1W01A

Crystal structure of mutant enzyme y57f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
molecule tags Isomerase
source organism Pseudomonas putida
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B.
pubmed doi rcsb
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w01A00
5AIIA 5IEPA 3MHEA 3A76A 3B4OA 3F7SA 3MG1A 4HM0B 4HM4B 3IPTA 3K0ZA 4LMIA 5CXOA 2BMRB 3B4PA 3OWSA 3UJMA 2GEXA 1OGXA 1Q40B 3JUPA 3EN1B 3ER7A 1JN5B 7STDA 4J9AA 1GS3A 1O7MB 3FKAA 5HGRA 4J8TA 5IENA 2GBWB 1AR0A 3EHCA 1OUNA 3NV0B 5IG0A 3LYGA 1E3VA 3NXJA 3OV4A 4WYKA 5AIHA 5DRVA 5IG4A 2I9WA 3B8LA 2QIYA 3G0KA 4H3UA 3DM8A 2R4IA 3NUVA 4R9LA 5IEOA 1ISKA 3FZWA 2Z76A 3F7XA 3CNMA 2HMOB 1TP6A 3FSDA 4IIAA 3STDA 1HKXA 1ZX2A 2HMMB 3F8HA 3EN8A 1IDPA 2GEYA 1O7NB 1DMNA 1STDA 1W02A 2Z7AA 3H3HA 1E3RA 4GB5A 1DMMA 3HX8A 1OF5A 3VGNA 2STDA 4RZMA 5D82A 5CF2A 1EG9B 5KP1A 1U5OA 4FCJA 3GZBA 2HMKB 5JPUA 4R1KA 4K1UA 3GWRA 5AEUB 3OXAA 3FF0A 1A2KA 4L8OA 1OPYA 1S5AA 3D9RA 3F40A 2PZVA 5CF1A 2K54A 1QMAA 4WP5A 4XDWA 1JB5A 1OGZA 1Q40A 1W6YA 2BMOB 1GY5A 3KKGA 5IF6A 5BVBA 3JUOA 2BMQB 3E99A 5IG3A 4WYKB 5G2GA 4L8PA 2GBXB 2JQ5A 3CNXA 1GY7A 3EX9A 1NWWA 3RGRA 6STDA 3KZTA 3OWUA 3HZPA 1O7GB 3ROBA 1E97A 2XSHB 1K41A 1W01A 1QJGA 2INXA 3CU3A 4XBYA 1CQSA 4LGQA 5AI1A 3RGAA 3SEDA 3T8NA 5IG5A 5JPPA 2RCDA 2IMJA 2W2CA 3BLZA 1OHOA 3EF8A 4HM1B 1OHPA 4HM8B 1GYBA 3G8ZA 4WWUC 8CHOA 4XBXA 4PEJA 5KP3A 5EVHA 3G16A 4STDA 1ZO2A 3SOAA 3MSOA 3MYTA 3ECFA 1EA2A 3EBYA 5CK6A 4HM2B 4HVNA 4LEHA 5D81A 1SJWA 3FH1A 2GXFA 1NDOB 1OH0A 1NU3A 1WQLB 2HMLB 4ORLA 5STDA 2HMJB 5TGNA 5KP4A 2B24B 4HKVB 3KE7A 4L7KA 1JKGA 3OX9A 3BB9A 3DMCA 3FLJA 3H51A 3NV0A 1Z1SA 1TUHA 3FGYA 5AIFA 1ULIB 3NBRA 1DMQA 3S5CA 3SOYA 2XRXB 3T8UA 3Q90A 3MG3A 2RFRA 2YFJB 2B1XB 4X2OA 5DREA 4HM3B 1BUQA 5FW5A 4X2HA 5CLKA 5BXQA 2OWPA 3DXOA 4N3VA 4HJLB 1OHSA 2HMNB 3UNLA 1ASKA 1JB4A 1JN5A 3LZAA 4R9KA 3WMDA 3OWYA 4KVHA 4XM4A 5AEWB 4K1VA 3EBTA 1OCVA 2RGQA 1O7HB 1UUVB 2XR8B 2YFIB 3JUQA 2XSOB 5AIGA 3GZRA 4HM6B 4HZBB 1C7HA 3FF2A 2BNGA 4OUQA 4OVMA 4XB5A 2F98A 3EC9A 3EJVA 4FCMA 4HM7B 3GZXB 4Q53A 4U13A 5IERA 4XDVA 3MKIA 3NHXA 2CHCA 2YFLB 1JKGB 2F86B 2F99A 3F8XA 3M8CA 4I4KA 4CDLA 2Z77A 3F14A 3GRDA 3I0YA 3VSYA 1UUWB 1GY6A 3NM2A 1O7WB 4MJDA 1JB2A 1VZZA 4XBTA 5D83A 4HZ9B 3KSPA 2CKFB 1Q42A 1ULJB 3GZYB 3JUMA 3DUKA 1OF5B 2A15A 3EQQB 1O7PB 2QGUA 2UX0A 3CPOA 3JUNA 3K7CA 3MG2A 3F9SA 1W00A 3DZLA 3HK4A 4HM5B 3B7CA
chains in the Genus database with same CATH superfamily
5M19A 3B4OA 1QAFA 3UJMA 1AQZA 1G96A 3B4PA 5JBSA 3PYJA 4EV2A 1IQXA 1I70A 4KFEA 1VQ83 3ZG0A 6GSPA 2XFSA 1I3FA 4J9AA 1GS3A 2RNTA 3G713 2LYXA 4J8TA 5IENA 1VQ63 1B20A 3O8YA 3OV4A 1YJW3 2RSXA 3HOHA 4QWTA 3CMA3 1S723 5IG4A 2QEX3 3Q1CA 3G0KA 4R9LA 3FG4A 3CPW2 3NUVA 4HYZA 2ZDJA 1FGMA 3I563 3CNMA 3FSDA 1B2XA 1C54A 2GEYA 2Z7AA 3CCV3 1DMMA 1MGWA 1UI8A 3HX8A 5M18A 2W04A 1OF5A 2Q07A 3EE1A 5KP1A 1EG9B 2XGLA 1B27A 2HMKB 5JPUA 9RNTA 2CFLA 1ZGXA 2GU3A 2KRTA 1S5AA 2CG1A 1LOWA 1T2IA 4NHFA 5CF1A 4WP5A 2PNCA 1W6YA 2BMOB 1Y4KA 1JNQA 4AEQA 1IV9A 5IF6A 1VQL3 3D5IA 3JUOA 3WA3A 1UDII 3IMAB 1GY7A 3EX9A 2CW9A 2AAEA 1FGRA 1O7GB 1X1XA 1ZS7A 1T3BA 1MWRA 1ROAA 2XSHB 1K41A 2INXA 5IERA 1NJI4 4JF8A 3CCJ3 2CWTA 4N6LA 2RCDA 2IMJA 3U97A 4HM8B 3PGBA 1OHPA 4EYCA 1IT7A 2M7OA 1WTHA 4PEJA 4XBXA 1TFOA 3G16A 3LTCA 2P0XA 4FR9A 3ECFA 4HBRA 1EA2A 5CK6A 2E2TA 1TTOA 4HVNA 5GSPA 1K734 2GXFA 1JV2B 1NDOB 5TGNA 1RLSA 2KF3A 3HI7A 5KP4A 4MMZB 1RCKA 1JBSA 1TUHA 3AGOA 1A67A 2P09A 4CPKA 3CC73 1IVVA 3SOYA 2O9UX 2RFRA 3CCE3 4X2OA 7RNTA 1RSNA 4BTXA 1BUQA 5FW5A 3LTAA 5BXQA 2OWPA 4FMCA 1KD14 1BOXA 1EQKA 1D6UA 3UNLA 1ASKA 1UCIA 4N6UA 1BGSA 1G0TA 1RMSA 4HAAA 2CFDA 4KVHA 1IU7A 1A90A 3EBTA 2C11A 2D1WA 2RGQA 2XR8B 2YFIB 5RNTA 3CCL3 4HM6B 4HZBB 1FA3A 2BNGA 1QAKA 1X1UA 4GSPA 1BNFA 3EC9A 4HM7B 3A5EA 3N54B 4KZ1A 4Q53A 2WOHA 3NQZA 1IVWA 1SIHA 2F5MA 4I4KA 2F86B 2F99A 3D79A 4K90B 1N5HA 1VQ53 3F14A 3I0YA 1W6GA 1PYLA 2H0HA 3CD63 1O7WB 1HYFA 2Y74A 4IT7A 1VZZA 2CWUA 4FMAA 4XBTA 2UGIA 3S29A 2OOVC 4RNYA 1N8QA 1KQS2 1R4CA 3GZYB 4WFOA 1VQM3 2JDIH 3X42A 1O7PB 2UX0A 3CPOA 3MWZA 3V98A 1FUWA 2L4VA 1ROVA 1YNVX 2ML6A 1YJ93 1VQQA 1BNRA 3V92A 3URPA 2CFGA 5IEPA 3MHEA 3A76A 1V57A 3F7SA 3MG1A 4HM0B 1EUIC 2W9PA 3K0ZA 2HOHA 4JRFA 3V99A 1BSDA 1B2ZA 1OGXA 4H61A 1VQ43 3JUPA 