1W00A

Crystal structure of mutant enzyme d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
124
Chain Sequence
NLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 124
sequence length 126
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w00A00
3JUPA 1S5AA 1W02A 3NV0A 3EJVA 5IF6A 5JPPA 3EC9A 3KSPA 3K0ZA 3ROBA 1OUNA 3DMCA 3VGNA 3NUVA 1ASKA 4WP5A 2I9WA 3OWYA 5KP1A 5KP4A 3MYTA 4MJDA 5D83A 4J9AA 2OWPA 4WWUC 1OCVA 5BXQA 1E3RA 3MKIA 2BMQB 3JUQA 3SOYA 1NWWA 1OHOA 5IG5A 2RGQA 3OWSA 3KKGA 5FW5A 5AI1A 2HMMB 2GEYA 5AEWB 2GEXA 1OHPA 2HMJB 1W01A 3CPOA 1U5OA 2HMNB 3EN1B 2PZVA 4HM0B 1O7WB 2QGUA 5DREA 5IENA 3Q90A 4HM7B 2XSOB 4LEHA 4L8OA 5CK6A 3UJMA 3RGAA 4WYKA 4ORLA 1JB4A 4XB5A 3EX9A 4GB5A 3I0YA 5KP3A 2INXA 3B8LA 4KVHA 3G8ZA 3GZXB 1JN5A 1OF5B 3MG2A 8CHOA 4CDLA 3HX8A 1NDOB 1GY5A 1GS3A 3NM2A 2Z76A 3KZTA 4IIAA 1O7HB 4R9KA 4HVNA 1Z1SA 4HZ9B 2Z77A 5D82A 1E3VA 3MSOA 3LZAA 4HM1B 1AR0A 3CU3A 5CF1A 3FF0A 5AIFA 5CF2A 3F9SA 4U13A 2XRXB 2XR8B 3NV0B 2CKFB 4R1KA 5IEOA 3EBYA 2STDA 2GBWB 2YFJB 4LMIA 3B7CA 4XDWA 3LYGA 3CNMA 3OWUA 1O7NB 3D9RA 1O7PB 3G16A 5IERA 4Q53A 1Q40A 3NXJA 4XBXA 4HM8B 5IG0A 3F40A 1BUQA 1ISKA 5BVBA 3NHXA 3EBTA 1UUWB 1O7MB 2R4IA 5EVHA 3DZLA 1E97A 1W6YA 4HM3B 3HZPA 2YFLB 2K54A 4PEJA 1JKGA 1DMQA 1JB5A 4OVMA 2JQ5A 4R9LA 1C7HA 3OV4A 1TP6A 1QMAA 3BB9A 1OGZA 1ULIB 3G0KA 4H3UA 1OGXA 3VSYA 2GBXB 1JN5B 3NBRA 3EF8A 3FZWA 1K41A 3FH1A 1GY7A 4XBTA 5D81A 2W2CA 2B24B 4XBYA 1QJGA 3F8XA 4K1UA 3GZBA 3FGYA 5AIHA 5AIIA 3BLZA 3DM8A 1ULJB 3ER7A 3SOAA 1A2KA 3DUKA 4X2OA 5AEUB 5TGNA 5IG3A 3FKAA 4FCMA 2HMKB 3M8CA 1STDA 5CLKA 1ZX2A 3JUNA 3K7CA 3FF2A 3F7SA 3T8NA 2UX0A 1Q40B 4HM4B 4X2HA 3OX9A 3H3HA 3DXOA 3GRDA 5AIGA 1GYBA 1VZZA 1Q42A 2RCDA 3B4OA 1CQSA 1SJWA 5STDA 1OHSA 2F98A 5CXOA 4FCJA 1IDPA 3FLJA 2CHCA 5G2GA 1JKGB 1JB2A 2Z7AA 4HJLB 4J8TA 1DMMA 2BMRB 4HM6B 2BNGA 3FSDA 1WQLB 5IG4A 5JPUA 3MG3A 2F99A 3H51A 4L8PA 1EA2A 1OH0A 4LGQA 5IEPA 4WYKB 2B1XB 3SEDA 3F7XA 2YFIB 3GZRA 3EQQB 3STDA 4HM2B 3EHCA 3CNXA 3OXAA 1OPYA 4OUQA 6STDA 3S5CA 4L7KA 3T8UA 4HKVB 3JUOA 2IMJA 3A76A 3KE7A 1NU3A 2F86B 2HMLB 1HKXA 1ZO2A 3WMDA 3UNLA 3B4PA 3GZYB 4XDVA 3MG1A 3JUMA 2HMOB 2RFRA 3RGRA 2A15A 4I4KA 3ECFA 1DMNA 4XM4A 1O7GB 4K1VA 5DRVA 1UUVB 3F14A 1GY6A 1OF5A 4HZBB 4STDA 3E99A 7STDA 4HM5B 4N3VA 3IPTA 1W00A 1EG9B 3HK4A 3GWRA 3EN8A 1TUHA 2BMOB 2GXFA 2QIYA 2XSHB 5HGRA 4RZMA 3F8HA 3MHEA
chains in the Genus database with same CATH superfamily
4NPBA 2XF3A 3JUPA 1S5AA 1GOVA 1W02A 4KFEA 3NV0A 1GMQA 2OTJ3 3CCM3 3EJVA 5IF6A 5JPPA 3FCSB 1UUGB 1I3FA 2SBLA 1BNGA 3EC9A 1DVCA 3KSPA 3K0ZA 1PY3A 3ROBA 1VQO3 3UL6A 1WMNA 3HIIA 1OUNA 1ROAA 1BSBA 3DMCA 5EEOA 3VGNA 3NUVA 5HOHA 2W9QA 1JBSA 1PFPA 3OW22 3LTBA 5A0OB 1ASKA 5LC7A 1RNBA 1N8QA 4WP5A 2I9WA 3OWYA 5KP1A 5KP4A 4WHAA 1N8R4 3MYTA 3I553 4MJDA 5D83A 2IUJA 1LVNA 2AAEA 4J9AA 1U8CB 2OWPA 4WWUC 3X42A 1IK3A 1OCVA 5BXQA 6GSPA 1E3RA 1A2PA 3MKIA 2Q07A 2BMQB 3JUQA 3SOYA 1BRJA 1NWWA 1OHOA 5IG5A 3CCV3 4TX4A 1OACA 2RGQA 3OWSA 5ELJA 3WOEB 4CPKA 3KKGA 1I2EA 3LMLA 4IPBA 1I70A 3DH2A 1FUWA 4O3VA 4LSOA 5FW5A 4KT3B 5AI1A 2OQEA 1LNHA 1BU4A 2HMMB 1AV4A 3X3YA 2IA7A 1RGHA 1X1WA 3DGMA 2GEYA 5AEWB 2MC8A 1NB5I 3EB8A 3O8YA 2GEXA 2ZA4A 3MWZA 1OHPA 2CX0A 2HMJB 2FNQA 1W01A 2OTL3 2C10A 3CPOA 1KD14 1U5OA 4OK0A 2HMNB 3EN1B 1ZGXA 1UDII 2PZVA 1B27A 1STFI 3WDGB 3PCSA 4HM0B 1BRNL 1K28A 2BIRA 1O7WB 1T2IA 1A67A 2QGUA 1LOWA 5DREA 1YJW3 3U1WA 5IENA 5JBSA 3Q90A 1B2MA 1KWIA 4KFDA 4ILFA 1RCKA 3RNTA 2WOFA 4HM7B 2XSOB 1UCIA 1RGLA 4LEHA 2CK3H 5M19A 4L8OA 5CK6A 1RDSA 1X1YA 3UJMA 1VQ53 3LTAA 3DGOA 3RGAA 3AMOA 1I8VA 4WYKA 4ORLA 1JB4A 4XB5A 6RNTA 2H0HA 3EX9A 1YI23 4IT7A 2ML5A 1TFOA 1MWUA 2Y74A 3N9HA 1SIIA 3AHSA 3K9MC 4GB5A 4JF8A 4ZM8A 3LT8A 1RGAA 2L4VA 4N6OB 3X3XA 1RGCA 1IYYA 5FGOA 3I0YA 5KP3A 3K5TA 4N6MA 2BO9B 1TIJA 2INXA 1SIHA 2LQVA 1BSDA 3B8LA 1RHLA 3FG1A 4FMBA 4KVHA 1RGEA 1RJOA 3G8ZA 5GSPA 2YX9A 3GZXB 2WOHA 1FA3A 2KF6A 1AY7A 1JN5A 1OF5B 3NQYA 1SARA 2GSPA 3MG2A 3T0UA 8CHOA 1Q864 2IY2A 1NNVA 4AKYA 3BNBA 2SARA 2V1LA 1K9M4 1BRIA 1RGGA 2KRTA 3NX0A 3WOFB 3HX8A 4N6V0 4CDLA 7RNTA 1J2BA 1VQM3 1JV2B 2IUKA 1BSAA 1NDOB 2F4YA 1RN7A 4RNZA 1FW7A 1GY5A 1W7CA 1FGRA 3CCE3 3Q2PA 1GS3A 2KAAA 2OOVC 3NM2A 3QK9A 2CH9A 2Z76A 3KZTA 1DETA 4IIAA 3G6E3 1UI8A 1BSEA 1I2GA 1HYFA 1N5PA 