1W01A

Crystal structure of mutant enzyme y57f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
LPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 31
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w01A00
3MYTA 3MG1A 3NUVA 3F8XA 3FKAA 3VGNA 1WQLB 3FGYA 3MKIA 3EBYA 1QMAA 1UUWB 2CKFB 3JUNA 4LEHA 3FH1A 1GYBA 1JB5A 1HKXA 1JB2A 3EN1B 3B7CA 5AIHA 4WYKA 2F86B 1JB4A 2HMNB 1OF5A 1W02A 3EX9A 1Q40B 3F40A 5AIGA 8CHOA 3SOYA 3EN8A 5IG5A 1AR0A 4HM3B 2QIYA 4OVMA 3DXOA 1K41A 1OGZA 2RGQA 3FZWA 3UJMA 5CF2A 4HM4B 4HVNA 2PZVA 3DMCA 5KP1A 1BUQA 1NWWA 3B4PA 3GRDA 5FW5A 1OPYA 3DZLA 1Q42A 3JUPA 5KP3A 4WWUC 4HKVB 3BLZA 5CXOA 5IEOA 4XDVA 1STDA 5AIIA 1GS3A 1A2KA 3STDA 3NV0A 5JPPA 3OWYA 4MJDA 3NXJA 3CNXA 4WYKB 1OUNA 5CLKA 2B1XB 4L7KA 1IDPA 3NM2A 5CK6A 5IG3A 4LGQA 5CF1A 3G16A 1NDOB 4IIAA 3HX8A 2A15A 7STDA 2BMRB 1W00A 5HGRA 3MHEA 3LZAA 2XSHB 3RGRA 4K1UA 1DMQA 4STDA 4FCMA 3FF0A 4HM7B 1SJWA 3EBTA 5EVHA 2STDA 4CDLA 1JN5A 1ZX2A 2GEYA 1OH0A 4ORLA 3H3HA 2OWPA 3DM8A 3E99A 3CPOA 4X2HA 2QGUA 4L8OA 3CU3A 3GZYB 4XB5A 1GY7A 4HM2B 3HZPA 4HJLB 4XBYA 2GBWB 5D81A 5IERA 1VZZA 3NV0B 3SOAA 2I9WA 3EJVA 1E3RA 1O7GB 2HMOB 5AEUB 4K1VA 1OHSA 3M8CA 3BB9A 5IG0A 3NHXA 4RZMA 1OHPA 1ASKA 1ULIB 3F14A 2BMQB 3KKGA 5IEPA 2GXFA 1O7MB 1W01A 3FF2A 3K7CA 3D9RA 3FSDA 4FCJA 5KP4A 4HZBB 3MG3A 4HZ9B 3OV4A 4R9KA 1JN5B 4N3VA 4PEJA 5IG4A 3B4OA 3UNLA 5IENA 5TGNA 2XRXB 4XM4A 3KZTA 3F8HA 3T8NA 1OF5B 3WMDA 5DRVA 4R1KA 3ER7A 1ISKA 5BXQA 2F98A 3GWRA 2GEXA 1JKGA 2YFJB 2XR8B 2R4IA 3T8UA 1O7HB 2Z7AA 3G0KA 4H3UA 3GZXB 2IMJA 2YFIB 4HM1B 4Q53A 4HM5B 2HMKB 3SEDA 5AI1A 3FLJA 3CNMA 5BVBA 5AIFA 3MSOA 3F7SA 3KSPA 1S5AA 2INXA 1TUHA 6STDA 1O7NB 1W6YA 1NU3A 3S5CA 5DREA 2XSOB 2HMJB 1EA2A 4LMIA 4J9AA 3H51A 5D83A 2BMOB 3GZBA 3I0YA 4XDWA 1QJGA 1JKGB 3VSYA 2W2CA 5STDA 3IPTA 4R9LA 3A76A 2JQ5A 2HMMB 3Q90A 4U13A 1OGXA 3GZRA 2F99A 3G8ZA 3OX9A 3OWSA 1DMMA 5AEWB 2RCDA 2HMLB 5D82A 3DUKA 3OXAA 4J8TA 4I4KA 3F7XA 2Z76A 3HK4A 1TP6A 3NBRA 3K0ZA 2YFLB 1U5OA 3LYGA 3OWUA 2Z77A 1C7HA 2BNGA 5IF6A 1DMNA 3KE7A 2GBXB 4XBXA 1UUVB 3JUQA 4HM0B 4WP5A 4HM8B 2UX0A 3EHCA 1E3VA 4GB5A 3JUMA 1GY6A 2RFRA 1ULJB 1E97A 1ZO2A 3EQQB 3EF8A 1CQSA 1O7PB 1OHOA 2B24B 4L8PA 3RGAA 4X2OA 3B8LA 3ROBA 3ECFA 4HM6B 1OCVA 1GY5A 1Q40A 3F9SA 5G2GA 4OUQA 4XBTA 1EG9B 1Z1SA 3MG2A 3JUOA 1O7WB 2CHCA 4KVHA 5JPUA 3EC9A 2K54A
chains in the Genus database with same CATH superfamily
1IVWA 1M904 4BU4A 2ZHXB 2XFSA 1WMOA 1GD4A 2CK3H 3MYTA 4N6V0 3MG1A 2WGOA 1J2BA 1G96A 1IYYA 4MMYB 2BHMA 3NUVA 6GSPA 5M19A 2CW9A 3F8XA 3FKAA 4NHFA 3DGLA 3VGNA 5G1LA 4JF8A 2MF7A 1TJDA 3IJEB 1W6CA 2P05A 3D79A 1BSEA 1JRQA 3SX1A 1RTUA 1KD14 1WQLB 1CH0A 1Y4KA 3FGYA 3MKIA 1JNQA 1R4YA 3EBYA 1QMAA 1UUWB 2CKFB 3JUNA 5HOHA 4LEHA 3SVAA 3FH1A 1GYBA 1JB5A 2OCTA 1HKXA 3G4S3 1JB2A 3EN1B 4K61A 2IYJA 1RGGA 3B7CA 5AIHA 1K734 1RJOA 4WYKA 2F86B 2CFDA 1RGCA 2UUGC 1JB4A 2HMNB 1OF5A 1BSCA 1W02A 2W9PA 4AEQA 3UL6A 3EX9A 2P38A 1V57A 1Q40B 3HOHA 3WHOA 1BNRA 3F40A 4KT3B 1YI23 4O3VA 1LQMB 4LZIA 5AIGA 1ZGXA 8CHOA 5LC7A 2AADA 3SOYA 2J8XB 3EN8A 3DGMA 1AR0A 5IG5A 3D4AA 2GU3A 2QIYA 4HM3B 3DXOA 4OVMA 1ZS7A 1VQN3 1RKYA 3PGBA 1K41A 1OGZA 2RGQA 4FMAA 3Q2PA 3FZWA 3X3XA 2W04A 1CYVA 3UJMA 2XF3A 1Q7HA 5CF2A 4HM4B 1B2XA 1KSIA 5RNTA 4HVNA 2PZVA 1S723 5AYRB 3DMCA 1BNSA 3A5EA 4IPBA 5KP1A 1BUQA 1MWTA 1NWWA 2O3OA 3B4PA 4OK0A 1PU4A 3GRDA 5FW5A 1OPYA 1RGHA 1VQQA 5AYSC 1YJN3 3BNEA 2P0MA 2ZA4A 3DZLA 3X40A 3CCM3 3LTAA 1BRHA 1T5YA 2C4BA 1NB5I 1FYSA 1Q42A 3JUPA 3S29A 1C54A 1B3SA 1US1A 5KP3A 2P09A 4WWUC 4HKVB 3BLZA 5CXOA 2RNTA 3FG4A 1U8CB 2XFTA 5IEOA 1IT8A 2GU1A 1W7CA 1FGTA 1IU7A 1Q9EA 4XDVA 1STDA 3ALAA 1TTOA 1LRAA 5AIIA 1GS3A 3X3ZA 2C10A 4N6UA 1KWIA 1N5HA 2D1WA 4GSPA 5GSPA 1IVXA 1FGOA 4WHAA 1A2KA 1TIJA 3STDA 3NV0A 2CG1A 3V99A 5JPPA 1G02A 1LNHA 4R4KA 3PZWA 2CWTA 3OWYA 