1BSCA 1JN5B 3FKAA 1M1K4 2GBWB 1AR0A 1RN7A 1OUNA 3PZWA 4N6MA 4RNTA 1UW1A 1I2EA 3L0RA 3AMOB 1RGAA 3CC43 2Z76A 4FMBA 3BNBA 1DETA 1AV4A 1F8NA 5AYSC 4LYLB 5M1AA 3SXXA 1HKXA 1ZX2A 5G1KA 1BSEA 1IDPA 3H3HA 1W02A 1NO3A 3D5GA 2BHMA 1RJOA 4N6TA 3NX0A 1GOUA 4DKIA 1FZUA 3FG1A 1SARA 2OCTA 4FCJA 3GZBA 2D42A 4R1KA 1BNIA 2UUGC 3FF0A 1A2KA 2BT3A 5A0OB 2OTL3 3D9RA 3ZFZA 3UB1A 1YJN3 1BAOA 1GMRA 1RNBA 1VQ93 1I2GA 3BNDA 5BIRA 2O3OA 3LTBA 1I3IA 1YVSA 4WYKB 3CXC2 3RGRA 1MWUA 1IT8A 1YGWA 1RGGA 3FG3A 1KC84 1RNTA 1Q864 1BRJA 3ROBA 1QJGA 3RGAA 1LOXA 1CQSA 2P05A 1HU9A 2W2CA 3EF8A 3GAXA 4HM1B 2CC3A 4WWUC 1GYBA 1R4YA 4N6OB 5KP3A 3SOAA 3X41A 2MF7A 3NBBA 1BNGA 2Y73A 1BNJA 3SX1A 1DVCA 2XF3A 1VQO3 4ORLA 1OH0A 5STDA 4EW5A 1Q7HA 2B24B 2IUKA 4HKVB 1BRHA 1LQMB 2BO9B 3OX9A 3BB9A 3FCSB 1X1WA 1YI23 4MEIA 1BRKA 3SLUA 1ULIB 3CC23 1DMQA 3BNEA 7GSPA 1BSAA 1IQ8A 3TDGA 1RGEA 3QRDA 2XH9A 1TU5A 2OQEA 1EEJA 4HM3B 2W03A 1CEWI 3Q2PA 4X2HA 3DXOA 3LH4A 1DE3A 2W9QA 4N3VA 4J5KA 2W0QA 2XFTA 4RNZA 1BUJA 1FGTA 1SPUA 2XEPA 3PXMA 5I97A 4AKZA 1OCVA 2AADA 1UUVB 1NB3I 3JUQA 2XSOB 3LT8A 1GMPA 3FF2A 2C4BA 1CYVA 1JZDA 4G1MB 4N6NB 1GSPA 2FGTA 2YX9A 2CH9A 2K3DA 3S27A 1VQK3 4BL3A 2CHCA 1LNHA 5LC6A 4CDLA 3M8CA 2Z77A 1FYSA 3VSYA 4O8SA 1B21A 3NM2A 3Q3FA 4WHAA 4MJDA 1RTUA 1L5GB 1KSIA 3LMLA 2CKFB 1ULJB 3JUMA 5IW9A 3JUNA 1W00A 3HK4A 2OOVA 3S28A 2ZHXB 4RBNA 3B7CA 3KSED 3X3YA 2KAAA 3CCU3 1GOYA 2BMRB 1Q40B 1TIJA 4OK0A 3EN1B 1LQGC 3RDEA 3WOEB 7STDA 1V74A 4AKYA 4O2HA 1HZ1A 3NV0B 3UL5A 5IG0A 3LYGA 1E3VA 5AIHA 2RBIA 2Z6BA 3DY5A 1LOVA 2I9WA 2QIYA 1ISKA 3DM8A 2E2VA 1N5PA 4IIAA 1I0XA 1GMQA 2P0MA 3STDA 3G4S3 3K5TA 2HMMB 1B2SA 4LSOA 3F8HA 1PY3A 3EN8A 5ELUA 1O7NB 1DMNA 1LNIA 5G1LA 2WOFA 3KIIA 5BU4A 3WHOA 1MGRA 3DGLA 3JVCA 1OACA 4RZMA 4BTWA 5CF2A 1FW7A 5AEUB 4K1UA 3OXAA 1V58A 2ZL8A 3F40A 2K0MA 4LZIA 2PZVA 1UGHI 2XGNA 2J8XB 3U1WA 1BIRA 2IY2A 4R4KA 2BU4A 1FUTA 1JB5A 1OGZA 1Q40A 3KKGA 3N9HA 1GY5A 1FGOA 4BIRA 4ZM8A 2CIUA 3E99A 1B3SA 1IVUA 2W56A 5G2GA 3OW22 2GBXB 2JQ5A 2KF6A 3CNXA 1CYUA 3AHWA 4ILFA 6STDA 3OWUA 3LXUX 1VQN3 1D6ZA 1K28A 2LQVA 1W01A 1Q9EA 3SEDA 2FNQA 5JPPA 3QK9A 3DGNA 8CHOA 1RGCA 2QA43 1DVDA 3G8ZA 4CJNA 1IK3A 1GD3A 1RCLA 1W4NA 8RNTA 1RGKA 5EVHA 1JBTA 1T2HA 1ZO2A 3MSOA 3EBYA 4HM2B 1M904 1YIT3 3NQYA 2W6JH 1WQLB 1NU3A 1UGIA 3S67A 1GOVA 2HMJB 1YGEA 3K9MC 1W2B2 4L7KA 1A2PA 1RDSA 1Z1SA 3FGYA 5AIFA 1RRHA 3S5CA 2W56B 2E2UA 1RHLA 4EV5A 1LOYA 1N9JA 3GSPA 3UL6A 2YFJB 2SBLA 3CCQ3 1VQP3 5DREA 1QALA 1BRSA 2IA7A 1WMPA 2KF4A 3CCM3 1QVG2 2H0GA 3K63A 3X3XA 1RKYA 4HJLB 3WODG 1JN5A 1JB4A 1A2VA 3LTDA 3LZAA 4NREA 1RGHA 4R9KA 3RNTA 3WMDA 2V1LA 1X1YA 4XM4A 4K1VA 5HOHA 1BRNL 3KCHA 3ZG5A 1Q814 5AIGA 2OTJ3 4BTYA 4FCZA 1C7HA 1BNEA 4J5GA 1BRGA 1W7CA 2FXTA 4OUQA 4XB5A 2F98A 3EJVA 4FCMA 2KF5A 4N6V0 3GZXB 4U13A 1I8VA 3WDGB 3T0UA 4O3VA 1YIJ3 3GRDA 1RN4A 1STFI 3CCR3 1GY6A 1LRAA 1W2ZA 1TRPA 4O02B 1FGQA 5AYRB 5D83A 3D4AA 2CX1A 3KSPA 3G6E3 3T8UA 1Q42A 4EXRA 1PU4A 1PFPA 1BANA 1OF5B 4I5QA 4K61A 5FGOA 3DZLA 2IYJA 3X40A 2CK3H 1WNHA 4LMIA 5AIIA 4HM4B 3IPTA 5CXOA 5ELJA 3OWSA 1W5ZA 2GEXA 1UCJA 3ER7A 3MPHA 1JBRA 1O7MB 5HGRA 1Q824 3EHCA 1IYYA 1FUSA 3DH2A 3NXJA 4WYKA 5DRVA 5LC7A 3B8LA 1RRLA 1AY7A 1N9EA 3DGMA 2R4IA 4H3UA 5IEOA 3D3LA 3LT9A 4BL2A 2ML5A 3FZWA 3F7XA 1NB5I 1QVF2 3BNCA 2HMOB 1TP6A 1JRQA 1I2FA 1STDA 2GSPA 4GB5A 1E3RA 3HIGA 1Q7Y4 1K8A4 2CFKA 3EB8A 1IV7A 1MWTA 2STDA 4GL6A 3AMOA 5D82A 3VGNA 1RGLA 1U5OA 2OQEC 1RGFA 6RNTA 3KFQC 3WOFB 3GWRA 2P38A 1VQ73 1YHQ3 1N8R4 4L8OA 2CX0A 1BVIA 1OPYA 1U8CB 1EKMA 3WA2X 3I553 1BNSA 1B2UA 1QMAA 2K54A 3AGNA 3HIIA 3J7Yd 1I0VA 3BIRA 4XDWA 3PCRA 5BVBA 1LVNA 3KN4A 2BMQB 2GU1A 2SARA 5IG3A 1UCKA 4L8PA 2F5WA 3X3ZA 1GD4A 1NWWA 1TFKA 2F56A 5EEOA 2KCDA 3KZTA 1K9M4 3HZPA 3CCS3 3NBJA 1MWSA 1IQYA 1E97A 3CU3A 4XBYA 3T8NA 5AI1A 4LGQA 2CFWA 2R41A 2L1SA 5IG5A 4EBGA 3BLZA 3DGYA 1OHOA 1RN1A 2KXGA 1TRQA 1CH0A 3DGOA 4TX4A 1G02A 4STDA 4KT3B 3MYTA 1T5YA 2WO0A 2WGQA 4LEHA 1SJWA 2ZA4A 3FH1A 3PCSA 4GHOA 5D81A 1MOLA 1SQWA 1UUGB 2HMLB 1BRIA 3VF1A 2WGOA 1NNVA 1WMNA 2BIRA 3KE7A 1JKGA 3IJEB 3DMCA 3FLJA 3H51A 3NV0A 4R80A 2CG0A 3NBRA 1AVKA 4BU4A 3PS8A 1JZOA 2XRXB 3Q90A 3MG3A 4MMYB 3ALAA 1YVBI 2B1XB 4MMXB 3SVAA 1D6YA 5CLKA 1MNLA 3LOYA 2C10A 1OHSA 2HMNB 1B2MA 4EC6A 3OWYA 5AEWB 1WMOA 2H0IA 3SYUA 2CWVA 1O7HB 1M9GA 3NM7A 1UI7A 3GZRA 3N8BA 4IPBA 3BU4A 2MC8A 4OVMA 1DYUA 1BSBA 1LXEA 4KFFA 2F4YA 4KFDA 4XDVA 3NHXA 3WR2A 1J2BA 2YFLB 4NPBA 1JKGB 1SIIA 1US1A 1KWIA 3F8XA 1JJ22 1UUWB 5EQLA 1BU4A 1AVLA 1JB2A 3AHSA 3CME3 1TJDA 1M1XB 4HZ9B 4FMDA 3DUKA 2A15A 3EQQB 3MKIA 2QGUA 3K7CA 2IUJA 1UCLA 3MG2A 1IVXA 3F9SA 4HOHA 4HM5B 4CCVA 1W6CA