1CEWI 3CCJ3 3D5IA 1N5HA 1O7HB 2P05A 4HYZA 4R9KA 1YIT3 4HVNA 3CPW2 1Z1SA 4HZ9B 1VQN3 1B21A 1UW1A 1G0TA 3DGNA 2Z77A 3JVCA 5D82A 1E3VA 3MSOA 3LZAA 2FGTA 1AR0A 4HM1B 3CU3A 2CFKA 2ML6A 5CF1A 3UB1A 3FF0A 1YVBI 5AIFA 1US1A 5CF2A 3F9SA 4U13A 2XRXB 1MGRA 2XR8B 1WNHA 3NV0B 2CKFB 1W5ZA 3PS8A 1GD4A 4R1KA 2K0MA 2D1WA 1FUTA 1UI7A 5IEOA 3EBYA 2STDA 4MMYB 1C54A 2GBWB 1RMSA 2YFJB 4LMIA 1V58A 1JBTA 4BL3A 2KF4A 3B7CA 3AHWA 4XDWA 3LYGA 3CNMA 3OWUA 3PYJA 1PU4A 1O7NB 3D9RA 4EYCA 3DY5A 1O7PB 2OQEC 2XFSA 3DGLA 3G16A 5IERA 3WHOA 1MWSA 4BTWA 1W6GA 2CFWA 2W6JH 1BRKA 4Q53A 1Q40A 1Y4KA 3NXJA 1SQWA 4XBXA 1I3IA 4N6TA 2W0QA 1VQP3 3WA3A 1K734 1BNFA 4HM8B 2F5MA 5IG0A 1CYVA 1DE3A 4N6NB 3F40A 1BUQA 1BANA 2KCDA 3BU4A 1AVKA 1CH0A 1ISKA 2CFLA 2OOVA 2MF7A 2XH9A 4CCVA 1ROVA 1I2FA 4R4KA 1KQS2 2ZL8A 1Q9EA 3NHXA 1BOXA 1BRHA 1D6YA 2WO0A 3EBTA 4EXRA 1GD3A 5BVBA 3CME3 1UUWB 1O7MB 1PYLA 1Q7HA 4KFFA 2R4IA 1LNIA 3D79A 5EVHA 3DZLA 1E97A 1RN1A 1KSIA 1W6YA 3N54B 1BNRA 1JRQA 3BNCA 1CYUA 1IT7A 4J5KA 2KXGA 4N6UA 1IVVA 1A2VA 4HM3B 3HZPA 2YFLB 5AYSC 3IJEB 5I97A 2K54A 2O9UX 2BHMA 4PEJA 8RNTA 1JKGA 1M1K4 3CD63 1DMQA 1JB5A 4OVMA 1S723 2JQ5A 5BIRA 1FZUA 3GSPA 4R9LA 3CCU3 1RSNA 3PXMA 2RBIA 1C7HA 1GSPA 1YVSA 1TP6A 3OV4A 2CIUA 1QMAA 1RN4A 3BB9A 1I0XA 1OGZA 2UUGC 5G1LA 4FR9A 2K3DA 2BT3A 2QA43 4MMZB 1HU9A 3LH4A 4RNYA 1RRHA 3G4S3 1JJ22 3A5EA 3CCR3 1QVF2 3ZG5A 1RLSA 3X41A 1HZ1A 1T3BA 1ULIB 1LOXA 3G0KA 4R80A 1QAFA 3D4AA 1IQXA 3BIRA 4H3UA 3VF1A 1OGXA 3URPA 3EE1A 3VSYA 3PGBA 2GBXB 1FYSA 3CCQ3 1JN5B 1IQYA 2E2VA 2WGQA 3NBRA 3ALAA 5G1KA 1V74A 2M7OA 1BUJA 3EF8A 3HI7A 3FZWA 3TDGA 4NREA 1EKMA 1L5GB 1K41A 4EBGA 1RTUA 3FH1A 1V57A 3CMA3 2AADA 3D3LA 3S29A 1GY7A 4XBTA 4K90B 1RNTA 2W2CA 5D81A 4BTXA 1YHQ3 2R41A 5LC6A 4MMXB 1G02A 2XGLA 1W6CA 1X1XA 1UCJA 2B24B 1I0VA 1TRPA 1RGFA 4LYLB 4XBYA 2P38A 1BNIA 1QJGA 4FMAA 4MEIA 3SYUA 3BNDA 1M904 1UGIA 3F8XA 1LQMB 2RSXA 2W56A 4K1UA 3S27A 2CFDA 1IT8A 1BSCA 1LRAA 3DGYA 3GZBA 4BU4A 3CC23 3V98A 3FGYA 5AIHA 3SX1A 5AIIA 3BLZA 3SXXA 1JBRA 3DM8A 4AEQA 1ULJB 3ER7A 4QWTA 1A2KA 2KF3A 3DUKA 3KSED 4X2OA 3SOAA 3KIIA 5AEUB 5TGNA 3CCS3 1BRSA 1VQ93 3BNEA 2JDIH 5IG3A 1BAOA 1D6ZA 4I5QA 4EW5A 3FKAA 4FCMA 1YJ93 1D6UA 2HMKB 4GL6A 3M8CA 3X3ZA 5ELUA 3LXUX 1STDA 1UCKA 5CLKA 4HAAA 1ZX2A 3JUNA 3K7CA 1JNQA 3FF2A 4O02B 3F7SA 4O2HA 3T8NA 4BIRA 2E2TA 2UX0A 2RNTA 3CCL3 1Q40B 3MPHA 4HM4B 3G713 1LQGC 2QEX3 4X2HA 3OX9A 1VQ63 2W9PA 3H3HA 4GSPA 1VQ43 1LXEA 2CWUA 4EC6A 3DXOA 2P0MA 3GRDA 5AIGA 2CG0A 1TU5A 1GYBA 1VZZA 2UGIA 3U97A 3V92A 1VQL3 5BU4A 4HBRA 4BTYA 1N9EA 1Q7Y4 1NJI4 2C11A 1Q42A 3LTDA 1FUSA 1FGTA 2RCDA 3B4OA 3PZWA 3S67A 4EV2A 1GOUA 1EQKA 1IVUA 1CQSA 1SJWA 3N8BA 1EUIC 5STDA 2FXTA 2XFTA 1OHSA 2F98A 5CXOA 1BVIA 4FCJA 1GMPA 3D5GA 1UGHI 1IDPA 2F5WA 1IVWA 3FLJA 1WMOA 1IU7A 2LYXA 2Z6BA 2CHCA 4HOHA 5G2GA 3S28A 4KZ1A 2CC3A 1JKGB 1JB2A 1B2SA 1T5YA 4FMCA 4FCZA 2Z7AA 1VQ73 1K8A4 1R4CA 1W2ZA 1W2B2 1Q824 1IV7A 4HJLB 1B2UA 1RGKA 1YNVX 2BMRB 1DMMA 4HM6B 2BNGA 4J8TA 3I563 1B20A 3FSDA 1WQLB 2ZHXB 2GU3A 1AQZA 5IG4A 3RDEA 3LT9A 5JPUA 1A90A 3WR2A 1BNSA 1DYUA 1WTHA 2J8XB 3J7Yd 1ZS7A 5EQLA 3MG3A 2F99A 1X1UA 1TRQA 3H51A 3KFQC 4L8PA 1EA2A 1OH0A 1IV9A 3AMOB 3Q1CA 4LGQA 4NHFA 5IEPA 4WYKB 1VQQA 3LOYA 4RNTA 2B1XB 3SEDA 3WA2X 1W4NA 3L0RA 3F7XA 2CX1A 2YFIB 3GZRA 3EQQB 1RCLA 3STDA 2OCTA 4HM2B 4EV5A 7GSPA 1Q814 1QVG2 3EHCA 2WGOA 3CNXA 3KN4A 3PCRA 3OXAA 4K61A 1OPYA 4OUQA 1WMPA 6STDA 1IVXA 5RNTA 3HOHA 4GHOA 1TFKA 9RNTA 1T2HA 2D42A 1YIJ3 1RKYA 2P0XA 1M1XB 3KCHA 3S5CA 1VQ83 4L7KA 3T8UA 3X40A 2HOHA 1FGMA 2CWTA 2L1SA 4HKVB 3CC43 2ZDJA 5M1AA 3JUOA 2PNCA 2IMJA 3A76A 2XGNA 3KE7A 1B2XA 1EEJA 1NU3A 2F86B 2HMLB 5AYRB 1TTOA 1HKXA 4JRFA 4DKIA 1ZO2A 1B2ZA 2O3OA 1M9GA 2W56B 1MGWA 1TJDA 3NBJA 2CFGA 3K63A 3WMDA 4CJNA 3UNLA 3B4PA 1F8NA 1MOLA 2Y73A 3GZYB 1UCLA 4XDVA 3FG4A 2KF5A 3MG1A 2W04A 3JUMA 2HMOB 1NB3I 1YGWA 3NBBA 1AVLA 2RFRA 3RGRA 1BNJA 1QAKA 3QRDA 2A15A 1GOYA 1R4YA 4I4KA 4RBNA 1YGEA 3Q3FA 1BNEA 4J5GA 1MWTA 2W03A 1DMNA 1FGOA 3ECFA 3CC73 4H61A 1B3SA 4XM4A 1IQ8A 1GMRA 3ZFZA 3HIGA 1O7GB 4K1VA 2CG1A 2CWVA 1LOYA 5DRVA 2IYJA 5M18A 4AKZA 1UUVB 2H0GA 3F14A 1GY6A 1OF5A 2P09A 4N6LA 3WODG 4HZBB 2XEPA 4STDA 1NO3A 1N9JA 3E99A 3NQZA 3LTCA 1JZDA 1FGQA 1QALA 3AGNA 7STDA 1MNLA 3SLUA 5IW9A 1RRLA 2BU4A 4HM5B 1G96A 3NM7A 4N3VA 3SVAA 1KC84 2F56A 3AGOA 3IPTA 1W00A 2GU1A 4G1MB 4BL2A 1EG9B 3HK4A 4WFOA 3GWRA 1BRGA 1BGSA 3IMAB 2E2UA 3EN8A 1YJN3 1SPUA 1TUHA 3ZG0A 1DVDA 4O8SA 2BMOB 1MWRA 2GXFA 2QIYA 1LOVA 3GAXA 4FMDA 2XSHB 1VQK3 4LZIA 1JZOA 5HGRA 4RZMA 3CXC2 2CW9A 3V99A 3UL5A 2C4BA 2H0IA 3FG3A 3F8HA 1BIRA 3MHEA
