX A;  3OXA A;  4HM1 B;  2RFR A;  5BVB A;  2RCD A;  2INX A;  1W00 A;  1QMA A;  3WMD A;  5D82 A;  2OWP A;  3LZA A;  1OHO A;  2QIY A;  2CHC A;  3NV0 B;  4R9L A;  4HM0 B;  5CF1 A;  5FW5 A;  3DUK A;  2IMJ A;  1GY5 A;  3MG2 A;  3CNM A;  5JPU A;  1NWW A;  4OVM A;  3SOY A;  1UUV B;  5DRE A;  3ER7 A;  4HKV B;  1O7G B;  3F9S A;  5IG5 A;  2HMM B;  5IEN A;  3OWS A;  5IEO A;  3NXJ A;  1GY6 A;  4WWU C;  4HM7 B;  4LGQ A;  1JN5 A;  2BNG A;  1DMM A;  3GZR A;  3D9R A;  3F8H A;  1OH0 A;  4IIA A;  3F14 A;  1ASK A;  1OCV A;  3CNX A;  3B8L A;  2STD A;  4ORL A;  3G8Z A;  1OF5 B;  3CPO A;  5D81 A;  3OWY A;  3MSO A;  3FLJ A;  3A76 A;  3G16 A;  1E3V A;  3GZY B;  3EC9 A;  5IG0 A;  1DMQ A;  3H3H A;  3BLZ A;  3HK4 A;  4HVN A;  3GZX B;  5AIG A;  3LYG A;  2B24 B;  4HM8 B;  1JB4 A;  3KKG A;  4XBY A;  3S5C A;  5IEP A;  5AIH A;  2HMK B;  4GB5 A;  2XSO B;  3DMC A;  3RGA A;  4U13 A;  3NV0 A;  4J9A A;  5EVH A;  1GS3 A;  1W6Y A;  1NDO B;  2HMO B;  3EF8 A;  4PEJ A;  2GEY A;  3MHE A;  3MG1 A;  4HM3 B;  4XDW A;  3VGN A;  2XRX B;  3OX9 A;  5IG4 A;  5AEU B;  3F40 A;  1EA2 A;  4STD A;  1O7P B;  3FZW A;  6STD A;  4RZM A;  3B7C A;  1W02 A;  3EN1 B;  2HMN B;  3MYT A;  3GWR A;  3B4P A;  1OUN A;  1JKG B;  4H3U A;  5TGN A;  3CU3 A;  1O7H B;  4X2O A;  5CK6 A;  1JB5 A;  1TUH A;  1OF5 A;  3ECF A;  3MG3 A;  4KVH A;  5KP3 A;  3Q90 A;  3T8U A;  2HMJ B;  4N3V A;  3K0Z A;  2XSH B;  3NHX A;  3JUN A;  4FCM A;  1ZX2 A;  3GZB A;  5STD A;  1SJW A;  3F7X A;  2JQ5 A;  3H51 A;  5CXO A;  2F86 B;  5HGR A;  4WP5 A;  3I0Y A;  1K41 A;  2YFI B;  1OHS A;  3JUP A;  4FCJ A;  2I9W A;  3VSY A;  3SED A;  3EQQ B;  1CQS A;  2F98 A;  2CKF B;  2GBX B;  7STD A;  2BMR B;  2GXF A;  4LMI A;  2GBW B;  5AI1 A;  4WYK B;  2R4I A;  1BUQ A;  4J8T A;  3DM8 A;  3FH1 A;  3EN8 A;  1OGZ A;  3MKI A;  5D83 A;  3NUV A;  3DZL A;  1Z1S A;  5CLK A;  3NBR A;  4K1V A;  1ULI B;  1Q40 B;  5AIF A;  4XBT A;  3SOA A;  3JUO A;  1Q42 A;  4CDL A;  5AEW B;  4K1U A;  2QGU A;  4HZB B;  5G2G A;  4L8O A;  4I4K A;  3B4O A;  2GEX A;  3KSP A;  4XDV A;  3DXO A;  1EG9 B;  1S5A A;  3JUQ A;  4Q53 A;  4L8P A;  2RGQ A;  4OUQ A;  3G0K A;  4XB5 A;  1QJG A;  1O7W B;  3OV4 A;  5CF2 A;  2Z77 A;  1TP6 A;  4HM6 B;  2A15 A;  4HM4 B;  2W2C A;  1VZZ A;  1HKX A;  3M8C A;  4XM4 A;  2K54 A;  1U5O A;  1JB2 A;  5IER A;  4HM5 B;  3EX9 A;  4HZ9 B;  5KP4 A;  3FF2 A;  5AII A;  2BMQ B;  1UUW B;  3RGR A;  5KP1 A;  3KZT A;  1GY7 A;  3NM2 A;  3OWU A;  1W01 A;  1STD A;  1ULJ B;  1O7M B;  3EBT A;  3FF0 A;  2HML B;  4WYK A;  2Z76 A;  1O7N B;  3JUM A;  1OHP A;  1NU3 A;  1E3R A;  2B1X B;  3BB9 A;  2PZV A;  3EHC A;  1IDP A;  3STD A;  2BMO B;  3FGY A;  3UJM A; 