chains in the Genus database with same CATH topology
3B4OA 1QAFA 3UJMA 1G96A 3B4PA 5JBSA 3PYJA 4EV2A 1IQXA 4KFEA 1VQ83 2XFSA 4J9AA 1GS3A 3G713 2LYXA 4J8TA 5IENA 1VQ63 3OV4A 3O8YA 1YJW3 2RSXA 4QWTA 3CMA3 1S723 5IG4A 2QEX3 3Q1CA 3G0KA 4R9LA 3FG4A 3CPW2 3NUVA 4HYZA 2ZDJA 1FGMA 3I563 3CNMA 3FSDA 2GEYA 2Z7AA 3CCV3 1DMMA 1UI8A 3HX8A 2W04A 1OF5A 2Q07A 3EE1A 5KP1A 1EG9B 2XGLA 5JPUA 2HMKB 2CFLA 2GU3A 2KRTA 1S5AA 2CG1A 4NHFA 5CF1A 4WP5A 2PNCA 1W6YA 2BMOB 1Y4KA 1JNQA 4AEQA 1IV9A 5IF6A 1VQL3 3JUOA 3WA3A 3IMAB 1GY7A 3EX9A 2CW9A 1FGRA 1O7GB 1ROAA 2XSHB 1K41A 2INXA 5IERA 1NJI4 4JF8A 3CCJ3 2CWTA 4N6LA 2RCDA 2IMJA 3U97A 4HM8B 3PGBA 1OHPA 4EYCA 1IT7A 2M7OA 1WTHA 4PEJA 4XBXA 1TFOA 3G16A 3LTCA 2P0XA 4FR9A 3ECFA 4HBRA 1EA2A 5CK6A 2E2TA 4HVNA 1K734 2GXFA 1JV2B 1NDOB 5TGNA 5KP4A 3HI7A 4MMZB 1TUHA 1A67A 2P09A 3CC73 1IVVA 3SOYA 2O9UX 2RFRA 3CCE3 4X2OA 4BTXA 1BUQA 5FW5A 3LTAA 5BXQA 2OWPA 4FMCA 1KD14 1EQKA 1D6UA 3UNLA 1ASKA 4N6UA 4KVHA 2CFDA 1IU7A 1A90A 3EBTA 2C11A 2D1WA 2RGQA 2XR8B 2YFIB 3CCL3 4HM6B 4HZBB 1FA3A 2BNGA 1QAKA 3EC9A 4HM7B 3N54B 4KZ1A 4Q53A 2WOHA 3NQZA 1IVWA 1SIHA 4I4KA 2F86B 2F99A 4K90B 1VQ53 1N5HA 3F14A 3I0YA 1W6GA 3CD63 1O7WB 2Y74A 4IT7A 1VZZA 2CWUA 4FMAA 4XBTA 3S29A 2OOVC 4RNYA 1N8QA 1KQS2 1R4CA 3GZYB 4WFOA 1VQM3 2JDIH 3X42A 1O7PB 2UX0A 3CPOA 3MWZA 3V98A 1FUWA 2L4VA 1ROVA 1YJ93 2ML6A 3V92A 2CFGA 5IEPA 3MHEA 3A76A 4HM0B 3F7SA 3MG1A 2W9PA 3K0ZA 3V99A 4JRFA 1OGXA 4H61A 1VQ43 3JUPA 1JN5B 3FKAA 1M1K4 2GBWB 1AR0A 1RN7A 1OUNA 3PZWA 4N6MA 1UW1A 3L0RA 3AMOB 3CC43 2Z76A 4FMBA 3BNBA 1AV4A 1F8NA 5AYSC 3SXXA 1HKXA 1ZX2A 1IDPA 3H3HA 1W02A 1NO3A 2BHMA 1RJOA 4N6TA 3NX0A 3FG1A 2OCTA 4FCJA 3GZBA 2D42A 4R1KA 3FF0A 2OTL3 1A2KA 2BT3A 5A0OB 3D9RA 3UB1A 1YJN3 1VQ93 3BNDA 2O3OA 3LTBA 4WYKB 3CXC2 3RGRA 1IT8A 3FG3A 1KC84 1Q864 3ROBA 1QJGA 3RGAA 1LOXA 1CQSA 2P05A 1HU9A 2W2CA 3EF8A 3GAXA 4HM1B 2CC3A 4WWUC 1GYBA 4N6OB 5KP3A 3SOAA 3X41A 2MF7A 3NBBA 2Y73A 3SX1A 1DVCA 2XF3A 1VQO3 4ORLA 1OH0A 5STDA 2B24B 2IUKA 4HKVB 2BO9B 3OX9A 3BB9A 3FCSB 1YI23 4MEIA 3SLUA 3CC23 1ULIB 1DMQA 3BNEA 1IQ8A 3TDGA 3QRDA 2XH9A 1TU5A 2OQEA 4HM3B 2W03A 1CEWI 3Q2PA 4X2HA 3DXOA 3LH4A 2W9QA 4N3VA 2W0QA 2XFTA 4RNZA 1FGTA 1SPUA 2XEPA 3PXMA 5I97A 4AKZA 1OCVA 1UUVB 1NB3I 3JUQA 2XSOB 3LT8A 3FF2A 1CYVA 4G1MB 4N6NB 2FGTA 2YX9A 2CH9A 3S27A 1VQK3 2CHCA 1LNHA 5LC6A 4CDLA 3M8CA 2Z77A 3VSYA 4O8SA 3NM2A 4WHAA 4MJDA 1L5GB 1KSIA 3LMLA 2CKFB 1ULJB 3JUMA 5IW9A 3JUNA 1W00A 3HK4A 2OOVA 3S28A 4RBNA 3B7CA 3KSED 3X3YA 3CCU3 2BMRB 1Q40B 1TIJA 4OK0A 3EN1B 3RDEA 7STDA 3WOEB 1V74A 4AKYA 4O2HA 3NV0B 3UL5A 5IG0A 3LYGA 1E3VA 5AIHA 2Z6BA 3DY5A 2I9WA 2QIYA 1ISKA 3DM8A 2E2VA 1N5PA 4IIAA 3G4S3 2P0MA 3STDA 3K5TA 2HMMB 4LSOA 5ELUA 3F8HA 3EN8A 1O7NB 1DMNA 2WOFA 3KIIA 3DGLA 3JVCA 1OACA 4RZMA 4BTWA 5CF2A 5AEUB 4K1UA 3OXAA 2ZL8A 3F40A 2K0MA 4LZIA 2PZVA 2XGNA 3U1WA 4R4KA 1JB5A 1OGZA 1Q40A 3KKGA 3N9HA 1GY5A 1FGOA 4ZM8A 2CIUA 3E99A 1IVUA 2W56A 5G2GA 3OW22 2GBXB 2JQ5A 3CNXA 1CYUA 6STDA 3OWUA 3LXUX 1VQN3 1D6ZA 1K28A 2LQVA 1W01A 3SEDA 2FNQA 5JPPA 3QK9A 3DGNA 8CHOA 1DVDA 2QA43 3G8ZA 1IK3A 1GD3A 1W4NA 5EVHA 1ZO2A 3MSOA 3EBYA 4HM2B 1M904 1YIT3 3NQYA 2W6JH 1WQLB 1NU3A 3S67A 2HMJB 3K9MC 1YGEA 1W2B2 4L7KA 1Z1SA 3FGYA 5AIFA 1RRHA 3S5CA 2W56B 2E2UA 4EV5A 1N9JA 3CCQ3 3UL6A 2YFJB 2SBLA 1VQP3 5DREA 1QALA 2IA7A 1WMPA 3CCM3 1QVG2 3K63A 3X3XA 1RKYA 4HJLB 3WODG 1JN5A 1JB4A 1A2VA 3LTDA 3LZAA 4NREA 4R9KA 3WMDA 2V1LA 4XM4A 4K1VA 1Q814 5AIGA 2OTJ3 4BTYA 4FCZA 1C7HA 1W7CA 2FXTA 4OUQA 4XB5A 2F98A 3EJVA 4FCMA 4N6V0 3GZXB 4U13A 3WDGB 3T0UA 4O3VA 1YIJ3 3GRDA 1STFI 3CCR3 1GY6A 1W2ZA 4O02B 1FGQA 5AYRB 5D83A 3KSPA 3G6E3 3T8UA 1Q42A 4EXRA 1PU4A 1PFPA 1OF5B 4K61A 5FGOA 3DZLA 3X40A 2CK3H 1WNHA 4LMIA 5AIIA 4HM4B 3IPTA 5CXOA 5ELJA 3OWSA 1W5ZA 2GEXA 3ER7A 3MPHA 1O7MB 5HGRA 1Q824 3EHCA 3NXJA 4WYKA 5DRVA 5LC7A 3B8LA 1RRLA 4H3UA 1N9EA 3DGMA 2R4IA 5IEOA 3D3LA 3LT9A 2ML5A 3FZWA 3F7XA 1NB5I 1QVF2 3BNCA 2HMOB 1TP6A 1JRQA 