4MJDA 3NXJA 3CNXA 4WYKB 4CCVA 1A2VA 1W4NA 1OUNA 2M7OA 4EYCA 5CLKA 2B1XB 4L7KA 1IDPA 1GMPA 2KF4A 1WNHA 3S27A 3CC23 3NM2A 3EE1A 1I0VA 1QAKA 2D42A 5CK6A 5IG3A 4LGQA 3BNCA 3G16A 5CF1A 2QA43 5LC6A 1FGMA 1DETA 4TX4A 3WOFB 2CFWA 3QRDA 1NDOB 1QALA 4IIAA 3HX8A 2SARA 4O2HA 2A15A 2KXGA 3AHSA 7STDA 1LOYA 1LXEA 1NB3I 2LQVA 2OOVA 3SLUA 2R41A 1VQL3 3FG3A 2CFKA 1TU5A 1PFPA 2KAAA 4HYZA 1BOXA 1ROAA 2BMRB 1B2SA 2AAEA 1W00A 2CC3A 5HGRA 3ZG0A 3UL5A 1RRHA 1VQ83 1RGFA 3LZAA 3MHEA 2XSHB 3RGRA 4K1UA 2CWVA 1DMQA 1LOXA 1YVSA 2OTL3 4STDA 4FCMA 1L5GB 1IT7A 3FF0A 4HM7B 3CCR3 1MGRA 1SJWA 3EBTA 5EVHA 1MOLA 2STDA 1VQ73 1KC84 4CDLA 1MWUA 1JN5A 1LVNA 4KFDA 1ZX2A 2FNQA 1OH0A 2GEYA 2KF3A 3H3HA 4ORLA 2OWPA 4KFFA 4O02B 3CCE3 1W5ZA 4QWTA 1GMRA 3DM8A 3WODG 3E99A 3LXUX 2L1SA 3CPOA 4X2HA 3HIIA 3IMAB 2QGUA 4L8OA 3CU3A 4FMDA 3GZYB 1JJ22 1PY3A 1GY7A 4HM2B 4XB5A 2CWUA 5M1AA 2ZL8A 3ZFZA 2IUKA 3HZPA 4EC6A 1K9M4 2IA7A 1AV4A 1BGSA 2ML5A 3LH4A 4HJLB 2O9UX 4DKIA 1STFI 1RGAA 3AGOA 3SXXA 4XBYA 2GBWB 2KF5A 2WO0A 5D81A 1RRLA 5IERA 1IQ8A 1VZZA 3NV0B 3SOAA 3BU4A 2I9WA 3URPA 1Q814 2W9QA 3EJVA 1E3RA 1FGQA 3CPW2 3S67A 1JZDA 1O7GB 2HMOB 2H0HA 1KQS2 2KF6A 5AEUB 1ROVA 4K1VA 1TFOA 1OHSA 4WFOA 3M8CA 5EQLA 1HZ1A 3BIRA 1Q824 3HIGA 6RNTA 1BRGA 4BTYA 2C11A 3BB9A 5IG0A 1N8R4 3NHXA 1BNJA 2W03A 1RCLA 4G1MB 4NPBA 4RZMA 7RNTA 1EKMA 3RDEA 1YIJ3 1OHPA 1BNEA 2CX0A 1ASKA 1ULIB 1CEWI 3F14A 2BMQB 3KKGA 4LYLB 3N54B 2CG0A 5IEPA 2K3DA 1W6GA 4RNZA 2GXFA 1O7MB 3I563 1W01A 1RMSA 3FF2A 1BSAA 1AY7A 3K7CA 1M1XB 4GL6A 3MWZA 3D9RA 2OQEC 1FA3A 3FSDA 2PNCA 4FCJA 1VQ53 4JRFA 1SPUA 2XGNA 2Z6BA 4EBGA 3K63A 1I2EA 3K5TA 1YVBI 5KP4A 1EQKA 1UDII 1LNIA 1X1YA 1RNBA 4J5GA 3D5GA 4HZBB 3U1WA 3MG3A 4HZ9B 3LTCA 3OV4A 1MNLA 4R9KA 1JN5B 5EEOA 4N3VA 4NREA 1OACA 4PEJA 1Q864 2OTJ3 5IG4A 2W6JH 3UB1A 1FZUA 1TRQA 3KIIA 1M9GA 1UI8A 3B4OA 4N6TA 3V98A 3GSPA 1BAOA 3UNLA 2KRTA 1IVUA 1QVG2 3DH2A 1FUSA 5IENA 3PS8A 5TGNA 3NQZA 2XRXB 2V1LA 2E2UA 1IVVA 4N6OB 1DE3A 2BT3A 2WOHA 3CCV3 2BIRA 4XM4A 3KZTA 4BL2A 1LOWA 3FCSB 2OQEA 7GSPA 1EUIC 1BNGA 1RN1A 3F8HA 2CFGA 3T8NA 4BTWA 1RCKA 1VQM3 3KN4A 1OF5B 1I3IA 3WMDA 1D6YA 2RBIA 3D5IA 1RN7A 1M1K4 5DRVA 1LQGC 1BRJA 3ER7A 4R1KA 1ISKA 5BXQA 2F98A 2Q07A 1WMPA 3CCS3 5ELUA 1AVKA 1YJW3 1WMNA 3GWRA 3LTBA 2GEXA 3HI7A 4HOHA 1JKGA 1V58A 2YFJB 2F56A 1EEJA 3G6E3 4KZ1A 2XR8B 1B2MA 2R4IA 1YHQ3 1SIHA 1AVLA 4HBRA 1RGLA 1K28A 3RNTA 3LT8A 5G1KA 3T8UA 2CFLA 2F4YA 2CIUA 1O7HB 1UCLA 3GAXA 2Z7AA 3G0KA 1T2IA 3GZXB 4H3UA 2IUJA 2IMJA 1IV7A 2LYXA 2YFIB 4CJNA 4HM1B 4Q53A 1UW1A 4HM5B 5A0OB 1UGHI 3PYJA 1SIIA 4FR9A 2HMKB 1FW7A 4MEIA 1GOYA 3CCL3 3SEDA 2KCDA 2W56A 3DGYA 1HYFA 1FUTA 5AI1A 1D6UA 2YX9A 3FLJA 1QVF2 3CNMA 1BRSA 5BVBA 1BSBA 4MMZB 1RNTA 3NBJA 3BNDA 3JVCA 3KFQC 1MWSA 5AIFA 4AKYA 3MSOA 1T3BA 3F7SA 1NJI4 3KSPA 3Q3FA 2CX1A 5JBSA 3DGOA 3CCU3 1UUGB 1S5AA 3CC43 2MC8A 2INXA 3AHWA 1YJ93 1X1UA 5I97A 4AKZA 3WA2X 1IQXA 1TUHA 3WDGB 3LMLA 6STDA 3G713 1O7NB 1JBRA 1W6YA 3NBBA 3J7Yd 1NU3A 1DVCA 1F8NA 1UI7A 3X41A 3S5CA 9RNTA 3O8YA 1N9EA 1GD3A 3ZG5A 1BU4A 1IK3A 5DREA 2XSOB 3AMOA 2HMJB 1DYUA 3PXMA 1EA2A 4HAAA 4LMIA 3MPHA 3AGNA 4J9AA 1AQZA 1YGWA 3H51A 1A90A 5D83A 2BMOB 4N6NB 3GZBA 4GHOA 1G0TA 1YGEA 1I70A 4H61A 1MWRA 1N9JA 3I0YA 4XDWA 3X3YA 2XH9A 2SBLA 4LSOA 1UGIA 3X42A 1TFKA 1QJGA 1BNFA 1T2HA 1A2PA 1JKGB 1BVIA 2RSXA 2ML6A 1RGEA 3VSYA 2W2CA 4IT7A 3IPTA 5STDA 4R9LA 3S28A 1VQP3 3WA3A 1LOVA 3A76A 3QK9A 3WR2A 4EV2A 2QEX3 4RBNA 3D3LA 4FMCA 2JQ5A 4FCZA 1I2GA 2HMMB 1RLSA 1X1WA 3Q90A 1OGXA 4U13A 4CPKA 4KFEA 2E2VA 2F99A 3GZRA 3G8ZA 3OX9A 3OWSA 1DMMA 4I5QA 5AEWB 2W56B 2RCDA 2HMLB 4ZM8A 1N5PA 1CYUA 4RNTA 3U97A 1GSPA 3CCJ3 5D82A 1V74A 4N6LA 4EXRA 8RNTA 1RSNA 3DUKA 3OXAA 4J8TA 4N6MA 1NNVA 4I4KA 4J5KA 3KSED 3F7XA 4K90B 2Y73A 3WOEB 1FUWA 2WGQA 3N8BA 1BUJA 2Z76A 3HK4A 2P0XA 3DY5A 1TP6A 1BIRA 