#chains in the Genus database with same CATH topology
 2E2V A;  1Q40 A;  3EJV A;  3UL5 A;  1VQ4 3;  1AVK A;  1RGL A;  2W6J H;  4G1M B;  1VQM 3;  2PNC A;  1AR0 A;  1FGQ A;  3S28 A;  3T8N A;  1JN5 B;  1B2Z A;  2Z7A A;  1A2K A;  3RDE A;  1C7H A;  1MWU A;  1LOW A;  1ZGX A;  3ROB A;  3LOY A;  1BRS A;  1RGA A;  1IQY A;  1W7C A;  1ROV A;  2FGT A;  3HX8 A;  1B2M A;  1ZO2 A;  3F7S A;  1HZ1 A;  2V1L A;  3K7C A;  1LNH A;  3WR2 A;  4GSP A;  5IF6 A;  2CWT A;  3DY5 A;  4XBX A;  5ELJ A;  5BU4 A;  5BXQ A;  1BNR A;  4CJN A;  1IK3 A;  2BIR A;  4X2H A;  2KF3 A;  1BOX A;  3S67 A;  3FSD A;  4R9K A;  4HJL B;  2YX9 A;  3G6E 3;  3KE7 A;  1X1Y A;  3E99 A;  3HZP A;  3EBY A;  3CC7 3;  3F8X A;  1LRA A;  3Q3F A;  3CCU 3;  1WMO A;  5DRV A;  2F56 A;  5HOH A;  5JPP A;  4CCV A;  1BUJ A;  4NHF A;  1OPY A;  1WQL B;  1GD3 A;  2BT3 A;  2YFJ B;  5M18 A;  1DVD A;  2YFL B;  3FKA A;  1YGE A;  4HM2 B;  1V57 A;  1BSE A;  4HAA A;  3DGY A;  2LYX A;  2BO9 B;  1E97 A;  3Q1C A;  3NBJ A;  4KFD A;  4N6V 0;  1W4N A;  4LZI A;  2KAA A;  1BSC A;  2UX0 A;  1EEJ A;  1GSP A;  2FXT A;  1N9E A;  1B21 A;  1RRH A;  4K61 A;  1JKG A;  2F99 A;  3O8Y A;  4L7K A;  4MJD A;  5IG3 A;  1YHQ 3;  1ISK A;  3CME 3;  1M90 4;  1I3F A;  3GRD A;  4LEH A;  1GYB A;  4R1K A;  1DMN A;  2CX0 A;  2GU1 A;  3IPT A;  2XR8 B;  3UNL A;  8CHO A;  1TIJ A;  1LQG C;  1OGX A;  2KF5 A;  5RNT A;  1N8R 4;  2ZL8 A;  3D5I A;  1Q7Y 4;  1HU9 A;  3OXA A;  5G1K A;  1IQ8 A;  3KN4 A;  4HM1 B;  4O02 B;  2RFR A;  5BVB A;  5M19 A;  1WMP A;  2RCD A;  2M7O A;  2MF7 A;  2GU3 A;  4EC6 A;  2INX A;  3LTD A;  4FMB A;  1VQ7 3;  1YJ9 3;  4LSO A;  2GSP A;  3HOH A;  1MOL A;  1W00 A;  1X1X A;  1QMA A;  3PXM A;  2K0M A;  2RNT A;  1NNV A;  3WMD A;  1W6G A;  4BIR A;  5D82 A;  2Y73 A;  1TTO A;  1GD4 A;  3UL6 A;  2J8X B;  1GMQ A;  2OWP A;  4AEQ A;  3WOE B;  3CC2 3;  3OW2 2;  2OTJ 3;  1AY7 A;  3LZA A;  1OHO A;  2QIY A;  1RDS A;  2CHC A;  3CCR 3;  1A2P A;  3NV0 B;  2W56 B;  1BAO A;  3IMA B;  5LC6 A;  3DGL A;  4R9L A;  1RKY A;  1EUI C;  4HM0 B;  1US1 A;  5CF1 A;  1JBR A;  2UUG C;  1M9G A;  5FW5 A;  3DUK A;  3I56 3;  2QEX 3;  2IMJ A;  1GY5 A;  3BU4 A;  3MG2 A;  1PFP A;  1A2V A;  1SPU A;  3CNM A;  2AAD A;  5JPU A;  1NWW A;  1BSB A;  3D3L