chains in the Genus database with same CATH topology
2XF3A 3JUPA 1S5AA 1W02A 4KFEA 3NV0A 2OTJ3 3CCM3 3EJVA 5IF6A 5JPPA 3FCSB 2SBLA 3EC9A 1DVCA 3KSPA 3K0ZA 3ROBA 1VQO3 3UL6A 1WMNA 3HIIA 1OUNA 1ROAA 3DMCA 3VGNA 5EEOA 3NUVA 2W9QA 1PFPA 3OW22 3LTBA 5A0OB 1ASKA 5LC7A 1N8QA 4WP5A 2I9WA 3OWYA 5KP1A 5KP4A 4WHAA 1N8R4 3MYTA 3I553 4MJDA 5D83A 2IUJA 1LVNA 4J9AA 1U8CB 2OWPA 4WWUC 3X42A 1IK3A 1OCVA 5BXQA 1E3RA 3MKIA 2Q07A 2BMQB 3JUQA 3SOYA 1NWWA 1OHOA 5IG5A 3CCV3 4TX4A 1OACA 2RGQA 3OWSA 5ELJA 3WOEB 1FUWA 3KKGA 3LMLA 4IPBA 4O3VA 4LSOA 5FW5A 5AI1A 2OQEA 1LNHA 2HMMB 1AV4A 3X3YA 2IA7A 3DGMA 2GEYA 5AEWB 2MC8A 1NB5I 3EB8A 3O8YA 2GEXA 3MWZA 1OHPA 2HMJB 2FNQA 1W01A 2OTL3 2C10A 3CPOA 1KD14 1U5OA 4OK0A 2HMNB 3EN1B 2PZVA 1STFI 3WDGB 3PCSA 4HM0B 1A67A 1K28A 1O7WB 2QGUA 5DREA 1YJW3 3U1WA 5IENA 5JBSA 3Q90A 1KWIA 4KFDA 2WOFA 4HM7B 2XSOB 4LEHA 2CK3H 4L8OA 5CK6A 3UJMA 1VQ53 3LTAA 3DGOA 3RGAA 3AMOA 4WYKA 4ORLA 1JB4A 4XB5A 3EX9A 1YI23 4IT7A 2ML5A 1TFOA 2Y74A 3N9HA 4GB5A 1SIIA 3K9MC 4JF8A 4ZM8A 3LT8A 2L4VA 4N6OB 3X3XA 5FGOA 3I0YA 5KP3A 3K5TA 4N6MA 2BO9B 1TIJA 2INXA 1SIHA 2LQVA 3B8LA 4FMBA 3FG1A 4KVHA 1RJOA 3G8ZA 2YX9A 3GZXB 2WOHA 1FA3A 1JN5A 1OF5B 3NQYA 3MG2A 3T0UA 8CHOA 1Q864 4AKYA 3BNBA 2V1LA 1K9M4 3NX0A 2KRTA 3WOFB 4CDLA 3HX8A 4N6V0 1J2BA 1VQM3 1JV2B 2IUKA 1NDOB 1RN7A 4RNZA 1GY5A 1W7CA 1FGRA 3CCE3 3Q2PA 1GS3A 2OOVC 3NM2A 3QK9A 2CH9A 2Z76A 3KZTA 4IIAA 3G6E3 1UI8A 1N5PA 1CEWI 3CCJ3 1N5HA 1O7HB 2P05A 4HYZA 4R9KA 1YIT3 4HVNA 3CPW2 1Z1SA 4HZ9B 1VQN3 1UW1A 3DGNA 2Z77A 3JVCA 5D82A 1E3VA 3MSOA 3LZAA 2FGTA 1AR0A 4HM1B 3CU3A 2CFKA 2ML6A 5CF1A 3UB1A 3FF0A 1YVBI 5AIFA 1US1A 5CF2A 3F9SA 4U13A 2XRXB 2XR8B 1WNHA 3NV0B 2CKFB 1W5ZA 3PS8A 1GD4A 4R1KA 2K0MA 2D1WA 1UI7A 5IEOA 3EBYA 2STDA 4MMYB 2GBWB 2YFJB 4LMIA 3B7CA 4XDWA 3LYGA 3CNMA 3OWUA 3PYJA 1PU4A 1O7NB 3D9RA 4EYCA 3DY5A 1O7PB 2OQEC 2XFSA 3DGLA 3G16A 5IERA 4BTWA 1W6GA 2CFWA 2W6JH 4Q53A 1Q40A 1Y4KA 3NXJA 1SQWA 4XBXA 4N6TA 2W0QA 1VQP3 3WA3A 1K734 4HM8B 5IG0A 1CYVA 4N6NB 3F40A 1BUQA 2KCDA 1AVKA 1ISKA 2CFLA 2OOVA 2MF7A 2XH9A 4CCVA 1ROVA 4R4KA 1KQS2 2ZL8A 5BVBA 3NHXA 2WO0A 1D6YA 3EBTA 4EXRA 1GD3A 3CME3 1UUWB 1O7MB 4KFFA 2R4IA 5EVHA 3DZLA 1E97A 1KSIA 1W6YA 3N54B 1JRQA 3BNCA 1CYUA 1IT7A 2KXGA 4N6UA 1IVVA 1A2VA 4HM3B 3HZPA 2YFLB 5AYSC 3IJEB 5I97A 2K54A 2O9UX 2BHMA 4PEJA 1M1K4 1JKGA 3CD63 1DMQA 1JB5A 4OVMA 1S723 2JQ5A 4R9LA 3CCU3 3PXMA 1C7HA 3OV4A 1TP6A 2CIUA 1QMAA 3BB9A 1OGZA 4FR9A 2BT3A 2QA43 4MMZB 1HU9A 3LH4A 4RNYA 1RRHA 3G4S3 1JJ22 3CCR3 1QVF2 3X41A 1ULIB 1LOXA 3G0KA 4R80A 1QAFA 1IQXA 4H3UA 3VF1A 1OGXA 3EE1A 3VSYA 3PGBA 2GBXB 3CCQ3 1JN5B 1IQYA 2E2VA 2WGQA 3NBRA 3ALAA 1V74A 2M7OA 3EF8A 3HI7A 3FZWA 3TDGA 4NREA 1EKMA 1L5GB 1K41A 4EBGA 3FH1A 3CMA3 3D3LA 3S29A 1GY7A 4XBTA 4K90B 5D81A 2W2CA 1YHQ3 4BTXA 5LC6A 4MMXB 2XGLA 1W6CA 2B24B 4XBYA 2P38A 1QJGA 4FMAA 4MEIA 3BNDA 1M904 3F8XA 2RSXA 2W56A 4K1UA 3S27A 2CFDA 1IT8A 3GZBA 3CC23 3V98A 3FGYA 5AIHA 3SX1A 5AIIA 3BLZA 3SXXA 3DM8A 4AEQA 1ULJB 3ER7A 4QWTA 1A2KA 3DUKA 3KSED 4X2OA 3SOAA 5AEUB 3KIIA 3CCS3 5TGNA 1VQ93 3BNEA 2JDIH 5IG3A 1D6ZA 3FKAA 4FCMA 1YJ93 1D6UA 2HMKB 4GL6A 3M8CA 3X3ZA 5ELUA 3LXUX 1STDA 5CLKA 1ZX2A 3JUNA 3K7CA 1JNQA 3FF2A 4O02B 3F7SA 4O2HA 3T8NA 2E2TA 2UX0A 3CCL3 1Q40B 3MPHA 4HM4B 3G713 2QEX3 4X2HA 3OX9A 1VQ63 2W9PA 3H3HA 1VQ43 1LXEA 2CWUA 4EC6A 3DXOA 2P0MA 3GRDA 5AIGA 2CG0A 1TU5A 1GYBA 1VZZA 3U97A 3V92A 1VQL3 4HBRA 4BTYA 1N9EA 1Q7Y4 1NJI4 2C11A 1Q42A 3LTDA 1FGTA 2RCDA 3B4OA 3PZWA 3S67A 4EV2A 1EQKA 1IVUA 1CQSA 1SJWA 3N8BA 5STDA 2FXTA 2XFTA 1OHSA 2F98A 5CXOA 4FCJA 1IDPA 1IVWA 3FLJA 1WMOA 1IU7A 2LYXA 2Z6BA 2CHCA 5G2GA 3S28A 4KZ1A 2CC3A 1JKGB 1JB2A 1T5YA 4FMCA 4FCZA 2Z7AA 1VQ73 1K8A4 1R4CA 1W2ZA 1W2B2 1Q824 1IV7A 4HJLB 4J8TA 1DMMA 2BMRB 4HM6B 2BNGA 3I563 3FSDA 1WQLB 2GU3A 5IG4A 3RDEA 3LT9A 5JPUA 1A90A 1DYUA 1WTHA 3J7Yd 5EQLA 3MG3A 2F99A 3H51A 4L8PA 3KFQC 1EA2A 1OH0A 1IV9A 3AMOB 3Q1CA 4LGQA 4NHFA 5IEPA 4WYKB 3LOYA 2B1XB 3SEDA 3WA2X 1W4NA 