3NBRA 1WTHA 3K0ZA 2L4VA 3KCHA 1VQ43 3L0RA 3BNBA 2YFLB 1MGWA 1JV2B 1U5OA 3LYGA 3NM7A 2JDIH 5ELJA 3CXC2 3OWUA 3NQYA 3T0UA 1D6ZA 2Z77A 3CME3 1C7HA 2BNGA 4EW5A 1JZOA 1RDSA 1RN4A 2IY2A 5IF6A 1N8QA 1DMNA 3CC73 1X1XA 2GBXB 2WOFA 3KE7A 4XBXA 1W2B2 1UUVB 3JUQA 4HM0B 2FGTA 1GOUA 1I2FA 4WP5A 2F5MA 3VF1A 1UCJA 2UGIA 3OW22 1BRIA 4HM8B 1VQK3 1BRKA 1QAFA 3AMOB 4BTXA 2Y74A 2W0QA 1BRNL 2UX0A 2OOVC 3EHCA 1E3VA 1YNVX 4GB5A 3LTDA 1I3FA 3JUMA 2CH9A 2BU4A 1FGRA 1GY6A 2RFRA 1ULJB 1E97A 1ZO2A 3EQQB 3EF8A 1IQYA 2FXTA 1CQSA 4MMXB 3CD63 1B2ZA 1I0XA 1O7PB 2GSPA 1B27A 3N9HA 1OHOA 1SQWA 1I8VA 2B24B 5FGOA 4L8PA 1RGKA 4EV5A 3Q1CA 2XGLA 3RGAA 4X2OA 2F5WA 3EB8A 1VQO3 3B8LA 2ZDJA 3ROBA 1YIT3 3ECFA 1HU9A 3FG1A 1UCKA 4HM6B 1OCVA 1JBSA 1GOVA 3LT9A 1GY5A 1RHLA 1Q40A 1W2ZA 2K0MA 4O8SA 1Q7Y4 1K8A4 3F9SA 4BIRA 1PYLA 4ILFA 1JBTA 5G2GA 1B20A 3SYUA 4R80A 4OUQA 2XEPA 2H0IA 4XBTA 1BSDA 3V92A 4BL3A 4FMBA 2H0GA 3CMA3 1EG9B 1R4CA 3K9MC 5BU4A 3I553 3PCRA 1B2UA 4RNYA 1TRPA 2BO9B 3NX0A 5M18A 1SARA 3LOYA 1GMQA 1Z1SA 3MG2A 3JUOA 5BIRA 1O7WB 2HOHA 5IW9A 1UCIA 2E2TA 3TDGA 2CHCA 4KVHA 5JPUA 3CCQ3 1VQ93 1VQ63 1B21A 1BANA 3EC9A 2K54A 3DGNA 1IV9A 1DVDA 1NO3A 1A67A 1BNIA 3PCSA
chains in the Genus database with same CATH topology
1IVWA 1M904 2XFSA 1WMOA 1GD4A 2CK3H 3MYTA 4N6V0 3MG1A 2WGOA 1J2BA 1G96A 4MMYB 2BHMA 3NUVA 2CW9A 3F8XA 3FKAA 4NHFA 3DGLA 3VGNA 4JF8A 2MF7A 3IJEB 1W6CA 2P05A 1JRQA 3SX1A 1KD14 1WQLB 1Y4KA 3FGYA 3MKIA 1JNQA 3EBYA 1QMAA 1UUWB 2CKFB 3JUNA 4LEHA 3SVAA 3FH1A 1GYBA 1JB5A 2OCTA 1HKXA 3G4S3 1JB2A 3EN1B 4K61A 3B7CA 5AIHA 1K734 1RJOA 4WYKA 2F86B 2CFDA 1JB4A 2HMNB 1OF5A 1W02A 2W9PA 4AEQA 3UL6A 3EX9A 2P38A 1Q40B 3F40A 1YI23 4O3VA 5AIGA 4LZIA 8CHOA 5LC7A 3SOYA 3EN8A 3DGMA 1AR0A 5IG5A 2GU3A 2QIYA 4HM3B 3DXOA 4OVMA 1VQN3 3PGBA 1K41A 1OGZA 2RGQA 4FMAA 3Q2PA 3FZWA 3X3XA 2W04A 1CYVA 3UJMA 2XF3A 5CF2A 4HM4B 1KSIA 4HVNA 2PZVA 1S723 5AYRB 3DMCA 5KP1A 4IPBA 1BUQA 1NWWA 2O3OA 3B4PA 4OK0A 1PU4A 3GRDA 5FW5A 1OPYA 5AYSC 1YJN3 3BNEA 2P0MA 3DZLA 3X40A 3CCM3 3LTAA 1T5YA 1NB5I 1Q42A 3JUPA 3S29A 1US1A 5KP3A 2P09A 4WWUC 4HKVB 3BLZA 5CXOA 3FG4A 1U8CB 2XFTA 5IEOA 1IT8A 2GU1A 1W7CA 1FGTA 1IU7A 4XDVA 1STDA 3ALAA 5AIIA 1GS3A 3X3ZA 2C10A 4N6UA 1KWIA 1N5HA 2D1WA 1IVXA 1FGOA 4WHAA 1A2KA 1TIJA 3STDA 3NV0A 2CG1A 3V99A 5JPPA 1LNHA 4R4KA 3PZWA 2CWTA 3OWYA 4MJDA 3NXJA 3CNXA 4WYKB 4CCVA 1A2VA 1W4NA 1OUNA 2M7OA 4EYCA 5CLKA 2B1XB 4L7KA 1IDPA 3CC23 1WNHA 3S27A 3NM2A 3EE1A 1QAKA 2D42A 5CK6A 5IG3A 4LGQA 3BNCA 3G16A 5CF1A 2QA43 5LC6A 1FGMA 3WOFB 4TX4A 2CFWA 3QRDA 1NDOB 1QALA 4IIAA 3HX8A 4O2HA 2A15A 2KXGA 7STDA 1LXEA 1NB3I 2LQVA 2OOVA 3SLUA 1VQL3 3FG3A 2CFKA 1TU5A 1PFPA 4HYZA 1ROAA 2BMRB 1W00A 2CC3A 5HGRA 3UL5A 1RRHA 1VQ83 3MHEA 3LZAA 2XSHB 3RGRA 4K1UA 2CWVA 1DMQA 1LOXA 2OTL3 4STDA 4FCMA 1L5GB 1IT7A 3FF0A 4HM7B 3CCR3 1SJWA 3EBTA 5EVHA 1MOLA 2STDA 1VQ73 1KC84 4CDLA 4KFDA 1JN5A 1LVNA 1ZX2A 2FNQA 1OH0A 2GEYA 4ORLA 3H3HA 2OWPA 4KFFA 4O02B 3CCE3 1W5ZA 4QWTA 3DM8A 3WODG 3E99A 3LXUX 3CPOA 4X2HA 3HIIA 3IMAB 2QGUA 4L8OA 3CU3A 4FMDA 3GZYB 1JJ22 4XB5A 1GY7A 4HM2B 2CWUA 2ZL8A 2IUKA 3HZPA 4EC6A 1K9M4 2IA7A 1AV4A 2ML5A 4HJLB 3LH4A 2O9UX 1STFI 3SXXA 4XBYA 2GBWB 2WO0A 5D81A 1RRLA 5IERA 1IQ8A 1VZZA 3NV0B 3SOAA 2I9WA 1Q814 2W9QA 3EJVA 1E3RA 1FGQA 3CPW2 3S67A 1O7GB 2HMOB 1KQS2 5AEUB 1ROVA 4K1VA 1TFOA 1OHSA 4WFOA 3M8CA 5EQLA 1Q824 3HIGA 4BTYA 2C11A 3BB9A 5IG0A 1N8R4 3NHXA 2W03A 4G1MB 4RZMA 1EKMA 3RDEA 1YIJ3 1OHPA 1ASKA 1ULIB 1CEWI 3F14A 2BMQB 3KKGA 3N54B 2CG0A 5IEPA 1W6GA 4RNZA 2GXFA 1O7MB 3I563 1W01A 3FF2A 3K7CA 1M1XB 4GL6A 3MWZA 3D9RA 2OQEC 1FA3A 3FSDA 2PNCA 4FCJA 1VQ53 4JRFA 1SPUA 2XGNA 2Z6BA 4EBGA 3K63A 3K5TA 1YVBI 5KP4A 1EQKA 4HZBB 3U1WA 3MG3A 4HZ9B 3LTCA 3OV4A 1MNLA 4R9KA 1JN5B 5EEOA 4N3VA 4NREA 1OACA 4PEJA 1Q864 2OTJ3 5IG4A 2W6JH 3UB1A 3KIIA 1M9GA 