A;  6GSP A;  4EV2 A;  4OVM A;  1FUW A;  3SOY A;  1JZO A;  4CPK A;  1QVF 2;  1UUV B;  3HI7 A;  5DRE A;  3ER7 A;  4R4K A;  4HKV B;  1O7G B;  3F9S A;  1KQS 2;  4FMA A;  2F4Y A;  3CPW 2;  3NM7 A;  1ZS7 A;  1FGR A;  2CIU A;  3WDG B;  1VQK 3;  5IG5 A;  2HMM B;  4K90 B;  5IEN A;  4BTW A;  1VQL 3;  1BRN L;  3OWS A;  1UCI A;  5IEO A;  1GY6 A;  1GOV A;  3MWZ A;  3NXJ A;  3L0R A;  4MMX B;  5JBS A;  4WWU C;  1RGK A;  2P0X A;  4HM7 B;  1FGO A;  4LGQ A;  1JN5 A;  1W2Z A;  1IQX A;  1IV7 A;  4FCZ A;  2BNG A;  2CFG A;  3RNT A;  1DMM A;  3GZR A;  1VQP 3;  1SQW A;  2O3O A;  1N5P A;  3D9R A;  3F8H A;  1W6C A;  2HOH A;  3LTC A;  4RBN A;  2L1S A;  4NRE A;  4EV5 A;  2ML6 A;  1BSA A;  1D6U A;  1FUT A;  1OH0 A;  4IIA A;  1AV4 A;  1RJO A;  3F14 A;  5G1L A;  3FG1 A;  3SVA A;  1D6Z A;  3WA3 A;  1ASK A;  1SII A;  3AHS A;  1JBS A;  1UGH I;  2CWU A;  1OCV A;  2L4V A;  1UGI A;  1YVB I;  3CNX A;  1PYL A;  1WTH A;  1RNB A;  3BND A;  1I2E A;  1NB3 I;  3B8L A;  2STD A;  4ORL A;  3CCV 3;  1LOY A;  1B20 A;  1RRL A;  3ZFZ A;  2WOF A;  3SYU A;  3CC4 3;  1JZD A;  1QAF A;  3G8Z A;  1OF5 B;  3CPO A;  3N8B A;  3D79 A;  3OWY A;  4QWT A;  5D81 A;  3MSO A;  1TRQ A;  3FLJ A;  1Q81 4;  1BU4 A;  1PU4 A;  1TJD A;  2KF4 A;  3KCH A;  3A76 A;  2XEP A;  3G16 A;  1NJI 4;  1E3V A;  1IYY A;  3LTB A;  3D4A A;  1LQM B;  3GZY B;  1A67 A;  3EC9 A;  1N9J A;  3K5T A;  2CG1 A;  3PZW A;  4GL6 A;  5IG0 A;  1YJN 3;  3GAX A;  1RGF A;  1DMQ A;  4AKZ A;  3H3H A;  1KWI A;  4MMZ B;  1B27 A;  3BLZ A;  3HK4 A;  4HVN A;  5BIR A;  1J2B A;  3GZX B;  2C10 A;  5AIG A;  1DVC A;  3LYG A;  3PCS A;  1LVN A;  1K8A 4;  2B24 B;  3VF1 A;  1DE3 A;  4GHO A;  3FCS B;  4FMD A;  4HM8 B;  4N6T A;  4BTY A;  1LNI A;  3DH2 A;  1JB4 A;  3KKG A;  4XBY A;  3WOF B;  2RSX A;  3S5C A;  5IEP A;  3V92 A;  5AIH A;  2CFL A;  2HMK B;  1I3I A;  4GB5 A;  3ZG0 A;  5FGO A;  3AGN A;  2XSO B;  3DMC A;  3DGN A;  1IVW A;  1VQ8 3;  2FNQ A;  3RGA A;  2P05 A;  4U13 A;  5IW9 A;  3CMA 3;  1NO3 A;  2WGO A;  2W56 A;  3NV0 A;  2ZA4 A;  4J9A A;  1I0X A;  5EVH A;  4O3V A;  3HII A;  1GS3 A;  3X3Z A;  1RCK A;  1W6Y A;  1MGR A;  4N6L A;  1UCK A;  1NDO B;  2XF3 A;  1X1W A;  2HMO B;  3EF8 A;  1VQQ A;  3U1W A;  3G4S 3;  1ROA A;  1W5Z A;  4PEJ A;  2GEY A;  3MHE A;  2IY2 A;  3BNE A;  3SLU A;  3MG1 A;  4N6N B;  1AVL A;  3PYJ A;  4HM3 B;  4FR9 A;  2W03 A;  4XDW A;  2XRX B;  2ZHX B;  3VGN A;  3T0U A;  3LTA A;  3OX9 A;  5IG4 A;  5AEU B;  1T5Y A;  