3L0RA 3F7XA 2YFIB 3GZRA 3EQQB 3STDA 2OCTA 4HM2B 4EV5A 1Q814 1QVG2 3EHCA 2WGOA 3CNXA 3KN4A 3PCRA 3OXAA 4K61A 1OPYA 4OUQA 1WMPA 6STDA 1IVXA 1TFKA 2D42A 1YIJ3 1RKYA 2P0XA 1M1XB 3S5CA 1VQ83 4L7KA 3T8UA 3X40A 1FGMA 2CWTA 4HKVB 3CC43 2ZDJA 3JUOA 2PNCA 2IMJA 3A76A 2XGNA 3KE7A 1NU3A 2F86B 2HMLB 5AYRB 1HKXA 4JRFA 1ZO2A 2O3OA 1M9GA 2W56B 3NBJA 2CFGA 3K63A 3WMDA 3UNLA 3B4PA 1F8NA 1MOLA 2Y73A 3GZYB 4XDVA 3FG4A 3MG1A 2W04A 3JUMA 2HMOB 1NB3I 3NBBA 1AVLA 2RFRA 3RGRA 1QAKA 3QRDA 2A15A 4I4KA 4RBNA 1YGEA 3ECFA 2W03A 1DMNA 1FGOA 3CC73 4H61A 4XM4A 1IQ8A 3HIGA 1O7GB 4K1VA 2CG1A 2CWVA 5DRVA 4AKZA 1UUVB 3F14A 1GY6A 1OF5A 2P09A 4N6LA 3WODG 4HZBB 2XEPA 4STDA 1NO3A 1N9JA 3E99A 3NQZA 3LTCA 1FGQA 1QALA 7STDA 1MNLA 3SLUA 5IW9A 1RRLA 4HM5B 1G96A 3NM7A 4N3VA 3SVAA 1KC84 3IPTA 1W00A 2GU1A 4G1MB 1EG9B 3HK4A 4WFOA 3GWRA 3IMAB 2E2UA 3EN8A 1YJN3 1SPUA 1TUHA 1DVDA 4O8SA 2BMOB 2GXFA 2QIYA 3GAXA 4FMDA 2XSHB 1VQK3 4LZIA 5HGRA 4RZMA 3CXC2 2CW9A 3V99A 3UL5A 3FG3A 3F8HA 3MHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JUP A;  1S5A A;  1W02 A;  3NV0 A;  3EJV A;  5IF6 A;  5JPP A;  3EC9 A;  3KSP A;  3K0Z A;  3ROB A;  1OUN A;  3DMC A;  3VGN A;  3NUV A;  1ASK A;  4WP5 A;  2I9W A;  3OWY A;  5KP1 A;  5KP4 A;  3MYT A;  4MJD A;  5D83 A;  4J9A A;  2OWP A;  4WWU C;  1OCV A;  5BXQ A;  1E3R A;  3MKI A;  2BMQ B;  3JUQ A;  3SOY A;  1NWW A;  1OHO A;  5IG5 A;  2RGQ A;  3OWS A;  3KKG A;  5FW5 A;  5AI1 A;  2HMM B;  2GEY A;  5AEW B;  2GEX A;  1OHP A;  2HMJ B;  1W01 A;  3CPO A;  1U5O A;  2HMN B;  3EN1 B;  2PZV A;  4HM0 B;  1O7W B;  2QGU A;  5DRE A;  5IEN A;  3Q90 A;  4HM7 B;  2XSO B;  4LEH A;  4L8O A;  5CK6 A;  3UJM A;  3RGA A;  4WYK A;  4ORL A;  1JB4 A;  4XB5 A;  3EX9 A;  4GB5 A;  3I0Y A;  5KP3 A;  2INX A;  3B8L A;  4KVH A;  3G8Z A;  3GZX B;  1JN5 A;  1OF5 B;  3MG2 A;  8CHO A;  4CDL A;  3HX8 A;  1NDO B;  1GY5 A;  1GS3 A;  3NM2 A;  2Z76 A;  3KZT A;  4IIA A;  1O7H B;  4R9K A;  4HVN A;  1Z1S A;  4HZ9 B;  2Z77 A;  5D82 A;  1E3V A;  3MSO A;  3LZA A;  4HM1 B;  1AR0 A;  3CU3 A;  5CF1 A;  3FF0 A;  5AIF A;  5CF2 A;  3F9S A;  4U13 A;  2XRX B;  2XR8 B;  3NV0 B;  2CKF B;  4R1K A;  5IEO A;  3EBY A;  2STD A;  2GBW B;  2YFJ B;  4LMI A;  3B7C A;  4XDW A;  3LYG A;  3CNM A;  3OWU A;  1O7N B;  3D9R A;  1O7P B;  3G16 A;  5IER A;  4Q53 A;  1Q40 A;  3NXJ A;  4XBX A;  4HM8 B;  5IG0 A;  3F40 A;  1BUQ A;  1ISK A;  5BVB A;  3NHX A;  3EBT A;  1UUW B;  1O7M B;  2R4I A;  5EVH A;  3DZL A;  1E97 A;  1W6Y A;  4HM3 B;  3HZP A;  2YFL B;  2K54 A;  4PEJ A;  1JKG A;  1DMQ A;  1JB5 A;  4OVM A;  2JQ5 A;  4R9L A;  1C7H A;  3OV4 A;  1TP6 A;  1QMA A;  3BB9 A;  1OGZ A;  1ULI B;  3G0K A;  4H3U A;  1OGX A;  3VSY A;  2GBX B;  1JN5 B;  3NBR A;  3EF8 A;  3FZW A;  1K41 A;  3FH1 A;  1GY7 A;  4XBT A;  5D81 A;  2W2C A;  2B24 B;  4XBY A;  1QJG A;  3F8X A;  4K1U A;  3GZB A;  3FGY A;  5AIH A;  5AII A;  3BLZ A;  3DM8 A;  1ULJ B;  3ER7 A;  3SOA A;  1A2K A;  3DUK A;  4X2O A;  5AEU B;  5TGN A;  5IG3 A;  3FKA A;  4FCM A;  2HMK B;  3M8C A;  1STD A;  5CLK A;  1ZX2 A;  3JUN A;  3K7C A;  3FF2 A;  3F7S A;  3T8N A;  2UX0 A;  1Q40 B;  4HM4 B;  4X2H A;  3OX9 A;  3H3H A;  3DXO A;  3GRD A;  5AIG A;  1GYB A;  1VZZ A;  1Q42 A;  2RCD A;  3B4O A;  1CQS A;  1SJW A;  5STD A;  1OHS A;  2F98 A;  5CXO A;  4FCJ A;  1IDP A;  3FLJ A;  2CHC A;  5G2G A;  1JKG B;  1JB2 A;  2Z7A A;  4HJL B;  4J8T A;  1DMM A;  2BMR B;  4HM6 B;  2BNG A;  3FSD A;  1WQL B;  5IG4 A;  5JPU A;  3MG3 A;  2F99 A;  3H51 A;  4L8P A;  1EA2 A;  1OH0 A;  4LGQ A;  5IEP A;  4WYK B;  2B1X B;  3SED A;  3F7X A;  2YFI B;  3GZR A;  3EQQ B;  3STD A;  4HM2 B;  3EHC A;  3CNX A;  3OXA A;  1OPY A;  4OUQ A;  6STD A;  3S5C A;  4L7K A;  3T8U A;  4HKV B;  3JUO A;  2IMJ A;  3A76 A;  3KE7 A;  1NU3 A;  2F86 B;  2HML B;  1HKX A;  1ZO2 A;  3WMD A;  3UNL A;  3B4P A;  3GZY B;  4XDV A;  3MG1 A;  3JUM A;  2HMO B;  2RFR A;  3RGR A;  2A15 A;  4I4K A;  3ECF A;  1DMN A;  4XM4 A;  1O7G B;  4K1V A;  5DRV A;  1UUV B;  3F14 A;  1GY6 A;  1OF5 A;  4HZB B;  4STD A;  3E99 A;  7STD A;  4HM5 B;  4N3V A;  3IPT A;  1W00 A;  1EG9 B;  3HK4 A;  3GWR A;  3EN8 A;  1TUH A;  2BMO B;  2GXF A;  2QIY A;  2XSH B;  5HGR A;  4RZM A;  3F8H A;  3MHE A; 
#chains in the Genus database with same CATH topology