1UI8A 3B4OA 4N6TA 3V98A 3UNLA 2KRTA 1IVUA 1QVG2 5IENA 3PS8A 5TGNA 3NQZA 2XRXB 2V1LA 2E2UA 1IVVA 4N6OB 2BT3A 2WOHA 3CCV3 4XM4A 3KZTA 3FCSB 2OQEA 3F8HA 1VQM3 2CFGA 3T8NA 3KN4A 1OF5B 3WMDA 1D6YA 1RN7A 1M1K4 5DRVA 4R1KA 3ER7A 1ISKA 5BXQA 2F98A 2Q07A 1WMPA 5ELUA 1AVKA 1YJW3 1WMNA 3GWRA 3LTBA 2GEXA 3HI7A 1JKGA 2YFJB 3G6E3 4KZ1A 2XR8B 2R4IA 1YHQ3 1SIHA 1AVLA 4HBRA 1K28A 3LT8A 3T8UA 2CFLA 2CIUA 1O7HB 3GAXA 2Z7AA 3G0KA 4H3UA 3GZXB 2IUJA 2IMJA 1IV7A 2LYXA 2YFIB 4HM1B 4Q53A 1UW1A 4HM5B 5A0OB 3PYJA 1SIIA 4FR9A 2HMKB 4MEIA 3CCL3 3SEDA 2KCDA 2W56A 5AI1A 1D6UA 2YX9A 3FLJA 1QVF2 3CNMA 5BVBA 4MMZB 3NBJA 3BNDA 3JVCA 3KFQC 5AIFA 4AKYA 3MSOA 3F7SA 1NJI4 3KSPA 5JBSA 3DGOA 3CCU3 1S5AA 3CC43 2MC8A 2INXA 1YJ93 5I97A 4AKZA 3WA2X 1IQXA 1TUHA 3WDGB 3LMLA 6STDA 3G713 1O7NB 1W6YA 3NBBA 3J7Yd 1NU3A 1DVCA 1F8NA 1UI7A 3X41A 3S5CA 3O8YA 1N9EA 1GD3A 1IK3A 5DREA 2XSOB 3AMOA 2HMJB 1DYUA 3PXMA 1EA2A 4LMIA 4BTWA 3MPHA 4J9AA 3H51A 1A90A 5D83A 2BMOB 4N6NB 3GZBA 1YGEA 4H61A 1N9JA 3I0YA 4XDWA 3X3YA 2XH9A 2SBLA 4LSOA 3X42A 1TFKA 1QJGA 2RSXA 1RKYA 1JKGB 2ML6A 3VSYA 2W2CA 4IT7A 3IPTA 5STDA 4R9LA 3S28A 1VQP3 3WA3A 3A76A 3QK9A 4EV2A 2QEX3 4RBNA 3D3LA 4FMCA 2JQ5A 4FCZA 2HMMB 3Q90A 4U13A 1OGXA 4KFEA 2E2VA 2F99A 3GZRA 3G8ZA 3OX9A 3OWSA 1DMMA 5AEWB 2W56B 2RCDA 2HMLB 4ZM8A 1N5PA 1CYUA 3U97A 3CCJ3 5D82A 1V74A 4N6LA 4EXRA 3DUKA 3OXAA 4J8TA 4N6MA 4I4KA 3KSED 3F7XA 4K90B 2Y73A 3WOEB 1FUWA 2WGQA 3N8BA 2Z76A 3HK4A 2P0XA 3DY5A 1TP6A 3NBRA 1WTHA 3K0ZA 2L4VA 1VQ43 3L0RA 3BNBA 2YFLB 1U5OA 1JV2B 3LYGA 3NM7A 2JDIH 5ELJA 3CXC2 3OWUA 3NQYA 3T0UA 1D6ZA 2Z77A 3CME3 1C7HA 2BNGA 5IF6A 1N8QA 1DMNA 3CC73 2WOFA 2GBXB 3KE7A 1W2B2 4XBXA 1UUVB 3JUQA 4HM0B 2FGTA 4WP5A 3VF1A 3OW22 4HM8B 1VQK3 1QAFA 3AMOB 4BTXA 2Y74A 2W0QA 2UX0A 2OOVC 3EHCA 1E3VA 4GB5A 3LTDA 3JUMA 2CH9A 1FGRA 1GY6A 2RFRA 1ULJB 1E97A 1ZO2A 3EQQB 3EF8A 1IQYA 2FXTA 1CQSA 4MMXB 3CD63 1O7PB 3N9HA 1OHOA 1SQWA 2B24B 5FGOA 4L8PA 4EV5A 3Q1CA 2XGLA 3RGAA 4X2OA 3EB8A 1VQO3 3B8LA 2ZDJA 3ROBA 1YIT3 3ECFA 1HU9A 3FG1A 4HM6B 1OCVA 3LT9A 1GY5A 1Q40A 1W2ZA 2K0MA 4O8SA 1Q7Y4 1K8A4 3F9SA 5G2GA 4R80A 4OUQA 2XEPA 4XBTA 3V92A 4FMBA 3CMA3 1EG9B 1R4CA 3K9MC 3I553 3PCRA 4RNYA 2BO9B 3NX0A 3LOYA 1Z1SA 3MG2A 3JUOA 1O7WB 5IW9A 1VQ63 2E2TA 3TDGA 2CHCA 4KVHA 5JPUA 3CCQ3 1VQ93 3EC9A 2K54A 3DGNA 1IV9A 1DVDA 1NO3A 1A67A 3CCS3 3PCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MYT A;  3MG1 A;  3NUV A;  3F8X A;  3FKA A;  3VGN A;  1WQL B;  3FGY A;  3MKI A;  3EBY A;  1QMA A;  1UUW B;  2CKF B;  3JUN A;  4LEH A;  3FH1 A;  1GYB A;  1JB5 A;  1HKX A;  1JB2 A;  3EN1 B;  3B7C A;  5AIH A;  4WYK A;  2F86 B;  1JB4 A;  2HMN B;  1OF5 A;  1W02 A;  3EX9 A;  1Q40 B;  3F40 A;  5AIG A;  8CHO A;  3SOY A;  3EN8 A;  5IG5 A;  1AR0 A;  4HM3 B;  2QIY A;  4OVM A;  3DXO A;  1K41 A;  1OGZ A;  2RGQ A;  3FZW A;  3UJM A;  5CF2 A;  4HM4 B;  4HVN A;  2PZV A;  3DMC A;  5KP1 A;  1BUQ A;  1NWW A;  3B4P A;  3GRD A;  5FW5 A;  1OPY A;  3DZL A;  1Q42 A;  3JUP A;  5KP3 A;  4WWU C;  4HKV B;  3BLZ A;  5CXO A;  5IEO A;  4XDV A;  1STD A;  5AII A;  1GS3 A;  1A2K A;  3STD A;  3NV0 A;  5JPP A;  3OWY A;  4MJD A;  3NXJ A;  3CNX A;  4WYK B;  1OUN A;  5CLK A;  2B1X B;  4L7K A;  1IDP A;  3NM2 A;  5CK6 A;  5IG3 A;  4LGQ A;  5CF1 A;  3G16 A;  1NDO B;  4IIA A;  3HX8 A;  2A15 A;  7STD A;  2BMR B;  1W00 A;  5HGR A;  3MHE A;  3LZA A;  2XSH B;  3RGR A;  4K1U A;  1DMQ A;  4STD A;  4FCM A;  3FF0 A;  4HM7 B;  1SJW A;  3EBT A;  5EVH A;  2STD A;  4CDL A;  1JN5 A;  1ZX2 A;  2GEY A;  1OH0 A;  4ORL A;  3H3H A;  2OWP A;  3DM8 A;  3E99 A;  3CPO A;  4X2H A;  2QGU A;  4L8O A;  3CU3 A;  3GZY B;  4XB5 A;  1GY7 A;  4HM2 B;  3HZP A;  4HJL B;  4XBY A;  2GBW B;  5D81 A;  5IER A;  1VZZ A;  3NV0 B;  3SOA A;  2I9W A;  3EJV A;  1E3R A;  1O7G B;  2HMO B;  5AEU B;  4K1V