1JRQ A;  3F40 A;  1K28 A;  1EA2 A;  1GOY A;  1MGW A;  4STD A;  1CYV A;  3N9H A;  1IVU A;  1O7P B;  3FZW A;  1IT8 A;  6STD A;  4BU4 A;  4RZM A;  1RMS A;  2KRT A;  3AMO B;  3NQZ A;  3B7C A;  5AYR B;  2MC8 A;  1BAN A;  1W02 A;  4JRF A;  3EN1 B;  3KII A;  2HMN B;  1BNF A;  1WNH A;  1RGH A;  1X1U A;  1TU5 A;  3MYT A;  3GWR A;  1FW7 A;  5I97 A;  4N6M A;  2XFT A;  4BL3 A;  1N8Q A;  3B4P A;  1OUN A;  2E2T A;  3J7Y d;  3K63 A;  2P09 A;  1YGW A;  1MWS A;  1JKG B;  1TFK A;  4H3U A;  1BNI A;  2LQV A;  2OOV A;  3TDG A;  2CH9 A;  1YIT 3;  1R4Y A;  1CEW I;  4BTX A;  3MPH A;  5TGN A;  3CU3 A;  3I55 3;  1I2F A;  5GSP A;  3CCQ 3;  3SXX A;  1FGT A;  1WMN A;  1B3S A;  1YNV X;  3LML A;  1EKM A;  1W2B 2;  1O7H B;  2CWV A;  1YIJ 3;  3EE1 A;  4X2O A;  5CK6 A;  1JB5 A;  1TUH A;  2C4B A;  2KF6 A;  1OF5 A;  5ELU A;  3ECF A;  3MG3 A;  1Q82 4;  4KVH A;  5KP3 A;  1RLS A;  3Q90 A;  3T8U A;  1DET A;  2HMJ B;  1BIR A;  3K0Z A;  4N3V A;  2IUJ A;  3X40 A;  2SAR A;  2D1W A;  2XSH B;  4MEI A;  3NHX A;  1IVX A;  2KCD A;  3JUN A;  3A5E A;  4KFF A;  1U8C B;  1OAC A;  3LT8 A;  3K9M C;  1UI7 A;  3QRD A;  1T3B A;  4NPB A;  4RNT A;  1S72 3;  1YVS A;  4FCM A;  1RGE A;  4N6O B;  3V99 A;  1ZX2 A;  3NBB A;  1Y4K A;  4J5K A;  3GZB A;  2W04 A;  3LXU X;  5STD A;  2OQE C;  1SJW A;  1K73 4;  1Q9E A;  3F7X A;  3IJE B;  2JQ5 A;  3CCM 3;  1VQO 3;  1SAR A;  1I70 A;  3H51 A;  4R80 A;  5CXO A;  2QA4 3;  1LXE A;  3FG4 A;  2F86 B;  3D5G A;  5HGR A;  3X41 A;  1FUS A;  4WP5 A;  4WHA A;  2C11 A;  3I0Y A;  6RNT A;  1K41 A;  2YFI B;  1OHS A;  3JUP A;  1JV2 B;  3DGO A;  2H0H A;  4FCJ A;  2I9W A;  3VSY A;  3AHW A;  3CCJ 3;  2CW9 A;  1KC8 4;  1JNQ A;  1BRI A;  3PGB A;  5EEO A;  3SED A;  1UI8 A;  3EQQ B;  1BNG A;  2IYJ A;  4RNY A;  1CQS A;  4O8S A;  1DYU A;  2F98 A;  2XGL A;  3PCR A;  1GMR A;  4KZ1 A;  2CKF B;  2GBX B;  3X42 A;  4WFO A;  1UUG B;  2BMR B;  3ALA A;  2GXF A;  2Q07 A;  7STD A;  4LMI A;  1F8N A;  3EB8 A;  1M1K 4;  1RNT A;  2GBW B;  5M1A A;  1UCL A;  5AI1 A;  2R41 A;  4RNZ A;  4WYK B;  1I0V A;  1BRJ A;  3U97 A;  2R4I A;  1QVG 2;  1BUQ A;  1FA3 A;  1QAL A;  1G96 A;  2ML5 A;  1UW1 A;  1TFO A;  3DM8 A;  3FH1 A;  1STF I;  3EN8 A;  4J8T A;  2F5M A;  3CXC 2;  2OQE A;  1OGZ A;  4N6U A;  2OCT A;  3MKI A;  5D83 A;  1KD1 4;  1CH0 A;  2WGQ A;  3LH4 A;  1JJ2 2;  3NUV A;  2CK3 H;  4DKI A;  1RCL A;  3GSP A;  1KSI A;  2KXG A;  3DZL A;  1Z1S A;  1IU7 A;  2F5W A;  3NQY A;  1BNE A;  