 4NPB A;  2XF3 A;  3JUP A;  1S5A A;  1GOV A;  1W02 A;  4KFE A;  3NV0 A;  1GMQ A;  2OTJ 3;  3CCM 3;  3EJV A;  5IF6 A;  5JPP A;  3FCS B;  1UUG B;  1I3F A;  2SBL A;  1BNG A;  3EC9 A;  1DVC A;  3KSP A;  3K0Z A;  1PY3 A;  3ROB A;  1VQO 3;  3UL6 A;  1WMN A;  3HII A;  1OUN A;  1ROA A;  1BSB A;  3DMC A;  5EEO A;  3VGN A;  3NUV A;  5HOH A;  2W9Q A;  1JBS A;  1PFP A;  3OW2 2;  3LTB A;  5A0O B;  1ASK A;  5LC7 A;  1RNB A;  1N8Q A;  4WP5 A;  2I9W A;  3OWY A;  5KP1 A;  5KP4 A;  4WHA A;  1N8R 4;  3MYT A;  3I55 3;  4MJD A;  5D83 A;  2IUJ A;  1LVN A;  2AAE A;  4J9A A;  1U8C B;  2OWP A;  4WWU C;  3X42 A;  1IK3 A;  1OCV A;  5BXQ A;  6GSP A;  1E3R A;  1A2P A;  3MKI A;  2Q07 A;  2BMQ B;  3JUQ A;  3SOY A;  1BRJ A;  1NWW A;  1OHO A;  5IG5 A;  3CCV 3;  4TX4 A;  1OAC A;  2RGQ A;  3OWS A;  5ELJ A;  3WOE B;  4CPK A;  3KKG A;  1I2E A;  3LML A;  4IPB A;  1I70 A;  3DH2 A;  1FUW A;  4O3V A;  4LSO A;  5FW5 A;  4KT3 B;  5AI1 A;  2OQE A;  1LNH A;  1BU4 A;  2HMM B;  1AV4 A;  3X3Y A;  2IA7 A;  1RGH A;  1X1W A;  3DGM A;  2GEY A;  5AEW B;  2MC8 A;  1NB5 I;  3EB8 A;  3O8Y A;  2GEX A;  2ZA4 A;  3MWZ A;  1OHP A;  2CX0 A;  2HMJ B;  2FNQ A;  1W01 A;  2OTL 3;  2C10 A;  3CPO A;  1KD1 4;  1U5O A;  4OK0 A;  2HMN B;  3EN1 B;  1ZGX A;  1UDI I;  2PZV A;  1B27 A;  1STF I;  3WDG B;  3PCS A;  4HM0 B;  1BRN L;  1K28 A;  2BIR A;  1O7W B;  1T2I A;  1A67 A;  2QGU A;  1LOW A;  5DRE A;  1YJW 3;  3U1W A;  5IEN A;  5JBS A;  3Q90 A;  1B2M A;  1KWI A;  4KFD A;  4ILF A;  1RCK A;  3RNT A;  2WOF A;  4HM7 B;  2XSO B;  1UCI A;  1RGL A;  4LEH A;  2CK3 H;  5M19 A;  4L8O A;  5CK6 A;  1RDS A;  1X1Y A;  3UJM A;  1VQ5 3;  3LTA A;  3DGO A;  3RGA A;  3AMO A;  1I8V A;  4WYK A;  4ORL A;  1JB4 A;  4XB5 A;  6RNT A;  2H0H A;  3EX9 A;  1YI2 3;  4IT7 A;  2ML5 A;  1TFO A;  1MWU A;  2Y74 A;  3N9H A;  1SII A;  3AHS A;  3K9M C;  4GB5 A;  4JF8 A;  4ZM8 A;  3LT8 A;  1RGA A;  2L4V A;  4N6O B;  3X3X A;  1RGC A;  1IYY A;  5FGO A;  3I0Y A;  5KP3 A;  3K5T A;  4N6M A;  2BO9 B;  1TIJ A;  2INX A;  1SIH A;  2LQV A;  1BSD A;  3B8L A;  1RHL A;  3FG1 A;  4FMB A;  4KVH A;  1RGE A;  1RJO A;  3G8Z A;  5GSP A;  2YX9 A;  3GZX B;  2WOH A;  1FA3 A;  2KF6 A;  1AY7 A;  1JN5 A;  1OF5 B;  3NQY A;  1SAR A;  2GSP A;  3MG2 A;  3T0U A;  8CHO A;  1Q86 4;  2IY2 A;  1NNV A;  4AKY A;  3BNB A;  2SAR A;  2V1L A;  1K9M 4;  1BRI A;  1RGG A;  2KRT A;  3NX0 A;  3WOF B;  3HX8 A;  4N6V 0;  4CDL A;  7RNT A;  1J2B A;  1VQM 3;  1JV2 B;  2IUK A;  1BSA A;  1NDO B;  2F4Y A;  1RN7 A;  4RNZ A;  1FW7 A;  1GY5 A;  1W7C A;  1FGR A;  3CCE 3;  3Q2P A;  1GS3 A;  2KAA A;  2OOV C;  3NM2 A;  3QK9 A;  2CH9 A;  2Z76 A;  3KZT A;  1DET A;  4IIA A;  3G6E 3;  1UI8 A;  1BSE A;  1I2G A;  1HYF A;  1N5P A;  1CEW I;  3CCJ 3;  3D5I A;  1N5H A;  1O7H B;  2P05 A;  4HYZ A;  4R9K A;  1YIT 3;  4HVN A;  3CPW 2;  1Z1S A;  4HZ9 B;  1VQN 3;  1B21 A;  1UW1 A;  1G0T A;  3DGN A;  2Z77 A;  3JVC A;  5D82 A;  1E3V A;  3MSO A;  3LZA A;  2FGT A;  1AR0 A;  4HM1 B;  3CU3 A;  2CFK A;  2ML6 A;  5CF1 A;  3UB1 A;  3FF0 A;  1YVB I;  5AIF A;  1US1 A;  5CF2 A;  3F9S A;  4U13 A;  2XRX B;  1MGR A;  2XR8 B;  1WNH A;  3NV0 B;  2CKF B;  1W5Z A;  3PS8 A;  1GD4 A;  4R1K A;  2K0M A;  2D1W A;  1FUT A;  1UI7 A;  5IEO A;  3EBY A;  2STD A;  4MMY B;  1C54 A;  2GBW B;  1RMS A;  2YFJ B;  4LMI A;  1V58 A;  1JBT A;  4BL3 A;  2KF4 A;  3B7C A;  3AHW A;  4XDW A;  3LYG A;  3CNM A;  3OWU A;  3PYJ A;  1PU4 A;  1O7N B;  3D9R A;  4EYC A;  3DY5 A;  1O7P B;  2OQE C;  2XFS A;  3DGL A;  3G16 A;  5IER A;  3WHO A;  1MWS A;  4BTW A;  1W6G A;  2CFW A;  2W6J H;  1BRK A;  4Q53 A;  1Q40 A;  1Y4K A;  3NXJ A;  1SQW A;  4XBX A;  1I3I A;  4N6T A;  2W0Q A;  1VQP 3;  3WA3 A;  1K73 4;  1BNF A;  4HM8 B;  2F5M A;  5IG0 A;  1CYV A;  1DE3 A;  4N6N B;  3F40 A;  1BUQ A;  1BAN A;  2KCD A;  3BU4 A;  1AVK A;  1CH0 A;  1ISK A;  2CFL A;  2OOV A;  2MF7 A;  2XH9 A;  4CCV A;  1ROV A;  1I2F A;  4R4K A;  1KQS 2;  2ZL8 A;  1Q9E A;  3NHX A;  1BOX A;  1BRH A;  1D6Y A;  2WO0 A;  3EBT A;  4EXR A;  1GD3 A;  5BVB A;  3CME 3;  1UUW B;  1O7M B;  1PYL A;  1Q7H A;  4KFF A;  2R4I A;  1LNI A;  3D79 A;  5EVH A;  3DZL A;  1E97 A;  1RN1 A;  1KSI A;  1W6Y A;  3N54 B;  1BNR A;  1JRQ A;  3BNC A;  1CYU A;  1IT7 A;  4J5K A;  2KXG