A;  1OHS A;  3M8C A;  3BB9 A;  5IG0 A;  3NHX A;  4RZM A;  1OHP A;  1ASK A;  1ULI B;  3F14 A;  2BMQ B;  3KKG A;  5IEP A;  2GXF A;  1O7M B;  1W01 A;  3FF2 A;  3K7C A;  3D9R A;  3FSD A;  4FCJ A;  5KP4 A;  4HZB B;  3MG3 A;  4HZ9 B;  3OV4 A;  4R9K A;  1JN5 B;  4N3V A;  4PEJ A;  5IG4 A;  3B4O A;  3UNL A;  5IEN A;  5TGN A;  2XRX B;  4XM4 A;  3KZT A;  3F8H A;  3T8N A;  1OF5 B;  3WMD A;  5DRV A;  4R1K A;  3ER7 A;  1ISK A;  5BXQ A;  2F98 A;  3GWR A;  2GEX A;  1JKG A;  2YFJ B;  2XR8 B;  2R4I A;  3T8U A;  1O7H B;  2Z7A A;  3G0K A;  4H3U A;  3GZX B;  2IMJ A;  2YFI B;  4HM1 B;  4Q53 A;  4HM5 B;  2HMK B;  3SED A;  5AI1 A;  3FLJ A;  3CNM A;  5BVB A;  5AIF A;  3MSO A;  3F7S A;  3KSP A;  1S5A A;  2INX A;  1TUH A;  6STD A;  1O7N B;  1W6Y A;  1NU3 A;  3S5C A;  5DRE A;  2XSO B;  2HMJ B;  1EA2 A;  4LMI A;  4J9A A;  3H51 A;  5D83 A;  2BMO B;  3GZB A;  3I0Y A;  4XDW A;  1QJG A;  1JKG B;  3VSY A;  2W2C A;  5STD A;  3IPT A;  4R9L A;  3A76 A;  2JQ5 A;  2HMM B;  3Q90 A;  4U13 A;  1OGX A;  3GZR A;  2F99 A;  3G8Z A;  3OX9 A;  3OWS A;  1DMM A;  5AEW B;  2RCD A;  2HML B;  5D82 A;  3DUK A;  3OXA A;  4J8T A;  4I4K A;  3F7X A;  2Z76 A;  3HK4 A;  1TP6 A;  3NBR A;  3K0Z A;  2YFL B;  1U5O A;  3LYG A;  3OWU A;  2Z77 A;  1C7H A;  2BNG A;  5IF6 A;  1DMN A;  3KE7 A;  2GBX B;  4XBX A;  1UUV B;  3JUQ A;  4HM0 B;  4WP5 A;  4HM8 B;  2UX0 A;  3EHC A;  1E3V A;  4GB5 A;  3JUM A;  1GY6 A;  2RFR A;  1ULJ B;  1E97 A;  1ZO2 A;  3EQQ B;  3EF8 A;  1CQS A;  1O7P B;  1OHO A;  2B24 B;  4L8P A;  3RGA A;  4X2O A;  3B8L A;  3ROB A;  3ECF A;  4HM6 B;  1OCV A;  1GY5 A;  1Q40 A;  3F9S A;  5G2G A;  4OUQ A;  4XBT A;  1EG9 B;  1Z1S A;  3MG2 A;  3JUO A;  1O7W B;  2CHC A;  4KVH A;  5JPU A;  3EC9 A;  2K54 A; 
#chains in the Genus database with same CATH topology
 1IVW A;  1M90 4;  4BU4 A;  2ZHX B;  2XFS A;  1WMO A;  1GD4 A;  2CK3 H;  3MYT A;  4N6V 0;  3MG1 A;  2WGO A;  1J2B A;  1G96 A;  1IYY A;  4MMY B;  2BHM A;  3NUV A;  6GSP A;  5M19 A;  2CW9 A;  3F8X A;  3FKA A;  4NHF A;  3DGL A;  3VGN A;  5G1L A;  4JF8 A;  2MF7 A;  1TJD A;  3IJE B;  1W6C A;  2P05 A;  3D79 A;  1BSE A;  1JRQ A;  3SX1 A;  1RTU A;  1KD1 4;  1WQL B;  1CH0 A;  1Y4K A;  3FGY A;  3MKI A;  1JNQ A;  1R4Y A;  3EBY A;  1QMA A;  1UUW B;  2CKF B;  3JUN A;  5HOH A;  4LEH A;  3SVA A;  3FH1 A;  1GYB A;  1JB5 A;  2OCT A;  1HKX A;  3G4S 3;  1JB2 A;  3EN1 B;  4K61 A;  2IYJ A;  1RGG A;  3B7C A;  5AIH A;  1K73 4;  1RJO A;  4WYK A;  2F86 B;  2CFD A;  1RGC A;  2UUG C;  1JB4 A;  2HMN B;  1OF5 A;  1BSC A;  1W02 A;  2W9P A;  4AEQ A;  3UL6 A;  3EX9 A;  2P38 A;  1V57 A;  1Q40 B;  3HOH A;  3WHO A;  1BNR A;  3F40 A;  4KT3 B;  1YI2 3;  4O3V A;  1LQM B;  4LZI A;  5AIG A;  1ZGX A;  8CHO A;  5LC7 A;  2AAD A;  3SOY A;  2J8X B;  3EN8 A;  3DGM A;  1AR0 A;  5IG5 A;  3D4A A;  2GU3 A;  2QIY A;  4HM3 B;  3DXO A;  4OVM A;  1ZS7 A;  1VQN 3;  1RKY A;  3PGB A;  1K41 A;  1OGZ A;  2RGQ A;  4FMA A;  3Q2P A;  3FZW A;  3X3X A;  2W04 A;  1CYV A;  3UJM A;  2XF3 A;  1Q7H A;  5CF2 A;  4HM4 B;  1B2X A;  1KSI A;  5RNT A;  4HVN A;  2PZV A;  1S72 3;  5AYR B;  3DMC A;  1BNS A;  3A5E A;  4IPB A;  5KP1 A;  1BUQ A;  1MWT A;  1NWW A;  2O3O A;  3B4P A;  4OK0 A;  1PU4 A;  3GRD A;  5FW5 A;  1OPY A;  1RGH A;  1VQQ A;  5AYS C;  1YJN 3;  3BNE A;  2P0M A;  2ZA4 A;  3DZL A;  3X40 A;  3CCM 3;  3LTA A;  1BRH A;  1T5Y A;  2C4B A;  1NB5 I;  1FYS A;  1Q42 A;  3JUP A;  3S29 A;  1C54 A;  1B3S A;  1US1 A;  5KP3 A;  2P09 A;  4WWU C;  4HKV B;  3BLZ A;  5CXO A;  2RNT A;  3FG4 A;  1U8C B;  2XFT A;  5IEO A;  1IT8 A;  2GU1 A;  1W7C A;  1FGT A;  1IU7 A;  1Q9E A;  4XDV A;  1STD A;  3ALA A;  1TTO A;  1LRA A;  5AII A;  1GS3 A;  3X3Z A;  2C10 A;  4N6U A;  1KWI A;  1N5H A;  2D1W A;  4GSP A;  5GSP A;  1IVX A;  1FGO A;  4WHA A;  1A2K