4MMY B;  5CLK A;  1GMP A;  1B2S A;  1T2H A;  1HYF A;  1FGM A;  2WO0 A;  3NBR A;  1MNL A;  1PY3 A;  4I5Q A;  2OOV C;  4K1V A;  1ULI B;  1Q40 B;  1UCJ A;  1RN4 A;  5AIF A;  3AMO A;  4XBT A;  3SOA A;  1B2X A;  1I2G A;  3JUO A;  3BNB A;  1Q42 A;  2E2U A;  2K3D A;  1AQZ A;  1FYS A;  8RNT A;  9RNT A;  3UB1 A;  3CCE 3;  1Q86 4;  4CDL A;  4AKY A;  3CCS 3;  4FMC A;  5AEW B;  2D42 A;  2H0I A;  3CCL 3;  1VQ5 3;  4JF8 A;  3NX0 A;  3URP A;  2XGN A;  2QGU A;  4K1U A;  4HZB B;  4TX4 A;  2ZDJ A;  1LOV A;  2BU4 A;  1L5G B;  5G2G A;  4L8O A;  3DGM A;  3AGO A;  4I4K A;  3X3Y A;  1BRH A;  1V74 A;  1BRG A;  1RGG A;  1BNS A;  3B4O A;  4EW5 A;  2CC3 A;  2CFW A;  2GEX A;  1I8V A;  3KSP A;  1UDI I;  1BRK A;  1D6Y A;  1GOU A;  4XDV A;  1TRP A;  3SX1 A;  3DXO A;  3WOD G;  1EG9 B;  1S5A A;  1EQK A;  3JUQ A;  1RN7 A;  2XH9 A;  4Q53 A;  4L8P A;  2JDI H;  1SIH A;  3N54 B;  1FZU A;  2RGQ A;  3KFQ C;  1A90 A;  1G0T A;  3HIG A;  3G0K A;  4OUQ A;  2Y74 A;  4XB5 A;  1T2I A;  1QJG A;  3FG3 A;  3WHO A;  1CYU A;  1O7W B;  2IUK A;  1BVI A;  3OV4 A;  2CX1 A;  5CF2 A;  2Z77 A;  1N5H A;  4HYZ A;  1JBT A;  1TP6 A;  4HM6 B;  4EXR A;  2P38 A;  2A15 A;  2IA7 A;  4HM4 B;  1VQ9 3;  3BIR A;  3G71 3;  4O2H A;  2W2C A;  5AYS C;  1VZZ A;  2CFD A;  1HKX A;  3M8C A;  4XM4 A;  4ZM8 A;  2K54 A;  1VQN 3;  4BL2 A;  1U5O A;  2CFK A;  1JB2 A;  4HOH A;  3S29 A;  1C54 A;  5IER A;  2SBL A;  2BHM A;  4H61 A;  1RSN A;  3BNC A;  4HM5 B;  2UGI A;  3EX9 A;  4IPB A;  4HZ9 B;  2H0G A;  2W9P A;  4J5G A;  5KP4 A;  2O9U X;  3FF2 A;  1YJW 3;  5AII A;  1NB5 I;  2BMQ B;  1UUW B;  3X3X A;  1YI2 3;  1G02 A;  1RGC A;  3JVC A;  4KT3 B;  4OK0 A;  4KFE A;  1BNJ A;  1BGS A;  3RGR A;  1Q7H A;  3PS8 A;  5KP1 A;  1M1X B;  3KZT A;  3ZG5 A;  4HBR A;  1GY7 A;  1LOX A;  3V98 A;  1RN1 A;  3NM2 A;  4EYC A;  3OWU A;  1B2U A;  1W01 A;  2W9Q A;  4ILF A;  2P0M A;  2WOH A;  4LYL B;  1STD A;  1RTU A;  1ULJ B;  1O7M B;  3EBT A;  3FF0 A;  2HML B;  2OTL 3;  5LC7 A;  2RBI A;  2CG0 A;  3LT9 A;  7RNT A;  1MWR A;  3KSE D;  3CD6 3;  3WA2 X;  2XFS A;  3QK9 A;  4WYK A;  3S27 A;  1MWT A;  2Z76 A;  7GSP A;  1O7N B;  3JUM A;  1OHP A;  1IV9 A;  1NU3 A;  5A0O B;  2AAE A;  5EQL A;  4IT7 A;  1V58 A;  1VQ6 3;  2W0Q A;  2Z6B A;  1QAK A;  1E3R A;  2B1X B;  3BB9 A;  2PZV A;  3EHC A;  1R4C A;  4EBG A;  1IDP A;  3STD A;  1RHL A;  2BMO B;  3FGY A;  3Q2P A;  3UJM A;  1BSD A;  1IVV A;  1IT7 A;  1K9M 4; 
#chains in the Genus database with same CATH homology