1STDA 4GB5A 1E3RA 3HIGA 1Q7Y4 1K8A4 2CFKA 3EB8A 1IV7A 4GL6A 2STDA 5D82A 3AMOA 3VGNA 1U5OA 2OQEC 1YHQ3 1VQ73 3KFQC 3WOFB 3GWRA 2P38A 1N8R4 4L8OA 1U8CB 1OPYA 3WA2X 1EKMA 3I553 2K54A 1QMAA 3J7Yd 3HIIA 4XDWA 3PCRA 5BVBA 1LVNA 3KN4A 2BMQB 2GU1A 5IG3A 4L8PA 3X3ZA 1GD4A 1NWWA 1TFKA 5EEOA 2KCDA 3KZTA 1K9M4 3HZPA 3CCS3 3NBJA 1IQYA 1E97A 3CU3A 4XBYA 3T8NA 5AI1A 4LGQA 2CFWA 5IG5A 4EBGA 3BLZA 1OHOA 2KXGA 3DGOA 4TX4A 4STDA 3MYTA 1T5YA 2WO0A 2WGQA 4LEHA 1SJWA 3FH1A 3PCSA 5D81A 1MOLA 1SQWA 2HMLB 3VF1A 2WGOA 1WMNA 3KE7A 1JKGA 3IJEB 3DMCA 3FLJA 3H51A 3NV0A 4R80A 2CG0A 3NBRA 1AVKA 3PS8A 2XRXB 3Q90A 3MG3A 4MMYB 3ALAA 1YVBI 2B1XB 4MMXB 3SVAA 1D6YA 5CLKA 1MNLA 3LOYA 2C10A 1OHSA 2HMNB 4EC6A 3OWYA 5AEWB 1WMOA 2CWVA 1O7HB 1M9GA 3NM7A 1UI7A 3GZRA 3N8BA 4IPBA 2MC8A 4OVMA 1DYUA 1LXEA 4KFFA 4KFDA 4XDVA 3NHXA 1J2BA 2YFLB 1JKGB 1SIIA 1US1A 1KWIA 3F8XA 1JJ22 1UUWB 5EQLA 1AVLA 1JB2A 3CME3 1M1XB 4HZ9B 4FMDA 3DUKA 2A15A 3EQQB 3MKIA 2QGUA 3K7CA 2IUJA 3MG2A 1IVXA 3F9SA 4HM5B 4CCVA 1W6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AII A;  5IEP A;  3MHE A;  3A76 A;  3B4O A;  3F7S A;  3MG1 A;  4HM0 B;  4HM4 B;  3IPT A;  3K0Z A;  4LMI A;  5CXO A;  2BMR B;  3B4P A;  3OWS A;  3UJM A;  2GEX A;  1OGX A;  1Q40 B;  3JUP A;  3EN1 B;  3ER7 A;  1JN5 B;  7STD A;  4J9A A;  1GS3 A;  1O7M B;  3FKA A;  5HGR A;  4J8T A;  5IEN A;  2GBW B;  1AR0 A;  3EHC A;  1OUN A;  3NV0 B;  5IG0 A;  3LYG A;  1E3V A;  3NXJ A;  3OV4 A;  4WYK A;  5AIH A;  5DRV A;  5IG4 A;  2I9W A;  3B8L A;  2QIY A;  3G0K A;  4H3U A;  3DM8 A;  2R4I A;  3NUV A;  4R9L A;  5IEO A;  1ISK A;  3FZW A;  2Z76 A;  3F7X A;  3CNM A;  2HMO B;  1TP6 A;  3FSD A;  4IIA A;  3STD A;  1HKX A;  1ZX2 A;  2HMM B;  3F8H A;  3EN8 A;  1IDP A;  2GEY A;  1O7N B;  1DMN A;  1STD A;  1W02 A;  2Z7A A;  3H3H A;  1E3R A;  4GB5 A;  1DMM A;  3HX8 A;  1OF5 A;  3VGN A;  2STD A;  4RZM A;  5D82 A;  5CF2 A;  1EG9 B;  5KP1 A;  1U5O A;  4FCJ A;  3GZB A;  2HMK B;  5JPU A;  4R1K A;  4K1U A;  3GWR A;  5AEU B;  3OXA A;  3FF0 A;  1A2K A;  4L8O A;  1OPY A;  1S5A A;  3D9R A;  3F40 A;  2PZV A;  5CF1 A;  2K54 A;  1QMA A;  4WP5 A;  4XDW A;  1JB5 A;  1OGZ A;  1Q40 A;  1W6Y A;  2BMO B;  1GY5 A;  3KKG A;  5IF6 A;  5BVB A;  3JUO A;  2BMQ B;  3E99 A;  5IG3 A;  4WYK B;  5G2G A;  4L8P A;  2GBX B;  2JQ5 A;  3CNX A;  1GY7 A;  3EX9 A;  1NWW A;  3RGR A;  6STD A;  3KZT A;  3OWU A;  3HZP A;  1O7G B;  3ROB A;  1E97 A;  2XSH B;  1K41 A;  1W01 A;  1QJG A;  2INX A;  3CU3 A;  4XBY A;  1CQS A;  4LGQ A;  5AI1 A;  3RGA A;  3SED A;  3T8N A;  5IG5 A;  5JPP A;  2RCD A;  2IMJ A;  2W2C A;  3BLZ A;  1OHO A;  3EF8 A;  4HM1 B;  1OHP A;  4HM8 B;  1GYB A;  3G8Z A;  4WWU C;  8CHO A;  4XBX A;  4PEJ A;  5KP3 A;  5EVH A;  3G16 A;  4STD A;  1ZO2 A;  3SOA A;  3MSO A;  3MYT A;  3ECF A;  1EA2 A;  3EBY A;  5CK6 A;  4HM2 B;  4HVN A;  4LEH A;  5D81 A;  1SJW A;  3FH1 A;  2GXF A;  1NDO B;  1OH0 A;  1NU3 A;  1WQL B;  2HML B;  4ORL A;  5STD A;  2HMJ B;  5TGN A;  5KP4 A;  2B24 B;  4HKV B;  3KE7 A;  4L7K A;  1JKG A;  3OX9 A;  3BB9 A;  3DMC A;  3FLJ A;  3H51 A;  3NV0 A;  1Z1S A;  1TUH A;  3FGY A;  5AIF A;  1ULI B;  3NBR A;  1DMQ A;  3S5C A;  3SOY A;  2XRX B;  3T8U A;  3Q90 A;  3MG3 A;  2RFR A;  2YFJ B;  2B1X B;  4X2O A;  5DRE A;  4HM3 B;  1BUQ A;  5FW5 A;  4X2H A;  5CLK A;  5BXQ A;  2OWP A;  3DXO A;  4N3V A;  4HJL B;  1OHS A;  2HMN B;  3UNL A;  1ASK A;  1JB4 A;  1JN5 A;  3LZA A;  4R9K A;  3WMD A;  3OWY A;  4KVH A;  4XM4 A;  5AEW B;  4K1V A;  3EBT A;  1OCV A;  2RGQ A;  1O7H B;  1UUV B;  2XR8 B;  2YFI B;  3JUQ A;  2XSO B;  5AIG A;  3GZR A;  4HM6 B;  4HZB B;  1C7H A;  3FF2 A;  2BNG A;  4OUQ A;  4OVM A;  4XB5 A;  2F98 A;  3EC9 A;  3EJV A;  4FCM A;  4HM7 B;  3GZX B;  4Q53 A;  4U13 A;  5IER A;  4XDV A;  3MKI A;  3NHX A;  2CHC A;  2YFL B;  1JKG B;  2F86 B;  2F99 A;  3F8X A;  3M8C A;  4I4K A;  4CDL A;  2Z77 A;  3F14 A;  3GRD A;  3I0Y A;  3VSY A;  1UUW B;  1GY6 A;  3NM2 A;  1O7W B;  4MJD A;  1JB2 A;  1VZZ A;  4XBT A;  5D83 A;  4HZ9 B;  3KSP A;  2CKF B;  1Q42 A;  1ULJ B;  3GZY B;  3JUM A;  3DUK A;  1OF5 B;  2A15 A;  3EQQ B;  1O7P B;  2QGU A;  2UX0 A;  3CPO A;  3JUN A;  3K7C A;  3MG2 A;  3F9S A;  1W00 A;  3DZL A;  3HK4 A;  4HM5 B;  3B7C A; 
#chains in the Genus database with same CATH topology