A;  1TIJ A;  3STD A;  3NV0 A;  2CG1 A;  3V99 A;  5JPP A;  1G02 A;  1LNH A;  4R4K A;  3PZW A;  2CWT A;  3OWY A;  4MJD A;  3NXJ A;  3CNX A;  4WYK B;  4CCV A;  1A2V A;  1W4N A;  1OUN A;  2M7O A;  4EYC A;  5CLK A;  2B1X B;  4L7K A;  1IDP A;  1GMP A;  2KF4 A;  1WNH A;  3S27 A;  3CC2 3;  3NM2 A;  3EE1 A;  1I0V A;  1QAK A;  2D42 A;  5CK6 A;  5IG3 A;  4LGQ A;  3BNC A;  3G16 A;  5CF1 A;  2QA4 3;  5LC6 A;  1FGM A;  1DET A;  4TX4 A;  3WOF B;  2CFW A;  3QRD A;  1NDO B;  1QAL A;  4IIA A;  3HX8 A;  2SAR A;  4O2H A;  2A15 A;  2KXG A;  3AHS A;  7STD A;  1LOY A;  1LXE A;  1NB3 I;  2LQV A;  2OOV A;  3SLU A;  2R41 A;  1VQL 3;  3FG3 A;  2CFK A;  1TU5 A;  1PFP A;  2KAA A;  4HYZ A;  1BOX A;  1ROA A;  2BMR B;  1B2S A;  2AAE A;  1W00 A;  2CC3 A;  5HGR A;  3ZG0 A;  3UL5 A;  1RRH A;  1VQ8 3;  1RGF A;  3LZA A;  3MHE A;  2XSH B;  3RGR A;  4K1U A;  2CWV A;  1DMQ A;  1LOX A;  1YVS A;  2OTL 3;  4STD A;  4FCM A;  1L5G B;  1IT7 A;  3FF0 A;  4HM7 B;  3CCR 3;  1MGR A;  1SJW A;  3EBT A;  5EVH A;  1MOL A;  2STD A;  1VQ7 3;  1KC8 4;  4CDL A;  1MWU A;  1JN5 A;  1LVN A;  4KFD A;  1ZX2 A;  2FNQ A;  1OH0 A;  2GEY A;  2KF3 A;  3H3H A;  4ORL A;  2OWP A;  4KFF A;  4O02 B;  3CCE 3;  1W5Z A;  4QWT A;  1GMR A;  3DM8 A;  3WOD G;  3E99 A;  3LXU X;  2L1S A;  3CPO A;  4X2H A;  3HII A;  3IMA B;  2QGU A;  4L8O A;  3CU3 A;  4FMD A;  3GZY B;  1JJ2 2;  1PY3 A;  1GY7 A;  4HM2 B;  4XB5 A;  2CWU A;  5M1A A;  2ZL8 A;  3ZFZ A;  2IUK A;  3HZP A;  4EC6 A;  1K9M 4;  2IA7 A;  1AV4 A;  1BGS A;  2ML5 A;  3LH4 A;  4HJL B;  2O9U X;  4DKI A;  1STF I;  1RGA A;  3AGO A;  3SXX A;  4XBY A;  2GBW B;  2KF5 A;  2WO0 A;  5D81 A;  1RRL A;  5IER A;  1IQ8 A;  1VZZ A;  3NV0 B;  3SOA A;  3BU4 A;  2I9W A;  3URP A;  1Q81 4;  2W9Q A;  3EJV A;  1E3R A;  1FGQ A;  3CPW 2;  3S67 A;  1JZD A;  1O7G B;  2HMO B;  2H0H A;  1KQS 2;  2KF6 A;  5AEU B;  1ROV A;  4K1V A;  1TFO A;  1OHS A;  4WFO A;  3M8C A;  5EQL A;  1HZ1 A;  3BIR A;  1Q82 4;  3HIG A;  6RNT A;  1BRG A;  4BTY A;  2C11 A;  3BB9 A;  5IG0 A;  1N8R 4;  3NHX A;  1BNJ A;  2W03 A;  1RCL A;  4G1M B;  4NPB A;  4RZM A;  7RNT A;  1EKM A;  3RDE A;  1YIJ 3;  1OHP A;  1BNE A;  2CX0 A;  1ASK A;  1ULI B;  1CEW I;  3F14 A;  2BMQ B;  3KKG A;  4LYL B;  3N54 B;  2CG0 A;  5IEP A;  2K3D A;  1W6G A;  4RNZ A;  2GXF A;  1O7M B;  3I56 3;  1W01 A;  1RMS A;  3FF2 A;  1BSA A;  1AY7 A;  3K7C A;  1M1X B;  4GL6 A;  3MWZ A;  3D9R A;  2OQE C;  1FA3 A;  3FSD A;  2PNC A;  4FCJ A;  1VQ5 3;  4JRF A;  1SPU A;  2XGN A;  2Z6B A;  4EBG A;  3K63 A;  1I2E A;  3K5T A;  1YVB I;  5KP4 A;  1EQK A;  1UDI I;  1LNI A;  1X1Y A;  1RNB A;  4J5G A;  3D5G A;  4HZB B;  3U1W A;  3MG3 A;  4HZ9 B;  3LTC A;  3OV4 A;  1MNL A;  4R9K A;  1JN5 B;  5EEO A;  4N3V A;  4NRE A;  1OAC A;  4PEJ A;  1Q86 4;  2OTJ 3;  5IG4 A;  2W6J H;  3UB1 A;  1FZU A;  1TRQ A;  3KII A;  1M9G A;  1UI8 A;  3B4O A;  4N6T A;  3V98 A;  3GSP A;  1BAO A;  3UNL A;  2KRT A;  1IVU A;  1QVG 2;  3DH2 A;  1FUS A;  5IEN A;  3PS8 A;  5TGN A;  3NQZ A;  2XRX B;  2V1L A;  2E2U A;  1IVV A;  4N6O B;  1DE3 A;  2BT3 A;  2WOH A;  3CCV 3;  2BIR A;  4XM4 A;  3KZT A;  4BL2 A;  1LOW A;  3FCS B;  2OQE A;  7GSP A;  1EUI C;  1BNG A;  1RN1 A;  3F8H A;  2CFG A;  3T8N A;  4BTW A;  1RCK A;  1VQM 3;  3KN4 A;  1OF5 B;  1I3I A;  3WMD A;  1D6Y A;  2RBI A;  3D5I A;  1RN7 A;  1M1K 4;  5DRV A;  1LQG C;  1BRJ A;  3ER7 A;  4R1K A;  1ISK A;  5BXQ A;  2F98 A;  2Q07 A;  1WMP A;  3CCS 3;  5ELU A;  1AVK A;  1YJW 3;  1WMN A;  3GWR A;  3LTB A;  2GEX A;  3HI7 A;  4HOH A;  1JKG A;  1V58 A;  2YFJ B;  2F56 A;  1EEJ A;  3G6E 3;  4KZ1 A;  2XR8 B;  1B2M A;  2R4I A;  1YHQ 3;  1SIH A;  1AVL A;  4HBR A;  1RGL A;  1K28 A;  3RNT A;  3LT8 A;  5G1K A;  3T8U A;  2CFL A;  2F4Y A;  2CIU A;  1O7H B;  1UCL A;  3GAX A;  2Z7A A;  3G0K A;  