A;  4N6U A;  1IVV A;  1A2V A;  4HM3 B;  3HZP A;  2YFL B;  5AYS C;  3IJE B;  5I97 A;  2K54 A;  2O9U X;  2BHM A;  4PEJ A;  8RNT A;  1JKG A;  1M1K 4;  3CD6 3;  1DMQ A;  1JB5 A;  4OVM A;  1S72 3;  2JQ5 A;  5BIR A;  1FZU A;  3GSP A;  4R9L A;  3CCU 3;  1RSN A;  3PXM A;  2RBI A;  1C7H A;  1GSP A;  1YVS A;  1TP6 A;  3OV4 A;  2CIU A;  1QMA A;  1RN4 A;  3BB9 A;  1I0X A;  1OGZ A;  2UUG C;  5G1L A;  4FR9 A;  2K3D A;  2BT3 A;  2QA4 3;  4MMZ B;  1HU9 A;  3LH4 A;  4RNY A;  1RRH A;  3G4S 3;  1JJ2 2;  3A5E A;  3CCR 3;  1QVF 2;  3ZG5 A;  1RLS A;  3X41 A;  1HZ1 A;  1T3B A;  1ULI B;  1LOX A;  3G0K A;  4R80 A;  1QAF A;  3D4A A;  1IQX A;  3BIR A;  4H3U A;  3VF1 A;  1OGX A;  3URP A;  3EE1 A;  3VSY A;  3PGB A;  2GBX B;  1FYS A;  3CCQ 3;  1JN5 B;  1IQY A;  2E2V A;  2WGQ A;  3NBR A;  3ALA A;  5G1K A;  1V74 A;  2M7O A;  1BUJ A;  3EF8 A;  3HI7 A;  3FZW A;  3TDG A;  4NRE A;  1EKM A;  1L5G B;  1K41 A;  4EBG A;  1RTU A;  3FH1 A;  1V57 A;  3CMA 3;  2AAD A;  3D3L A;  3S29 A;  1GY7 A;  4XBT A;  4K90 B;  1RNT A;  2W2C A;  5D81 A;  4BTX A;  1YHQ 3;  2R41 A;  5LC6 A;  4MMX B;  1G02 A;  2XGL A;  1W6C A;  1X1X A;  1UCJ A;  2B24 B;  1I0V A;  1TRP A;  1RGF A;  4LYL B;  4XBY A;  2P38 A;  1BNI A;  1QJG A;  4FMA A;  4MEI A;  3SYU A;  3BND A;  1M90 4;  1UGI A;  3F8X A;  1LQM B;  2RSX A;  2W56 A;  4K1U A;  3S27 A;  2CFD A;  1IT8 A;  1BSC A;  1LRA A;  3DGY A;  3GZB A;  4BU4 A;  3CC2 3;  3V98 A;  3FGY A;  5AIH A;  3SX1 A;  5AII A;  3BLZ A;  3SXX A;  1JBR A;  3DM8 A;  4AEQ A;  1ULJ B;  3ER7 A;  4QWT A;  1A2K A;  2KF3 A;  3DUK A;  3KSE D;  4X2O A;  3SOA A;  3KII A;  5AEU B;  5TGN A;  3CCS 3;  1BRS A;  1VQ9 3;  3BNE A;  2JDI H;  5IG3 A;  1BAO A;  1D6Z A;  4I5Q A;  4EW5 A;  3FKA A;  4FCM A;  1YJ9 3;  1D6U A;  2HMK B;  4GL6 A;  3M8C A;  3X3Z A;  5ELU A;  3LXU X;  1STD A;  1UCK A;  5CLK A;  4HAA A;  1ZX2 A;  3JUN A;  3K7C A;  1JNQ A;  3FF2 A;  4O02 B;  3F7S A;  4O2H A;  3T8N A;  4BIR A;  2E2T A;  2UX0 A;  2RNT A;  3CCL 3;  1Q40 B;  3MPH A;  4HM4 B;  3G71 3;  1LQG C;  2QEX 3;  4X2H A;  3OX9 A;  1VQ6 3;  2W9P A;  3H3H A;  4GSP A;  1VQ4 3;  1LXE A;  2CWU A;  4EC6 A;  3DXO A;  2P0M A;  3GRD A;  5AIG A;  2CG0 A;  1TU5 A;  1GYB A;  1VZZ A;  2UGI A;  3U97 A;  3V92 A;  1VQL 3;  5BU4 A;  4HBR A;  4BTY A;  1N9E A;  1Q7Y 4;  1NJI 4;  2C11 A;  1Q42 A;  3LTD A;  1FUS A;  1FGT A;  2RCD A;  3B4O A;  3PZW A;  3S67 A;  4EV2 A;  1GOU A;  1EQK A;  1IVU A;  1CQS A;  1SJW A;  3N8B A;  1EUI C;  5STD A;  2FXT A;  2XFT A;  1OHS A;  2F98 A;  5CXO A;  1BVI A;  4FCJ A;  1GMP A;  3D5G A;  1UGH I;  1IDP A;  2F5W A;  1IVW A;  3FLJ A;  1WMO A;  1IU7 A;  2LYX A;  2Z6B A;  2CHC A;  4HOH A;  5G2G A;  3S28 A;  4KZ1 A;  2CC3 A;  1JKG B;  1JB2 A;  1B2S A;  1T5Y A;  4FMC A;  4FCZ A;  2Z7A A;  1VQ7 3;  1K8A 4;  1R4C A;  1W2Z A;  1W2B 2;  1Q82 4;  1IV7 A;  4HJL B;  1B2U A;  1RGK A;  1YNV X;  2BMR B;  1DMM A;  4HM6 B;  2BNG A;  4J8T A;  3I56 3;  1B20 A;  3FSD A;  1WQL B;  2ZHX B;  2GU3 A;  1AQZ A;  5IG4 A;  3RDE A;  3LT9 A;  5JPU A;  1A90 A;  3WR2 A;  1BNS A;  1DYU A;  1WTH A;  2J8X B;  3J7Y d;  1ZS7 A;  5EQL A;  3MG3 A;  2F99 A;  1X1U A;  1TRQ A;  3H51 A;  3KFQ C;  4L8P A;  1EA2 A;  1OH0 A;  1IV9 A;  3AMO B;  3Q1C A;  4LGQ A;  4NHF A;  5IEP A;  4WYK B;  1VQQ A;  3LOY A;  4RNT A;  2B1X B;  3SED A;  3WA2 X;  1W4N A;  3L0R A;  3F7X A;  2CX1 A;  2YFI B;  3GZR A;  3EQQ B;  1RCL A;  3STD A;  2OCT A;  4HM2 B;  4EV5 A;  7GSP A;  1Q81 4;  1QVG 2;  3EHC A;  2WGO A;  3CNX A;  3KN4 A;  3PCR A;  3OXA A;  4K61 A;  1OPY A;  4OUQ A;  1WMP A;  6STD A;  1IVX A;  5RNT A;  3HOH A;  4GHO A;  1TFK A;  9RNT A;  1T2H A;  2D42 A;  1YIJ 3;  1RKY A;  2P0X A;  1M1X B;  3KCH A;  3S5C A;  1VQ8 3;  4L7K A;  3T8U A;  3X40 A;  2HOH A;  1FGM A;  2CWT A;  2L1S A;  4HKV B;  3CC4 3;  2ZDJ A;  5M1A A;  3JUO A;  2PNC A;  2IMJ A;  3A76 A;  2XGN A;  3KE7 A;  1B2X A;  1EEJ A;  1NU3 A;  2F86 B;  2HML B;  5AYR B;  1TTO A;  1HKX A;  4JRF A;  4DKI A;  1ZO2 A;  1B2Z A;  2O3O A;  1M9G A;  2W56 B;  1MGW A;  1TJD A;  3NBJ A;  2CFG A;  3K63 A;  3WMD A;  4CJN A;  3UNL A;  3B4P A;  1F8N A;  1MOL A;  2Y73 A;  3GZY B;  1UCL A;  4XDV A;  3FG4 A;  2KF5 A;  3MG1 A;  2W04 A;  3JUM A;  2HMO B;  1NB3 I;  1YGW A;  3NBB A;  1AVL