 2E2V A;  1Q40 A;  3EJV A;  3UL5 A;  1VQ4 3;  1AVK A;  2W6J H;  4G1M B;  1VQM 3;  2PNC A;  1AR0 A;  1FGQ A;  3S28 A;  3T8N A;  1JN5 B;  2Z7A A;  1A2K A;  3RDE A;  1C7H A;  3ROB A;  3LOY A;  1IQY A;  1W7C A;  1ROV A;  2FGT A;  3HX8 A;  1ZO2 A;  3F7S A;  2V1L A;  3K7C A;  1LNH A;  5IF6 A;  2CWT A;  3DY5 A;  4XBX A;  5ELJ A;  5BXQ A;  1IK3 A;  4X2H A;  3S67 A;  3FSD A;  4R9K A;  4HJL B;  2YX9 A;  3G6E 3;  3KE7 A;  3E99 A;  3HZP A;  3EBY A;  3CC7 3;  3F8X A;  3CCU 3;  1WMO A;  5DRV A;  5JPP A;  4CCV A;  4NHF A;  1OPY A;  1WQL B;  1GD3 A;  2BT3 A;  2YFJ B;  1DVD A;  2YFL B;  3FKA A;  1YGE A;  4HM2 B;  2LYX A;  2BO9 B;  1E97 A;  3Q1C A;  3NBJ A;  4KFD A;  4N6V 0;  1W4N A;  4LZI A;  2UX0 A;  2FXT A;  1N9E A;  4K61 A;  1RRH A;  4MJD A;  1JKG A;  2F99 A;  3O8Y A;  4L7K A;  5IG3 A;  1YHQ 3;  1ISK A;  3CME 3;  1M90 4;  4R1K A;  3GRD A;  4LEH A;  1GYB A;  3UNL A;  1DMN A;  2GU1 A;  3IPT A;  2XR8 B;  8CHO A;  1TIJ A;  1OGX A;  1N8R 4;  2ZL8 A;  1Q7Y 4;  1HU9 A;  3OXA A;  1IQ8 A;  3KN4 A;  4HM1 B;  4O02 B;  2RFR A;  5BVB A;  1WMP A;  2RCD A;  2M7O A;  2MF7 A;  2GU3 A;  4EC6 A;  2INX A;  3LTD A;  4FMB A;  1VQ7 3;  1YJ9 3;  4LSO A;  1MOL A;  1W00 A;  1QMA A;  3PXM A;  2K0M A;  3WMD A;  1W6G A;  5D82 A;  2Y73 A;  1GD4 A;  3UL6 A;  2OWP A;  4AEQ A;  3WOE B;  3CC2 3;  3OW2 2;  2OTJ 3;  3LZA A;  1OHO A;  2QIY A;  2CHC A;  3CCR 3;  3NV0 B;  2W56 B;  3IMA B;  5LC6 A;  3DGL A;  4R9L A;  1RKY A;  4HM0 B;  1US1 A;  5CF1 A;  5FW5 A;  1M9G A;  3DUK A;  3I56 3;  2QEX 3;  2IMJ A;  1GY5 A;  3MG2 A;  1PFP A;  1A2V A;  1SPU A;  3CNM A;  5JPU A;  1NWW A;  3D3L A;  4EV2 A;  4OVM A;  1FUW A;  3SOY A;  1QVF 2;  1UUV B;  3HI7 A;  5DRE A;  3ER7 A;  4R4K A;  4HKV B;  1O7G B;  3F9S A;  1KQS 2;  4FMA A;  3CPW 2;  3NM7 A;  1FGR A;  2CIU A;  3WDG B;  1VQK 3;  5IG5 A;  2HMM B;  4K90 B;  5IEN A;  4BTW A;  1VQL 3;  3OWS A;  5IEO A;  1GY6 A;  3MWZ A;  3NXJ A;  5JBS A;  3L0R A;  4MMX B;  4WWU C;  2P0X A;  4HM7 B;  1FGO A;  4LGQ A;  1JN5 A;  1W2Z A;  1IQX A;  1IV7 A;  4FCZ A;  2BNG A;  2CFG A;  1DMM A;  3GZR A;  1VQP 3;  1SQW A;  2O3O A;  1N5P A;  3D9R A;  3F8H A;  1W6C A;  3LTC A;  4RBN A;  4NRE A;  4EV5 A;  2ML6 A;  1D6U A;  1OH0 A;  4IIA A;  1AV4 A;  1RJO A;  3F14 A;  3FG1 A;  3SVA A;  1D6Z A;  3WA3 A;  1ASK A;  1SII A;  2CWU A;  1OCV A;  2L4V A;  1YVB I;  3CNX A;  1WTH A;  3BND A;  1NB3 I;  3B8L A;  2STD A;  4ORL A;  3CCV 3;  1RRL