1T2I A;  3GZX B;  4H3U A;  2IUJ A;  2IMJ A;  1IV7 A;  2LYX A;  2YFI B;  4CJN A;  4HM1 B;  4Q53 A;  1UW1 A;  4HM5 B;  5A0O B;  1UGH I;  3PYJ A;  1SII A;  4FR9 A;  2HMK B;  1FW7 A;  4MEI A;  1GOY A;  3CCL 3;  3SED A;  2KCD A;  2W56 A;  3DGY A;  1HYF A;  1FUT A;  5AI1 A;  1D6U A;  2YX9 A;  3FLJ A;  1QVF 2;  3CNM A;  1BRS A;  5BVB A;  1BSB A;  4MMZ B;  1RNT A;  3NBJ A;  3BND A;  3JVC A;  3KFQ C;  1MWS A;  5AIF A;  4AKY A;  3MSO A;  1T3B A;  3F7S A;  1NJI 4;  3KSP A;  3Q3F A;  2CX1 A;  5JBS A;  3DGO A;  3CCU 3;  1UUG B;  1S5A A;  3CC4 3;  2MC8 A;  2INX A;  3AHW A;  1YJ9 3;  1X1U A;  5I97 A;  4AKZ A;  3WA2 X;  1IQX A;  1TUH A;  3WDG B;  3LML A;  6STD A;  3G71 3;  1O7N B;  1JBR A;  1W6Y A;  3NBB A;  3J7Y d;  1NU3 A;  1DVC A;  1F8N A;  1UI7 A;  3X41 A;  3S5C A;  9RNT A;  3O8Y A;  1N9E A;  1GD3 A;  3ZG5 A;  1BU4 A;  1IK3 A;  5DRE A;  2XSO B;  3AMO A;  2HMJ B;  1DYU A;  3PXM A;  1EA2 A;  4HAA A;  4LMI A;  3MPH A;  3AGN A;  4J9A A;  1AQZ A;  1YGW A;  3H51 A;  1A90 A;  5D83 A;  2BMO B;  4N6N B;  3GZB A;  4GHO A;  1G0T A;  1YGE A;  1I70 A;  4H61 A;  1MWR A;  1N9J A;  3I0Y A;  4XDW A;  3X3Y A;  2XH9 A;  2SBL A;  4LSO A;  1UGI A;  3X42 A;  1TFK A;  1QJG A;  1BNF A;  1T2H A;  1A2P A;  1JKG B;  1BVI A;  2RSX A;  2ML6 A;  1RGE A;  3VSY A;  2W2C A;  4IT7 A;  3IPT A;  5STD A;  4R9L A;  3S28 A;  1VQP 3;  3WA3 A;  1LOV A;  3A76 A;  3QK9 A;  3WR2 A;  4EV2 A;  2QEX 3;  4RBN A;  3D3L A;  4FMC A;  2JQ5 A;  4FCZ A;  1I2G A;  2HMM B;  1RLS A;  1X1W A;  3Q90 A;  1OGX A;  4U13 A;  4CPK A;  4KFE A;  2E2V A;  2F99 A;  3GZR A;  3G8Z A;  3OX9 A;  3OWS A;  1DMM A;  4I5Q A;  5AEW B;  2W56 B;  2RCD A;  2HML B;  4ZM8 A;  1N5P A;  1CYU A;  4RNT A;  3U97 A;  1GSP A;  3CCJ 3;  5D82 A;  1V74 A;  4N6L A;  4EXR A;  8RNT A;  1RSN A;  3DUK A;  3OXA A;  4J8T A;  4N6M A;  1NNV A;  4I4K A;  4J5K A;  3KSE D;  3F7X A;  4K90 B;  2Y73 A;  3WOE B;  1FUW A;  2WGQ A;  3N8B A;  1BUJ A;  2Z76 A;  3HK4 A;  2P0X A;  3DY5 A;  1TP6 A;  1BIR A;  3NBR A;  1WTH A;  3K0Z A;  2L4V A;  3KCH A;  1VQ4 3;  3L0R A;  3BNB A;  2YFL B;  1MGW A;  1JV2 B;  1U5O A;  3LYG A;  3NM7 A;  2JDI H;  5ELJ A;  3CXC 2;  3OWU A;  3NQY A;  3T0U A;  1D6Z A;  2Z77 A;  3CME 3;  1C7H A;  2BNG A;  4EW5 A;  1JZO A;  1RDS A;  1RN4 A;  2IY2 A;  5IF6 A;  1N8Q A;  1DMN A;  3CC7 3;  1X1X A;  2GBX B;  2WOF A;  3KE7 A;  4XBX A;  1W2B 2;  1UUV B;  3JUQ A;  4HM0 B;  2FGT A;  1GOU A;  1I2F A;  4WP5 A;  2F5M A;  3VF1 A;  1UCJ A;  2UGI A;  3OW2 2;  1BRI A;  4HM8 B;  1VQK 3;  1BRK A;  1QAF A;  3AMO B;  4BTX A;  2Y74 A;  2W0Q A;  1BRN L;  2UX0 A;  2OOV C;  3EHC A;  1E3V A;  1YNV X;  4GB5 A;  3LTD A;  1I3F A;  3JUM A;  2CH9 A;  2BU4 A;  1FGR A;  1GY6 A;  2RFR A;  1ULJ B;  1E97 A;  1ZO2 A;  3EQQ B;  3EF8 A;  1IQY A;  2FXT A;  1CQS A;  4MMX B;  3CD6 3;  1B2Z A;  1I0X A;  1O7P B;  2GSP A;  1B27 A;  3N9H A;  1OHO A;  1SQW A;  1I8V A;  2B24 B;  5FGO A;  4L8P A;  1RGK A;  4EV5 A;  3Q1C A;  2XGL A;  3RGA A;  4X2O A;  2F5W A;  3EB8 A;  1VQO 3;  3B8L A;  2ZDJ A;  3ROB A;  1YIT 3;  3ECF A;  1HU9 A;  3FG1 A;  1UCK A;  4HM6 B;  1OCV A;  1JBS A;  1GOV A;  3LT9 A;  1GY5 A;  1RHL A;  1Q40 A;  1W2Z A;  2K0M A;  4O8S A;  1Q7Y 4;  1K8A 4;  3F9S A;  4BIR A;  1PYL A;  4ILF A;  1JBT A;  5G2G A;  1B20 A;  3SYU A;  4R80 A;  4OUQ A;  2XEP A;  2H0I A;  4XBT A;  1BSD A;  3V92 A;  4BL3 A;  4FMB A;  2H0G A;  3CMA 3;  1EG9 B;  1R4C A;  3K9M C;  5BU4 A;  3I55 3;  3PCR A;  1B2U A;  4RNY A;  1TRP A;  2BO9 B;  3NX0 A;  5M18 A;  1SAR A;  3LOY A;  1GMQ A;  1Z1S A;  3MG2 A;  3JUO A;  5BIR A;  1O7W B;  2HOH A;  5IW9 A;  1UCI A;  2E2T A;  3TDG A;  2CHC A;  4KVH A;  5JPU A;  3CCQ 3;  1VQ9 3;  1VQ6 3;  1B21 A;  1BAN A;  3EC9 A;  2K54 A;  3DGN A;  1IV9 A;  1DVD A;  1NO3 A;  1A67 A;  1BNI A;  3PCS A; 