 5M19 A;  3B4O A;  1QAF A;  3UJM A;  1AQZ A;  1G96 A;  3B4P A;  5JBS A;  3PYJ A;  4EV2 A;  1IQX A;  1I70 A;  4KFE A;  1VQ8 3;  3ZG0 A;  6GSP A;  2XFS A;  1I3F A;  4J9A A;  1GS3 A;  2RNT A;  3G71 3;  2LYX A;  4J8T A;  5IEN A;  1VQ6 3;  1B20 A;  3O8Y A;  3OV4 A;  1YJW 3;  2RSX A;  3HOH A;  4QWT A;  3CMA 3;  1S72 3;  5IG4 A;  2QEX 3;  3Q1C A;  3G0K A;  4R9L A;  3FG4 A;  3CPW 2;  3NUV A;  4HYZ A;  2ZDJ A;  1FGM A;  3I56 3;  3CNM A;  3FSD A;  1B2X A;  1C54 A;  2GEY A;  2Z7A A;  3CCV 3;  1DMM A;  1MGW A;  1UI8 A;  3HX8 A;  5M18 A;  2W04 A;  1OF5 A;  2Q07 A;  3EE1 A;  5KP1 A;  1EG9 B;  2XGL A;  1B27 A;  2HMK B;  5JPU A;  9RNT A;  2CFL A;  1ZGX A;  2GU3 A;  2KRT A;  1S5A A;  2CG1 A;  1LOW A;  1T2I A;  4NHF A;  5CF1 A;  4WP5 A;  2PNC A;  1W6Y A;  2BMO B;  1Y4K A;  1JNQ A;  4AEQ A;  1IV9 A;  5IF6 A;  1VQL 3;  3D5I A;  3JUO A;  3WA3 A;  1UDI I;  3IMA B;  1GY7 A;  3EX9 A;  2CW9 A;  2AAE A;  1FGR A;  1O7G B;  1X1X A;  1ZS7 A;  1T3B A;  1MWR A;  1ROA A;  2XSH B;  1K41 A;  2INX A;  5IER A;  1NJI 4;  4JF8 A;  3CCJ 3;  2CWT A;  4N6L A;  2RCD A;  2IMJ A;  3U97 A;  4HM8 B;  3PGB A;  1OHP A;  4EYC A;  1IT7 A;  2M7O A;  1WTH A;  4PEJ A;  4XBX A;  1TFO A;  3G16 A;  3LTC A;  2P0X A;  4FR9 A;  3ECF A;  4HBR A;  1EA2 A;  5CK6 A;  2E2T A;  1TTO A;  4HVN A;  5GSP A;  1K73 4;  2GXF A;  1JV2 B;  1NDO B;  5TGN A;  1RLS A;  2KF3 A;  3HI7 A;  5KP4 A;  4MMZ B;  1RCK A;  1JBS A;  1TUH A;  3AGO A;  1A67 A;  2P09 A;  4CPK A;  3CC7 3;  1IVV A;  3SOY A;  2O9U X;  2RFR A;  3CCE 3;  4X2O A;  7RNT A;  1RSN A;  4BTX A;  1BUQ A;  5FW5 A;  3LTA A;  5BXQ A;  2OWP A;  4FMC A;  1KD1 4;  1BOX A;  1EQK A;  1D6U A;  3UNL A;  1ASK A;  1UCI A;  4N6U A;  1BGS A;  1G0T A;  1RMS A;  4HAA A;  2CFD A;  4KVH A;  1IU7 A;  1A90 A;  3EBT A;  2C11 A;  2D1W A;  2RGQ A;  2XR8 B;  2YFI B;  5RNT A;  3CCL 3;  4HM6 B;  4HZB B;  1FA3 A;  2BNG A;  1QAK A;  1X1U A;  4GSP A;  1BNF A;  3EC9 A;  4HM7 B;  3A5E A;  3N54 B;  4KZ1 A;  4Q53 A;  2WOH A;  3NQZ A;  1IVW A;  1SIH A;  2F5M A;  4I4K A;  2F86 B;  2F99 A;  3D79 A;  4K90 B;  1N5H A;  1VQ5 3;  3F14 A;  3I0Y A;  1W6G A;  1PYL A;  2H0H A;  3CD6 3;  1O7W B;  1HYF A;  2Y74 A;  4IT7 A;  1VZZ A;  2CWU A;  4FMA A;  4XBT A;  2UGI A;  3S29 A;  2OOV C;  4RNY A;  1N8Q A;  1KQS 2;  1R4C A;  3GZY B;  4WFO A;  1VQM 3;  2JDI H;  3X42 A;  1O7P B;  2UX0 A;  3CPO A;  3MWZ A;  3V98 A;  1FUW A;  2L4V A;  1ROV A;  1YNV X;  2ML6 A;  1YJ9 3;  1VQQ A;  1BNR A;  3V92 A;  3URP A;  2CFG A;  5IEP A;  3MHE A;  3A76 A;  1V57 A;  3F7S A;  3MG1 A;  4HM0 B;  1EUI C;  2W9P A;  3K0Z A;  2HOH A;  4JRF A;  3V99 A;  1BSD A;  1B2Z A;  1OGX A;  4H61 A;  1VQ4 3;  3JUP A;  1BSC A;  1JN5 B;  3FKA A;  1M1K 4;  2GBW B;  1AR0 A;  1RN7 A;  1OUN A;  3PZW A;  4N6M A;  4RNT A;  1UW1 A;  1I2E A;  3L0R A;  3AMO B;  1RGA A;  3CC4 3;  2Z76 A;  4FMB A;  3BNB A;  1DET A;  1AV4 A;  1F8N A;  5AYS C;  4LYL B;  5M1A A;  3SXX A;  1HKX A;  1ZX2 A;  5G1K A;  1BSE A;  1IDP A;  3H3H A;  1W02 A;  1NO3 A;  3D5G A;  2BHM A;  1RJO A;  4N6T A;  3NX0 A;  1GOU A;  4DKI A;  1FZU A;  3FG1 A;  1SAR A;  2OCT A;  4FCJ A;  3GZB A;  2D42 A;  4R1K A;  1BNI A;  2UUG C;  3FF0 A;  1A2K A;  2BT3 A;  5A0O B;  2OTL 3;  3D9R A;  3ZFZ A;  3UB1 A;  1YJN 3;  1BAO A;  1GMR A;  1RNB A;  1VQ9 3;  1I2G A;  3BND A;  5BIR A;  2O3O A;  3LTB A;  1I3I A;  1YVS A;  4WYK B;  3CXC 2;  3RGR A;  1MWU A;  1IT8 A;  1YGW A;  1RGG A;  3FG3 A;  1KC8 4;  1RNT A;  1Q86 4;  1BRJ A;  3ROB A;  1QJG A;  3RGA A;  1LOX A;  1CQS A;  2P05 A;  1HU9 A;  2W2C A;  3EF8 A;  3GAX A;  4HM1 B;  2CC3 A;  4WWU C;  1GYB A;  1R4Y A;  4N6O B;  5KP3 A;  3SOA A;  3X41 A;  2MF7 A;  3NBB A;  1BNG A;  2Y73 A;  1BNJ A;  3SX1 A;  1DVC A;  2XF3 A;  1VQO 3;  4ORL A;  1OH0 A;  5STD A;  4EW5 A;  1Q7H A;  2B24 B;  2IUK A;  4HKV B;  1BRH A;  1LQM B;  2BO9 B;  3OX9 A;  3BB9 A;  3FCS B;  1X1W A;  1YI2 3;  4MEI A;  1BRK A;  3SLU A;  1ULI B;  3CC2 3;  1DMQ A;  3BNE A;  7GSP A;  1BSA A;  1IQ8 A;  3TDG A;  1RGE A;  3QRD A;  2XH9 A;  1TU5 A;  2OQE A;  1EEJ A;  4HM3 B;  2W03 A;  1CEW I;  3Q2P A;  4X2H A;  3DXO A;  3LH4 A;  1DE3 A;  2W9Q A;  4N3V A;  4J5K A;  2W0Q A;  2XFT A;  4RNZ A;  1BUJ A;  1FGT A;  1SPU A;  2XEP A;  3PXM A;  