A;  2WOF A;  3CC4 3;  1QAF A;  3G8Z A;  1OF5 B;  3CPO A;  3N8B A;  4QWT A;  3OWY A;  5D81 A;  3MSO A;  3FLJ A;  1Q81 4;  1PU4 A;  3A76 A;  2XEP A;  3G16 A;  1NJI 4;  1E3V A;  3LTB A;  3GZY B;  1A67 A;  3EC9 A;  1N9J A;  3K5T A;  2CG1 A;  3PZW A;  4GL6 A;  5IG0 A;  1YJN 3;  3GAX A;  4AKZ A;  1DMQ A;  3H3H A;  1KWI A;  4MMZ B;  3BLZ A;  3HK4 A;  4HVN A;  1J2B A;  3GZX B;  2C10 A;  5AIG A;  1DVC A;  3LYG A;  3PCS A;  1LVN A;  1K8A 4;  2B24 B;  3VF1 A;  3FCS B;  4FMD A;  4HM8 B;  4N6T A;  4BTY A;  1JB4 A;  3KKG A;  4XBY A;  3WOF B;  2RSX A;  3S5C A;  5IEP A;  3V92 A;  5AIH A;  2CFL A;  2HMK B;  4GB5 A;  5FGO A;  2XSO B;  3DMC A;  3DGN A;  1IVW A;  1VQ8 3;  2FNQ A;  3RGA A;  2P05 A;  4U13 A;  5IW9 A;  3CMA 3;  1NO3 A;  2WGO A;  2W56 A;  3NV0 A;  4J9A A;  5EVH A;  4O3V A;  3HII A;  1GS3 A;  3X3Z A;  1W6Y A;  4N6L A;  1NDO B;  2XF3 A;  2HMO B;  3EF8 A;  3U1W A;  3G4S 3;  1ROA A;  1W5Z A;  4PEJ A;  2GEY A;  3MHE A;  3BNE A;  3SLU A;  3MG1 A;  4N6N B;  1AVL A;  3PYJ A;  4HM3 B;  4FR9 A;  2W03 A;  4XDW A;  2XRX B;  3VGN A;  3T0U A;  3LTA A;  3OX9 A;  5IG4 A;  5AEU B;  1T5Y A;  1JRQ A;  3F40 A;  1K28 A;  1EA2 A;  4STD A;  1CYV A;  3N9H A;  1IVU A;  1O7P B;  3FZW A;  1IT8 A;  6STD A;  4RZM A;  2KRT A;  3AMO B;  3NQZ A;  3B7C A;  5AYR B;  2MC8 A;  1W02 A;  4JRF A;  3EN1 B;  3KII A;  2HMN B;  1TU5 A;  1WNH A;  3MYT A;  3GWR A;  5I97 A;  4N6M A;  2XFT A;  1N8Q A;  3B4P A;  1OUN A;  2E2T A;  3J7Y d;  3K63 A;  2P09 A;  1JKG B;  1TFK A;  4H3U A;  2OOV A;  2LQV A;  3TDG A;  2CH9 A;  1YIT 3;  1CEW I;  4BTX A;  3MPH A;  5TGN A;  3CU3 A;  3I55 3;  3CCQ 3;  3SXX A;  1FGT A;  1WMN A;  3LML A;  1EKM A;  1W2B 2;  1O7H B;  2CWV A;  1YIJ 3;  3EE1 A;  4X2O A;  5CK6 A;  1JB5 A;  1TUH A;  5ELU A;  1OF5 A;  3ECF A;  3MG3 A;  1Q82 4;  4KVH A;  5KP3 A;  3Q90 A;  3T8U A;  2HMJ B;  4N3V A;  3K0Z A;  3X40 A;  2IUJ A;  2XSH B;  2D1W A;  4MEI A;  3NHX A;  1IVX A;  2KCD A;  3JUN A;  4KFF A;  1U8C B;  1OAC A;  3LT8 A;  3K9M C;  1UI7 A;  3QRD A;  1S72 3;  4FCM A;  3V99 A;  4N6O B;  1ZX2 A;  3NBB A;  1Y4K A;  3GZB A;  2W04 A;  3LXU X;  5STD A;  2OQE C;  1SJW A;  1K73 4;  3F7X A;  3IJE B;  2JQ5 A;  3CCM 3;  1VQO 3;  3H51 A;  5CXO A;  4R80 A;  2QA4 3;  1LXE A;  3FG4 A;  2F86 B;  5HGR A;  3X41 A;  4WP5 A;  4WHA A;  2C11 A;  3I0Y A;  1K41 A;  2YFI B;  1OHS A;  3JUP A;  1JV2 B;  3DGO A;  4FCJ A;  2I9W A;  3VSY A;  3CCJ 3;  1KC8 4;  2CW9 A;  1JNQ A;  3PGB