A;  2RFR A;  3RGR A;  1BNJ A;  1QAK A;  3QRD A;  2A15 A;  1GOY A;  1R4Y A;  4I4K A;  4RBN A;  1YGE A;  3Q3F A;  1BNE A;  4J5G A;  1MWT A;  2W03 A;  1DMN A;  1FGO A;  3ECF A;  3CC7 3;  4H61 A;  1B3S A;  4XM4 A;  1IQ8 A;  1GMR A;  3ZFZ A;  3HIG A;  1O7G B;  4K1V A;  2CG1 A;  2CWV A;  1LOY A;  5DRV A;  2IYJ A;  5M18 A;  4AKZ A;  1UUV B;  2H0G A;  3F14 A;  1GY6 A;  1OF5 A;  2P09 A;  4N6L A;  3WOD G;  4HZB B;  2XEP A;  4STD A;  1NO3 A;  1N9J A;  3E99 A;  3NQZ A;  3LTC A;  1JZD A;  1FGQ A;  1QAL A;  3AGN A;  7STD A;  1MNL A;  3SLU A;  5IW9 A;  1RRL A;  2BU4 A;  4HM5 B;  1G96 A;  3NM7 A;  4N3V A;  3SVA A;  1KC8 4;  2F56 A;  3AGO A;  3IPT A;  1W00 A;  2GU1 A;  4G1M B;  4BL2 A;  1EG9 B;  3HK4 A;  4WFO A;  3GWR A;  1BRG A;  1BGS A;  3IMA B;  2E2U A;  3EN8 A;  1YJN 3;  1SPU A;  1TUH A;  3ZG0 A;  1DVD A;  4O8S A;  2BMO B;  1MWR A;  2GXF A;  2QIY A;  1LOV A;  3GAX A;  4FMD A;  2XSH B;  1VQK 3;  4LZI A;  1JZO A;  5HGR A;  4RZM A;  3CXC 2;  2CW9 A;  3V99 A;  3UL5 A;  2C4B A;  2H0I A;  3FG3 A;  3F8H A;  1BIR A;  3MHE A; 
#chains in the Genus database with same CATH homology
 2XF3 A;  3JUP A;  1S5A A;  1W02 A;  4KFE A;  3NV0 A;  2OTJ 3;  3CCM 3;  3EJV A;  5IF6 A;  5JPP A;  3FCS B;  2SBL A;  3EC9 A;  1DVC A;  3KSP A;  3K0Z A;  3ROB A;  1VQO 3;  3UL6 A;  1WMN A;  3HII A;  1OUN A;  1ROA A;  3DMC A;  3VGN A;  5EEO A;  3NUV A;  2W9Q A;  1PFP A;  3OW2 2;  3LTB A;  5A0O B;  1ASK A;  5LC7 A;  1N8Q A;  4WP5 A;  2I9W A;  3OWY A;  5KP1 A;  5KP4 A;  4WHA A;  1N8R 4;  3MYT A;  3I55 3;  4MJD A;  5D83 A;  2IUJ A;  1LVN A;  4J9A A;  1U8C B;  2OWP A;  4WWU C;  3X42 A;  1IK3 A;  1OCV A;  5BXQ A;  1E3R A;  3MKI A;  2Q07 A;  2BMQ B;  3JUQ A;  3SOY A;  1NWW A;  1OHO A;  5IG5 A;  3CCV 3;  4TX4 A;  1OAC A;  2RGQ A;  3OWS A;  5ELJ A;  3WOE B;  1FUW A;  3KKG A;  3LML A;  4IPB A;  4O3V A;  4LSO A;  5FW5 A;  5AI1 A;  2OQE A;  1LNH A;  2HMM B;  1AV4 A;  3X3Y A;  2IA7 A;  3DGM A;  2GEY A;  5AEW B;  2MC8 A;  1NB5 I;  3EB8 A;  3O8Y A;  2GEX A;  3MWZ A;  1OHP A;  2HMJ B;  2FNQ A;  1W01 A;  2OTL 3;  2C10 A;  3CPO A;  1KD1 4;  1U5O A;  4OK0 A;  2HMN B;  3EN1 B;  2PZV A;  1STF I;  3WDG B;  3PCS A;  4HM0 B;  1A67 A;  1K28 A;  1O7W B;  2QGU A;  5DRE A;  1YJW 3;  3U1W A;  5IEN A;  5JBS A;  3Q90 A;  1KWI A;  4KFD A;  2WOF A;  4HM7 B;  2XSO B;  4LEH A;  2CK3 H;  4L8O A;  5CK6 A;  3UJM A;  1VQ5 3;  3LTA A;  3DGO A;  3RGA A;  3AMO A;  4WYK A;  4ORL A;  1JB4 A;  4XB5 A;  3EX9 A;  1YI2 3;  4IT7 A;  2ML5 A;  1TFO A;  2Y74 A;  3N9H A;  4GB5 A;  1SII A;  3K9M C;  4JF8 A;  4ZM8 A;  3LT8 A;  2L4V A;  4N6O B;  3X3X A;  5FGO A;  3I0Y A;  5KP3 A;  3K5T A;  4N6M A;  2BO9 B;  1TIJ A;  2INX A;  1SIH A;  2LQV A;  3B8L A;  4FMB A;  3FG1 A;  4KVH A;  1RJO A;  3G8Z A;  2YX9 A;  3GZX B;  2WOH A;  1FA3 A;  1JN5 A;  1OF5 B;  3NQY A;  3MG2 A;  3T0U A;  8CHO A;  1Q86 4;  4AKY A;  3BNB A;  2V1L A;  1K9M 4;  3NX0 A;  2KRT A;  3WOF B;  4CDL A;  3HX8 A;  4N6V 0;  1J2B A;  1VQM 3;  1JV2 B;  2IUK A;  1NDO B;  1RN7 A;  4RNZ A;  1GY5 A;  1W7C A;  1FGR A;  3CCE 3;  3Q2P A;  1GS3 A;  2OOV C;  3NM2 A;  3QK9 A;  2CH9 A;  2Z76 A;  3KZT A;  4IIA A;  3G6E 3;  1UI8 A;  1N5P A;  1CEW I;  3CCJ 3;  1N5H A;  1O7H B;  2P05 A;  4HYZ A;  4R9K A;  1YIT 3;  4HVN A;  3CPW 2;  1Z1S A;  4HZ9 B;  1VQN 3;  1UW1 A;  3DGN A;  2Z77 A;  3JVC A;  5D82 A;  1E3V A;  3MSO A;  3LZA A;  2FGT A;  1AR0 A;  4HM1 B;  3CU3 A;  2CFK A;  2ML6 A;  5CF1 A;  3UB1 A;  3FF0 A;  1YVB I;  5AIF A;  1US1 A;  5CF2 A;  3F9S A;  4U13 A;  2XRX B;  2XR8 B;  1WNH A;  3NV0 B;  2CKF B;  1W5Z A;  3PS8 A;  1GD4 A;  4R1K A;  2K0M A;  2D1W A;  1UI7 A;  5IEO A;  3EBY A;  2STD A;  4MMY B;  2GBW B;  2YFJ B;  4LMI A;  3B7C A;  4XDW A;  3LYG A;  3CNM A;  3OWU A;  3PYJ A;  1PU4 A;  1O7N B;  3D9R A;  4EYC A;  3DY5 A;  1O7P B;  2OQE C;  2XFS A;  3DGL A;  3G16 A;  5IER A;  4BTW A;  1W6G A;  2CFW A;  2W6J H;  4Q53 A;  1Q40 A;  1Y4K A;  3NXJ A;  1SQW A;  4XBX A;  4N6T A;  2W0Q A;  1VQP 3;  3WA3 A;  1K73 4;  4HM8 B;  5IG0 A;  1CYV A;  4N6N B;  3F40 A;  1BUQ A;  2KCD A;  1AVK A;  1ISK A;  2CFL A;  2OOV A;  2MF7 A;  2XH9 A;  4CCV A;  1ROV A;  4R4K A;  1KQS 2;  2ZL8 A;  5BVB A;  3NHX A;  2WO0 A;  1D6Y A;  3EBT A;  4EXR A;  1GD3 A;  3CME 