5I97 A;  4AKZ A;  1OCV A;  2AAD A;  1UUV B;  1NB3 I;  3JUQ A;  2XSO B;  3LT8 A;  1GMP A;  3FF2 A;  2C4B A;  1CYV A;  1JZD A;  4G1M B;  4N6N B;  1GSP A;  2FGT A;  2YX9 A;  2CH9 A;  2K3D A;  3S27 A;  1VQK 3;  4BL3 A;  2CHC A;  1LNH A;  5LC6 A;  4CDL A;  3M8C A;  2Z77 A;  1FYS A;  3VSY A;  4O8S A;  1B21 A;  3NM2 A;  3Q3F A;  4WHA A;  4MJD A;  1RTU A;  1L5G B;  1KSI A;  3LML A;  2CKF B;  1ULJ B;  3JUM A;  5IW9 A;  3JUN A;  1W00 A;  3HK4 A;  2OOV A;  3S28 A;  2ZHX B;  4RBN A;  3B7C A;  3KSE D;  3X3Y A;  2KAA A;  3CCU 3;  1GOY A;  2BMR B;  1Q40 B;  1TIJ A;  4OK0 A;  3EN1 B;  1LQG C;  3RDE A;  3WOE B;  7STD A;  1V74 A;  4AKY A;  4O2H A;  1HZ1 A;  3NV0 B;  3UL5 A;  5IG0 A;  3LYG A;  1E3V A;  5AIH A;  2RBI A;  2Z6B A;  3DY5 A;  1LOV A;  2I9W A;  2QIY A;  1ISK A;  3DM8 A;  2E2V A;  1N5P A;  4IIA A;  1I0X A;  1GMQ A;  2P0M A;  3STD A;  3G4S 3;  3K5T A;  2HMM B;  1B2S A;  4LSO A;  3F8H A;  1PY3 A;  3EN8 A;  5ELU A;  1O7N B;  1DMN A;  1LNI A;  5G1L A;  2WOF A;  3KII A;  5BU4 A;  3WHO A;  1MGR A;  3DGL A;  3JVC A;  1OAC A;  4RZM A;  4BTW A;  5CF2 A;  1FW7 A;  5AEU B;  4K1U A;  3OXA A;  1V58 A;  2ZL8 A;  3F40 A;  2K0M A;  4LZI A;  2PZV A;  1UGH I;  2XGN A;  2J8X B;  3U1W A;  1BIR A;  2IY2 A;  4R4K A;  2BU4 A;  1FUT A;  1JB5 A;  1OGZ A;  1Q40 A;  3KKG A;  3N9H A;  1GY5 A;  1FGO A;  4BIR A;  4ZM8 A;  2CIU A;  3E99 A;  1B3S A;  1IVU A;  2W56 A;  5G2G A;  3OW2 2;  2GBX B;  2JQ5 A;  2KF6 A;  3CNX A;  1CYU A;  3AHW A;  4ILF A;  6STD A;  3OWU A;  3LXU X;  1VQN 3;  1D6Z A;  1K28 A;  2LQV A;  1W01 A;  1Q9E A;  3SED A;  2FNQ A;  5JPP A;  3QK9 A;  3DGN A;  8CHO A;  1RGC A;  2QA4 3;  1DVD A;  3G8Z A;  4CJN A;  1IK3 A;  1GD3 A;  1RCL A;  1W4N A;  8RNT A;  1RGK A;  5EVH A;  1JBT A;  1T2H A;  1ZO2 A;  3MSO A;  3EBY A;  4HM2 B;  1M90 4;  1YIT 3;  3NQY A;  2W6J H;  1WQL B;  1NU3 A;  1UGI A;  3S67 A;  1GOV A;  2HMJ B;  1YGE A;  3K9M C;  1W2B 2;  4L7K A;  1A2P A;  1RDS A;  1Z1S A;  3FGY A;  5AIF A;  1RRH A;  3S5C A;  2W56 B;  2E2U A;  1RHL A;  4EV5 A;  1LOY A;  1N9J A;  3GSP A;  3UL6 A;  2YFJ B;  2SBL A;  3CCQ 3;  1VQP 3;  5DRE A;  1QAL A;  1BRS A;  2IA7 A;  1WMP A;  2KF4 A;  3CCM 3;  1QVG 2;  2H0G A;  3K63 A;  3X3X A;  1RKY A;  4HJL B;  3WOD G;  1JN5 A;  1JB4 A;  1A2V A;  3LTD A;  3LZA A;  4NRE A;  1RGH A;  4R9K A;  3RNT A;  3WMD A;  2V1L A;  1X1Y A;  4XM4 A;  4K1V A;  5HOH A;  1BRN L;  3KCH A;  3ZG5 A;  1Q81 4;  5AIG A;  2OTJ 3;  4BTY A;  4FCZ A;  1C7H A;  1BNE A;  4J5G A;  1BRG A;  1W7C A;  2FXT A;  4OUQ A;  4XB5 A;  2F98 A;  3EJV A;  4FCM A;  2KF5 A;  4N6V 0;  3GZX B;  4U13 A;  1I8V A;  3WDG B;  3T0U A;  4O3V A;  1YIJ 3;  3GRD A;  1RN4 A;  1STF I;  3CCR 3;  1GY6 A;  1LRA A;  1W2Z A;  1TRP A;  4O02 B;  1FGQ A;  5AYR B;  5D83 A;  3D4A A;  2CX1 A;  3KSP A;  3G6E 3;  3T8U A;  1Q42 A;  4EXR A;  1PU4 A;  1PFP A;  1BAN A;  1OF5 B;  4I5Q A;  4K61 A;  5FGO A;  3DZL A;  2IYJ A;  3X40 A;  2CK3 H;  1WNH A;  4LMI A;  5AII A;  4HM4 B;  3IPT A;  5CXO A;  5ELJ A;  3OWS A;  1W5Z A;  2GEX A;  1UCJ A;  3ER7 A;  3MPH A;  1JBR A;  1O7M B;  5HGR A;  1Q82 4;  3EHC A;  1IYY A;  1FUS A;  3DH2 A;  3NXJ A;  4WYK A;  5DRV A;  5LC7 A;  3B8L A;  1RRL A;  1AY7 A;  1N9E A;  3DGM A;  2R4I A;  4H3U A;  5IEO A;  3D3L A;  3LT9 A;  4BL2 A;  2ML5 A;  3FZW A;  3F7X A;  1NB5 I;  1QVF 2;  3BNC A;  2HMO B;  1TP6 A;  1JRQ A;  1I2F A;  1STD A;  2GSP A;  4GB5 A;  1E3R A;  3HIG A;  1Q7Y 4;  1K8A 4;  2CFK A;  3EB8 A;  1IV7 A;  1MWT A;  2STD A;  4GL6 A;  3AMO A;  5D82 A;  3VGN A;  1RGL A;  1U5O A;  2OQE C;  1RGF A;  6RNT A;  3KFQ C;  3WOF B;  3GWR A;  2P38 A;  1VQ7 3;  1YHQ 3;  1N8R 4;  4L8O A;  2CX0 A;  1BVI A;  1OPY A;  1U8C B;  1EKM A;  3WA2 X;  3I55 3;  1BNS A;  1B2U A;  1QMA A;  2K54 A;  3AGN A;  3HII A;  3J7Y d;  1I0V A;  3BIR A;  4XDW A;  3PCR A;  5BVB A;  1LVN A;  3KN4 A;  2BMQ B;  2GU1 A;  2SAR A;  5IG3 A;  1UCK A;  4L8P A;  2F5W A;  3X3Z A;  1GD4 A;  1NWW A;  1TFK A;  2F56 A;  5EEO A;  2KCD A;  3KZT A;  1K9M 4;  3HZP A;  3CCS 3;  3NBJ A;  1MWS A;  1IQY A;  1E97 A;  3CU3 A;  4XBY A;  3T8N A;  5AI1 A;  4LGQ A;  2CFW A;  2R41 A;  2L1S A;  5IG5 A;  4EBG A;  3BLZ A;  3DGY A;  1OHO A;  1RN1 A;  2KXG A;  1TRQ A;  1CH0 A;  3DGO A;  4TX4 A;  1G02 A;  4STD