A;  5EEO A;  3SED A;  1UI8 A;  3EQQ B;  4RNY A;  1CQS A;  4O8S A;  1DYU A;  2F98 A;  2XGL A;  3PCR A;  4KZ1 A;  2CKF B;  2GBX B;  4WFO A;  3ALA A;  2BMR B;  7STD A;  2GXF A;  2Q07 A;  4LMI A;  1F8N A;  3EB8 A;  1M1K 4;  2GBW B;  5AI1 A;  4RNZ A;  4WYK B;  3U97 A;  1QVG 2;  2R4I A;  1BUQ A;  1FA3 A;  1QAL A;  1G96 A;  2ML5 A;  1UW1 A;  1TFO A;  3DM8 A;  3FH1 A;  1STF I;  3EN8 A;  4J8T A;  3CXC 2;  2OQE A;  1OGZ A;  4N6U A;  2OCT A;  3MKI A;  5D83 A;  1KD1 4;  2WGQ A;  3LH4 A;  1JJ2 2;  3NUV A;  2CK3 H;  1KSI A;  2KXG A;  3DZL A;  1Z1S A;  1IU7 A;  3NQY A;  4MMY B;  5CLK A;  2WO0 A;  1FGM A;  3NBR A;  1MNL A;  2OOV C;  4K1V A;  1ULI B;  1Q40 B;  5AIF A;  3AMO A;  4XBT A;  3SOA A;  3JUO A;  3BNB A;  1Q42 A;  2E2U A;  1Q86 4;  3CCE 3;  3UB1 A;  4CDL A;  4AKY A;  3CCS 3;  4FMC A;  5AEW B;  2D42 A;  3CCL 3;  1VQ5 3;  4JF8 A;  3NX0 A;  2XGN A;  2QGU A;  4K1U A;  4HZB B;  4TX4 A;  2ZDJ A;  1L5G B;  5G2G A;  4L8O A;  3DGM A;  4I4K A;  3X3Y A;  1V74 A;  3B4O A;  2CC3 A;  2CFW A;  2GEX A;  3KSP A;  1D6Y A;  4XDV A;  3X42 A;  3SX1 A;  3DXO A;  3WOD G;  1EG9 B;  1S5A A;  1EQK A;  3JUQ A;  1RN7 A;  2XH9 A;  4Q53 A;  4L8P A;  2JDI H;  1SIH A;  3N54 B;  3KFQ C;  2RGQ A;  1A90 A;  3HIG A;  4OUQ A;  3G0K A;  2Y74 A;  4XB5 A;  3FG3 A;  1QJG A;  1CYU A;  1O7W B;  2IUK A;  3OV4 A;  5CF2 A;  2Z77 A;  1N5H A;  4HYZ A;  1TP6 A;  4HM6 B;  4EXR A;  2P38 A;  2A15 A;  2IA7 A;  4HM4 B;  1VQ9 3;  3G71 3;  4O2H A;  2W2C A;  5AYS C;  1VZZ A;  2CFD A;  1HKX A;  3M8C A;  4XM4 A;  4ZM8 A;  2K54 A;  1VQN 3;  1U5O A;  2CFK A;  1JB2 A;  3S29 A;  5IER A;  2SBL A;  2BHM A;  4H61 A;  3BNC A;  4HM5 B;  3EX9 A;  4IPB A;  4HZ9 B;  2W9P A;  5KP4 A;  2O9U X;  3FF2 A;  1YJW 3;  5AII A;  1NB5 I;  2BMQ B;  1UUW B;  3X3X A;  1YI2 3;  3JVC A;  4OK0 A;  4KFE A;  3RGR A;  3PS8 A;  5KP1 A;  1M1X B;  3KZT A;  4HBR A;  1GY7 A;  1LOX A;  3V98 A;  4EYC A;  3NM2 A;  3OWU A;  1W01 A;  2W9Q A;  2P0M A;  2WOH A;  1STD A;  1ULJ B;  1O7M B;  3EBT A;  3FF0 A;  2HML B;  2OTL 3;  5LC7 A;  2CG0 A;  3LT9 A;  3KSE D;  3CD6 3;  3WA2 X;  2XFS A;  3QK9 A;  4WYK A;  3S27 A;  2Z76 A;  1O7N B;  3JUM A;  1OHP A;  1IV9 A;  1NU3 A;  5A0O B;  5EQL A;  4IT7 A;  1VQ6 3;  2W0Q A;  2Z6B A;  1QAK A;  1E3R A;  2B1X B;  3BB9 A;  2PZV A;  3EHC A;  1R4C A;  4EBG A;  1IDP A;  3STD A;  2BMO B;  3FGY A;  3Q2P A;  3UJM A;  1IVV A;  1IT7 A;  1K9M 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...