3;  1UUW B;  1O7M B;  4KFF A;  2R4I A;  5EVH A;  3DZL A;  1E97 A;  1KSI A;  1W6Y A;  3N54 B;  1JRQ A;  3BNC A;  1CYU A;  1IT7 A;  2KXG A;  4N6U A;  1IVV A;  1A2V A;  4HM3 B;  3HZP A;  2YFL B;  5AYS C;  3IJE B;  5I97 A;  2K54 A;  2O9U X;  2BHM A;  4PEJ A;  1M1K 4;  1JKG A;  3CD6 3;  1DMQ A;  1JB5 A;  4OVM A;  1S72 3;  2JQ5 A;  4R9L A;  3CCU 3;  3PXM A;  1C7H A;  3OV4 A;  1TP6 A;  2CIU A;  1QMA A;  3BB9 A;  1OGZ A;  4FR9 A;  2BT3 A;  2QA4 3;  4MMZ B;  1HU9 A;  3LH4 A;  4RNY A;  1RRH A;  3G4S 3;  1JJ2 2;  3CCR 3;  1QVF 2;  3X41 A;  1ULI B;  1LOX A;  3G0K A;  4R80 A;  1QAF A;  1IQX A;  4H3U A;  3VF1 A;  1OGX A;  3EE1 A;  3VSY A;  3PGB A;  2GBX B;  3CCQ 3;  1JN5 B;  1IQY A;  2E2V A;  2WGQ A;  3NBR A;  3ALA A;  1V74 A;  2M7O A;  3EF8 A;  3HI7 A;  3FZW A;  3TDG A;  4NRE A;  1EKM A;  1L5G B;  1K41 A;  4EBG A;  3FH1 A;  3CMA 3;  3D3L A;  3S29 A;  1GY7 A;  4XBT A;  4K90 B;  5D81 A;  2W2C A;  1YHQ 3;  4BTX A;  5LC6 A;  4MMX B;  2XGL A;  1W6C A;  2B24 B;  4XBY A;  2P38 A;  1QJG A;  4FMA A;  4MEI A;  3BND A;  1M90 4;  3F8X A;  2RSX A;  2W56 A;  4K1U A;  3S27 A;  2CFD A;  1IT8 A;  3GZB A;  3CC2 3;  3V98 A;  3FGY A;  5AIH A;  3SX1 A;  5AII A;  3BLZ A;  3SXX A;  3DM8 A;  4AEQ A;  1ULJ B;  3ER7 A;  4QWT A;  1A2K A;  3DUK A;  3KSE D;  4X2O A;  3SOA A;  5AEU B;  3KII A;  3CCS 3;  5TGN A;  1VQ9 3;  3BNE A;  2JDI H;  5IG3 A;  1D6Z A;  3FKA A;  4FCM A;  1YJ9 3;  1D6U A;  2HMK B;  4GL6 A;  3M8C A;  3X3Z A;  5ELU A;  3LXU X;  1STD A;  5CLK A;  1ZX2 A;  3JUN A;  3K7C A;  1JNQ A;  3FF2 A;  4O02 B;  3F7S A;  4O2H A;  3T8N A;  2E2T A;  2UX0 A;  3CCL 3;  1Q40 B;  3MPH A;  4HM4 B;  3G71 3;  2QEX 3;  4X2H A;  3OX9 A;  1VQ6 3;  2W9P A;  3H3H A;  1VQ4 3;  1LXE A;  2CWU A;  4EC6 A;  3DXO A;  2P0M A;  3GRD A;  5AIG A;  2CG0 A;  1TU5 A;  1GYB A;  1VZZ A;  3U97 A;  3V92 A;  1VQL 3;  4HBR A;  4BTY A;  1N9E A;  1Q7Y 4;  1NJI 4;  2C11 A;  1Q42 A;  3LTD A;  1FGT A;  2RCD A;  3B4O A;  3PZW A;  3S67 A;  4EV2 A;  1EQK A;  1IVU A;  1CQS A;  1SJW A;  3N8B A;  5STD A;  2FXT A;  2XFT A;  1OHS A;  2F98 A;  5CXO A;  4FCJ A;  1IDP A;  1IVW A;  3FLJ A;  1WMO A;  1IU7 A;  2LYX A;  2Z6B A;  2CHC A;  5G2G A;  3S28 A;  4KZ1 A;  2CC3 A;  1JKG B;  1JB2 A;  1T5Y A;  4FMC A;  4FCZ A;  2Z7A A;  1VQ7 3;  1K8A 4;  1R4C A;  1W2Z A;  1W2B 2;  1Q82 4;  1IV7 A;  4HJL B;  4J8T A;  1DMM A;  2BMR B;  4HM6 B;  2BNG A;  3I56 3;  3FSD A;  1WQL B;  2GU3 A;  5IG4 A;  3RDE A;  3LT9 A;  5JPU A;  1A90 A;  1DYU A;  1WTH A;  3J7Y d;  5EQL A;  3MG3 A;  2F99 A;  3H51 A;  4L8P A;  3KFQ C;  1EA2 A;  1OH0 A;  1IV9 A;  3AMO B;  3Q1C A;  4LGQ A;  4NHF A;  5IEP A;  4WYK B;  3LOY A;  2B1X B;  3SED A;  3WA2 X;  1W4N A;  3L0R A;  3F7X A;  2YFI B;  3GZR A;  3EQQ B;  3STD A;  2OCT A;  4HM2 B;  4EV5 A;  1Q81 4;  1QVG 2;  3EHC A;  2WGO A;  3CNX A;  3KN4 A;  3PCR A;  3OXA A;  4K61 A;  1OPY A;  4OUQ A;  1WMP A;  6STD A;  1IVX A;  1TFK A;  2D42 A;  1YIJ 3;  1RKY A;  2P0X A;  1M1X B;  3S5C A;  1VQ8 3;  4L7K A;  3T8U A;  3X40 A;  1FGM A;  2CWT A;  4HKV B;  3CC4 3;  2ZDJ A;  3JUO A;  2PNC A;  2IMJ A;  3A76 A;  2XGN A;  3KE7 A;  1NU3 A;  2F86 B;  2HML B;  5AYR B;  1HKX A;  4JRF A;  1ZO2 A;  2O3O A;  1M9G A;  2W56 B;  3NBJ A;  2CFG A;  3K63 A;  3WMD A;  3UNL A;  3B4P A;  1F8N A;  1MOL A;  2Y73 A;  3GZY B;  4XDV A;  3FG4 A;  3MG1 A;  2W04 A;  3JUM A;  2HMO B;  1NB3 I;  3NBB A;  1AVL A;  2RFR A;  3RGR A;  1QAK A;  3QRD A;  2A15 A;  4I4K A;  4RBN A;  1YGE A;  3ECF A;  2W03 A;  1DMN A;  1FGO A;  3CC7 3;  4H61 A;  4XM4 A;  1IQ8 A;  3HIG A;  1O7G B;  4K1V A;  2CG1 A;  2CWV A;  5DRV A;  4AKZ A;  1UUV B;  3F14 A;  1GY6 A;  1OF5 A;  2P09 A;  4N6L A;  3WOD G;  4HZB B;  2XEP A;  4STD A;  1NO3 A;  1N9J A;  3E99 A;  3NQZ A;  3LTC A;  1FGQ A;  1QAL A;  7STD A;  1MNL A;  3SLU A;  5IW9 A;  1RRL A;  4HM5 B;  1G96 A;  3NM7 A;  4N3V A;  3SVA A;  1KC8 4;  3IPT A;  1W00 A;  2GU1 A;  4G1M B;  1EG9 B;  3HK4 A;  4WFO A;  3GWR A;  3IMA B;  2E2U A;  3EN8 A;  1YJN 3;  1SPU A;  1TUH A;  1DVD A;  4O8S A;  2BMO B;  2GXF A;  2QIY A;  3GAX A;  4FMD A;  2XSH B;  1VQK 3;  4LZI A;  5HGR A;  4RZM A;  3CXC 2;  2CW9 A;  3V99 A;  3UL5 A;  3FG3 A;  3F8H A;  3MHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...