A;  4KT3 B;  3MYT A;  1T5Y A;  2WO0 A;  2WGQ A;  4LEH A;  1SJW A;  2ZA4 A;  3FH1 A;  3PCS A;  4GHO A;  5D81 A;  1MOL A;  1SQW A;  1UUG B;  2HML B;  1BRI A;  3VF1 A;  2WGO A;  1NNV A;  1WMN A;  2BIR A;  3KE7 A;  1JKG A;  3IJE B;  3DMC A;  3FLJ A;  3H51 A;  3NV0 A;  4R80 A;  2CG0 A;  3NBR A;  1AVK A;  4BU4 A;  3PS8 A;  1JZO A;  2XRX B;  3Q90 A;  3MG3 A;  4MMY B;  3ALA A;  1YVB I;  2B1X B;  4MMX B;  3SVA A;  1D6Y A;  5CLK A;  1MNL A;  3LOY A;  2C10 A;  1OHS A;  2HMN B;  1B2M A;  4EC6 A;  3OWY A;  5AEW B;  1WMO A;  2H0I A;  3SYU A;  2CWV A;  1O7H B;  1M9G A;  3NM7 A;  1UI7 A;  3GZR A;  3N8B A;  4IPB A;  3BU4 A;  2MC8 A;  4OVM A;  1DYU A;  1BSB A;  1LXE A;  4KFF A;  2F4Y A;  4KFD A;  4XDV A;  3NHX A;  3WR2 A;  1J2B A;  2YFL B;  4NPB A;  1JKG B;  1SII A;  1US1 A;  1KWI A;  3F8X A;  1JJ2 2;  1UUW B;  5EQL A;  1BU4 A;  1AVL A;  1JB2 A;  3AHS A;  3CME 3;  1TJD A;  1M1X B;  4HZ9 B;  4FMD A;  3DUK A;  2A15 A;  3EQQ B;  3MKI A;  2QGU A;  3K7C A;  2IUJ A;  1UCL A;  3MG2 A;  1IVX A;  3F9S A;  4HOH A;  4HM5 B;  4CCV A;  1W6C A; 
#chains in the Genus database with same CATH homology
 3B4O A;  1QAF A;  3UJM A;  1G96 A;  3B4P A;  5JBS A;  3PYJ A;  4EV2 A;  1IQX A;  4KFE A;  1VQ8 3;  2XFS A;  4J9A A;  1GS3 A;  3G71 3;  2LYX A;  4J8T A;  5IEN A;  1VQ6 3;  3OV4 A;  3O8Y A;  1YJW 3;  2RSX A;  4QWT A;  3CMA 3;  1S72 3;  5IG4 A;  2QEX 3;  3Q1C A;  3G0K A;  4R9L A;  3FG4 A;  3CPW 2;  3NUV A;  4HYZ A;  2ZDJ A;  1FGM A;  3I56 3;  3CNM A;  3FSD A;  2GEY A;  2Z7A A;  3CCV 3;  1DMM A;  1UI8 A;  3HX8 A;  2W04 A;  1OF5 A;  2Q07 A;  3EE1 A;  5KP1 A;  1EG9 B;  2XGL A;  5JPU A;  2HMK B;  2CFL A;  2GU3 A;  2KRT A;  1S5A A;  2CG1 A;  4NHF A;  5CF1 A;  4WP5 A;  2PNC A;  1W6Y A;  2BMO B;  1Y4K A;  1JNQ A;  4AEQ A;  1IV9 A;  5IF6 A;  1VQL 3;  3JUO A;  3WA3 A;  3IMA B;  1GY7 A;  3EX9 A;  2CW9 A;  1FGR A;  1O7G B;  1ROA A;  2XSH B;  1K41 A;  2INX A;  5IER A;  1NJI 4;  4JF8 A;  3CCJ 3;  2CWT A;  4N6L A;  2RCD A;  2IMJ A;  3U97 A;  4HM8 B;  3PGB A;  1OHP A;  4EYC A;  1IT7 A;  2M7O A;  1WTH A;  4PEJ A;  4XBX A;  1TFO A;  3G16 A;  3LTC A;  2P0X A;  4FR9 A;  3ECF A;  4HBR A;  1EA2 A;  5CK6 A;  2E2T A;  4HVN A;  1K73 4;  2GXF A;  1JV2 B;  1NDO B;  5TGN A;  5KP4 A;  3HI7 A;  4MMZ B;  1TUH A;  1A67 A;  2P09 A;  3CC7 3;  1IVV A;  3SOY A;  2O9U X;  2RFR A;  3CCE 3;  4X2O A;  4BTX A;  1BUQ A;  5FW5 A;  3LTA A;  5BXQ A;  2OWP A;  4FMC A;  1KD1 4;  1EQK A;  1D6U A;  3UNL A;  1ASK A;  4N6U A;  4KVH A;  2CFD A;  1IU7 A;  1A90 A;  3EBT A;  2C11 A;  2D1W A;  2RGQ A;  2XR8 B;  2YFI B;  3CCL 3;  4HM6 B;  4HZB B;  1FA3 A;  2BNG A;  1QAK A;  3EC9 A;  4HM7 B;  3N54 B;  4KZ1 A;  4Q53 A;  2WOH A;  3NQZ A;  1IVW A;  1SIH A;  4I4K A;  2F86 B;  2F99 A;  4K90 B;  1VQ5 3;  1N5H A;  3F14 A;  3I0Y A;  1W6G A;  3CD6 3;  1O7W B;  2Y74 A;  4IT7 A;  1VZZ A;  2CWU A;  4FMA A;  4XBT A;  3S29 A;  2OOV C;  4RNY A;  1N8Q A;  1KQS 2;  1R4C A;  3GZY B;  4WFO A;  1VQM 3;  2JDI H;  3X42 A;  1O7P B;  2UX0 A;  3CPO A;  3MWZ A;  3V98 A;  1FUW A;  2L4V A;  1ROV A;  1YJ9 3;  2ML6 A;  3V92 A;  2CFG A;  5IEP A;  3MHE A;  3A76 A;  4HM0 B;  3F7S A;  3MG1 A;  2W9P A;  3K0Z A;  3V99 A;  4JRF A;  1OGX A;  4H61 A;  1VQ4 3;  3JUP A;  1JN5 B;  3FKA A;  1M1K 4;  2GBW B;  1AR0 A;  1RN7 A;  1OUN A;  3PZW A;  4N6M A;  1UW1 A;  3L0R A;  3AMO B;  3CC4 3;  2Z76 A;  4FMB A;  3BNB A;  1AV4 A;  1F8N A;  5AYS C;  3SXX A;  1HKX A;  1ZX2 A;  1IDP A;  3H3H A;  1W02 A;  1NO3 A;  2BHM A;  1RJO A;  4N6T A;  3NX0 A;  3FG1 A;  2OCT A;  4FCJ A;  3GZB A;  2D42 A;  4R1K A;  3FF0 A;  2OTL 3;  1A2K A;  2BT3 A;  5A0O B;  3D9R A;  3UB1 A;  1YJN 3;  1VQ9 3;  3BND A;  2O3O A;  3LTB A;  4WYK B;  3CXC 2;  3RGR A;  1IT8 A;  3FG3 A;  1KC8 4;  1Q86 4;  3ROB A;  1QJG A;  3RGA A;  1LOX A;  1CQS A;  2P05 A;  1HU9 A;  2W2C A;  3EF8 A;  3GAX A;  4HM1 B;  2CC3 A;  4WWU C;  1GYB A;  4N6O B;  5KP3 A;  3SOA A;  3X41 A;  2MF7 A;  3NBB A;  2Y73 A;  3SX1 A;  1DVC A;  2XF3 A;  1VQO 3;  4ORL A;  1OH0 A;  5STD A;  2B24 B;  2IUK A;  4HKV B;  2BO9 B;  3OX9 A;  3BB9 A;  3FCS B;  1YI2 3;  4MEI A;  3SLU A;  3CC2 3;  1ULI B;  1DMQ A;  3BNE A;  1IQ8 A;  3TDG A;  3QRD A;  2XH9 A;  1TU5 A;  2OQE A;  4HM3 B;  2W03 A;  1CEW I;  3Q2P A;  4X2H A;  3DXO A;  3LH4 A;  2W9Q A;  4N3V A;  2W0Q A;  2XFT A;  4RNZ A;  1FGT A;  1SPU A;  2XEP A;  3PXM A;  5I97 A;  4AKZ A;  1OCV A;  1UUV B;  1NB3 I;  3JUQ A;  2XSO B;  3LT8 A;  3FF2 A;  1CYV A;  4G1M B;  4N6N B;  2FGT A;  2YX9 A;  2CH9 A;  3S27 A;  1VQK 3;  2CHC A;  1LNH A;  5LC6 A;  4CDL A;  3M8C A;  2Z77 A;  3VSY A;  4O8S A;  3NM2 A;  4WHA A;  4MJD A;  1L5G B;  1KSI A;  3LML A;  2CKF B;  1ULJ B;  3JUM A;  5IW9 A;  3JUN A;  1W00 A;  3HK4 A;  2OOV A;  3S28 A;  4RBN A;  3B7C A;  3KSE D;  3X3Y A;  3CCU 3;  2BMR B;  1Q40 B;  1TIJ A;  4OK0 A;  3EN1 B;  3RDE A;  7STD A;  3WOE B;  1V74 A;  4AKY A;  4O2H A;  3NV0 B;  3UL5 A;  5IG0 A;  3LYG A;  1E3V A;  5AIH A;  2Z6B A;  3DY5 A;  2I9W A;  2QIY A;  1ISK A;  3DM8 A;  2E2V A;  1N5P A;  4IIA A;  3G4S 3;  2P0M A;  3STD A;  3K5T A;  2HMM B;  4LSO A;  5ELU A;  3F8H A;  3EN8 A;  1O7N B;  1DMN A;  2WOF A;  3KII A;  3DGL A;  3JVC A;  1OAC A;  4RZM A;  4BTW A;  5CF2 A;  5AEU B;  4K1U A;  3OXA A;  2ZL8 A;  3F40 A;  2K0M A;  4LZI A;  2PZV A;  2XGN A;  3U1W A;  4R4K A;  1JB5 A;  1OGZ A;  1Q40 A;  3KKG A;  3N9H A;  1GY5 A;  1FGO A;  4ZM8 A;  2CIU A;  3E99 A;  1IVU A;  2W56 A;  5G2G A;  3OW2 2;  2GBX B;  2JQ5 A;  3CNX A;  1CYU A;  6STD A;  3OWU A;  3LXU X;  1VQN 3;  1D6Z A;  1K28 A;  2LQV A;  1W01 A;  3SED A;  2FNQ A;  5JPP A;  3QK9 A;  3DGN A;  8CHO A;  1DVD A;  2QA4 3;  3G8Z A;  1IK3 A;  1GD3 A;  1W4N A;  5EVH A;  1ZO2 A;  3MSO A;  3EBY A;  4HM2 B;  1M90 4;  1YIT 3;  3NQY A;  2W6J H;  1WQL B;  1NU3 A;  3S67 A;  2HMJ B;  3K9M C;  1YGE A;  1W2B 2;  4L7K A;  1Z1S A;  3FGY A;  5AIF A;  1RRH A;  3S5C A;  2W56 B;  2E2U A;  4EV5 A;  1N9J A;  3CCQ 3;  3UL6 A;  2YFJ B;  2SBL A;  1VQP 3;  5DRE A;  1QAL A;  2IA7 A;  1WMP A;  3CCM 3;  1QVG 2;  3K63 A;  3X3X A;  1RKY A;  4HJL B;  3WOD G;  1JN5 A;  1JB4 A;  1A2V A;  3LTD A;  3LZA A;  4NRE A;  4R9K A;  3WMD A;  2V1L A;  4XM4 A;  4K1V A;  1Q81 4;  5AIG A;  2OTJ 3;  4BTY A;  4FCZ A;  1C7H A;  1W7C A;  2FXT A;  4OUQ A;  4XB5 A;  2F98 A;  3EJV A;  4FCM A;  4N6V 0;  3GZX B;  4U13 A;  3WDG B;  3T0U A;  4O3V A;  1YIJ 3;  3GRD A;  1STF I;  3CCR 3;  1GY6 A;  1W2Z A;  4O02 B;  1FGQ A;  5AYR B;  5D83 A;  3KSP A;  3G6E 3;  3T8U A;  1Q42 A;  4EXR A;  1PU4 A;  1PFP A;  1OF5 B;  4K61 A;  5FGO A;  3DZL A;  3X40 A;  2CK3 H;  1WNH A;  4LMI A;  5AII A;  4HM4 B;  3IPT A;  5CXO A;  5ELJ A;  3OWS A;  1W5Z A;  2GEX A;  3ER7 A;  3MPH A;  1O7M B;  5HGR A;  1Q82 4;  3EHC A;  3NXJ A;  4WYK A;  5DRV A;  5LC7 A;  3B8L A;  1RRL A;  4H3U A;  1N9E A;  3DGM A;  2R4I A;  5IEO A;  3D3L A;  3LT9 A;  2ML5 A;  3FZW A;  3F7X A;  1NB5 I;  1QVF 2;  3BNC A;  2HMO B;  1TP6 A;  1JRQ A;  1STD A;  4GB5 A;  1E3R A;  3HIG A;  1Q7Y 4;  1K8A 4;  2CFK A;  3EB8 A;  1IV7 A;  4GL6 A;  2STD A;  5D82 A;  3AMO A;  3VGN A;  1U5O A;  2OQE C;  1YHQ 3;  1VQ7 3;  3KFQ C;  3WOF B;  3GWR A;  2P38 A;  1N8R 4;  4L8O A;  1U8C B;  1OPY A;  3WA2 X;  1EKM A;  3I55 3;  2K54 A;  1QMA A;  3J7Y d;  3HII A;  4XDW A;  3PCR A;  5BVB A;  1LVN A;  3KN4 A;  2BMQ B;  2GU1 A;  5IG3 A;  4L8P A;  3X3Z A;  1GD4 A;  1NWW A;  1TFK A;  5EEO A;  2KCD A;  3KZT A;  1K9M 4;  3HZP A;  3CCS 3;  3NBJ A;  1IQY A;  1E97 A;  3CU3 A;  4XBY A;  3T8N A;  5AI1 A;  4LGQ A;  2CFW A;  5IG5 A;  4EBG A;  3BLZ A;  1OHO A;  2KXG A;  3DGO A;  4TX4 A;  4STD A;  3MYT A;  1T5Y A;  2WO0 A;  2WGQ A;  4LEH A;  1SJW A;  3FH1 A;  3PCS A;  5D81 A;  1MOL A;  1SQW A;  2HML B;  3VF1 A;  2WGO A;  1WMN A;  3KE7 A;  1JKG A;  3IJE B;  3DMC A;  3FLJ A;  3H51 A;  3NV0 A;  4R80 A;  2CG0 A;  3NBR A;  1AVK A;  3PS8 A;  2XRX B;  3Q90 A;  3MG3 A;  4MMY B;  3ALA A;  1YVB I;  2B1X B;  4MMX B;  3SVA A;  1D6Y A;  5CLK A;  1MNL A;  3LOY A;  2C10 A;  1OHS A;  2HMN B;  4EC6 A;  3OWY A;  5AEW B;  1WMO A;  2CWV A;  1O7H B;  1M9G A;  3NM7 A;  1UI7 A;  3GZR A;  3N8B A;  4IPB A;  2MC8 A;  4OVM A;  1DYU A;  1LXE A;  4KFF A;  4KFD A;  4XDV A;  3NHX A;  1J2B A;  2YFL B;  1JKG B;  1SII A;  1US1 A;  1KWI A;  3F8X A;  1JJ2 2;  1UUW B;  5EQL A;  1AVL A;  1JB2 A;  3CME 3;  1M1X B;  4HZ9 B;  4FMD A;  3DUK A;  2A15 A;  3EQQ B;  3MKI A;  2QGU A;  3K7C A;  2IUJ A;  3MG2 A;  1IVX A;  3F9S A;  4HM5 B;  4CCV A;  1W6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...