#chains in the Genus database with same CATH homology
 1IVW A;  1M90 4;  2XFS A;  1WMO A;  1GD4 A;  2CK3 H;  3MYT A;  4N6V 0;  3MG1 A;  2WGO A;  1J2B A;  1G96 A;  4MMY B;  2BHM A;  3NUV A;  2CW9 A;  3F8X A;  3FKA A;  4NHF A;  3DGL A;  3VGN A;  4JF8 A;  2MF7 A;  3IJE B;  1W6C A;  2P05 A;  1JRQ A;  3SX1 A;  1KD1 4;  1WQL B;  1Y4K A;  3FGY A;  3MKI A;  1JNQ A;  3EBY A;  1QMA A;  1UUW B;  2CKF B;  3JUN A;  4LEH A;  3SVA A;  3FH1 A;  1GYB A;  1JB5 A;  2OCT A;  1HKX A;  3G4S 3;  1JB2 A;  3EN1 B;  4K61 A;  3B7C A;  5AIH A;  1K73 4;  1RJO A;  4WYK A;  2F86 B;  2CFD A;  1JB4 A;  2HMN B;  1OF5 A;  1W02 A;  2W9P A;  4AEQ A;  3UL6 A;  3EX9 A;  2P38 A;  1Q40 B;  3F40 A;  1YI2 3;  4O3V A;  5AIG A;  4LZI A;  8CHO A;  5LC7 A;  3SOY A;  3EN8 A;  3DGM A;  1AR0 A;  5IG5 A;  2GU3 A;  2QIY A;  4HM3 B;  3DXO A;  4OVM A;  1VQN 3;  3PGB A;  1K41 A;  1OGZ A;  2RGQ A;  4FMA A;  3Q2P A;  3FZW A;  3X3X A;  2W04 A;  1CYV A;  3UJM A;  2XF3 A;  5CF2 A;  4HM4 B;  1KSI A;  4HVN A;  2PZV A;  1S72 3;  5AYR B;  3DMC A;  5KP1 A;  4IPB A;  1BUQ A;  1NWW A;  2O3O A;  3B4P A;  4OK0 A;  1PU4 A;  3GRD A;  5FW5 A;  1OPY A;  5AYS C;  1YJN 3;  3BNE A;  2P0M A;  3DZL A;  3X40 A;  3CCM 3;  3LTA A;  1T5Y A;  1NB5 I;  1Q42 A;  3JUP A;  3S29 A;  1US1 A;  5KP3 A;  2P09 A;  4WWU C;  4HKV B;  3BLZ A;  5CXO A;  3FG4 A;  1U8C B;  2XFT A;  5IEO A;  1IT8 A;  2GU1 A;  1W7C A;  1FGT A;  1IU7 A;  4XDV A;  1STD A;  3ALA A;  5AII A;  1GS3 A;  3X3Z A;  2C10 A;  4N6U A;  1KWI A;  1N5H A;  2D1W A;  1IVX A;  1FGO A;  4WHA A;  1A2K A;  1TIJ A;  3STD A;  3NV0 A;  2CG1 A;  3V99 A;  5JPP A;  1LNH A;  4R4K A;  3PZW A;  2CWT A;  3OWY A;  4MJD A;  3NXJ A;  3CNX A;  4WYK B;  4CCV A;  1A2V A;  1W4N A;  1OUN A;  2M7O A;  4EYC A;  5CLK A;  2B1X B;  4L7K A;  1IDP A;  3CC2 3;  1WNH A;  3S27 A;  3NM2 A;  3EE1 A;  1QAK A;  2D42 A;  5CK6 A;  5IG3 A;  4LGQ A;  3BNC A;  3G16 A;  5CF1 A;  2QA4 3;  5LC6 A;  1FGM A;  3WOF B;  4TX4 A;  2CFW A;  3QRD A;  1NDO B;  1QAL A;  4IIA A;  3HX8 A;  4O2H A;  2A15 A;  2KXG A;  7STD A;  1LXE A;  1NB3 I;  2LQV A;  2OOV A;  3SLU A;  1VQL 3;  3FG3 A;  2CFK A;  1TU5 A;  1PFP A;  4HYZ A;  1ROA A;  2BMR B;  1W00 A;  2CC3 A;  5HGR A;  3UL5 A;  1RRH A;  1VQ8 3;  3MHE A;  3LZA A;  2XSH B;  3RGR A;  4K1U A;  2CWV A;  1DMQ A;  1LOX A;  2OTL 3;  4STD A;  4FCM A;  1L5G B;  1IT7 A;  3FF0 A;  4HM7 B;  3CCR 3;  1SJW A;  3EBT A;  5EVH A;  1MOL A;  2STD A;  1VQ7 3;  1KC8 4;  4CDL A;  4KFD A;  1JN5 A;  1LVN A;  1ZX2 A;  2FNQ A;  1OH0 A;  2GEY A;  4ORL A;  3H3H A;  2OWP A;  4KFF A;  4O02 B;  3CCE 3;  1W5Z A;  4QWT A;  3DM8 A;  3WOD G;  3E99 A;  3LXU X;  3CPO A;  4X2H A;  3HII A;  3IMA B;  2QGU A;  4L8O A;  3CU3 A;  4FMD A;  3GZY B;  1JJ2 2;  4XB5 A;  1GY7 A;  4HM2 B;  2CWU A;  2ZL8 A;  2IUK A;  3HZP A;  4EC6 A;  1K9M 4;  2IA7 A;  1AV4 A;  2ML5 A;  4HJL B;  3LH4 A;  2O9U X;  1STF I;  3SXX A;  4XBY A;  2GBW B;  2WO0 A;  5D81 A;  1RRL A;  5IER A;  1IQ8 A;  1VZZ A;  3NV0 B;  3SOA A;  2I9W A;  1Q81 4;  2W9Q A;  3EJV A;  1E3R A;  1FGQ A;  3CPW 2;  3S67 A;  1O7G B;  2HMO B;  1KQS 2;  5AEU B;  1ROV A;  4K1V A;  1TFO A;  1OHS A;  4WFO A;  3M8C A;  5EQL A;  1Q82 4;  3HIG A;  4BTY A;  2C11 A;  3BB9 A;  5IG0 A;  1N8R 4;  3NHX A;  2W03 A;  4G1M B;  4RZM A;  1EKM A;  3RDE A;  1YIJ 3;  1OHP A;  1ASK A;  1ULI B;  1CEW I;  3F14 A;  2BMQ B;  3KKG A;  3N54 B;  2CG0 A;  5IEP A;  1W6G A;  4RNZ A;  2GXF A;  1O7M B;  3I56 3;  1W01 A;  3FF2 A;  3K7C A;  1M1X B;  4GL6 A;  3MWZ A;  3D9R A;  2OQE C;  1FA3 A;  3FSD A;  2PNC A;  4FCJ A;  1VQ5 3;  4JRF A;  1SPU A;  2XGN A;  2Z6B A;  4EBG A;  3K63 A;  3K5T A;  1YVB I;  5KP4 A;  1EQK A;  4HZB B;  3U1W A;  3MG3 A;  4HZ9 B;  3LTC A;  3OV4 A;  1MNL A;  4R9K A;  1JN5 B;  5EEO A;  4N3V A;  4NRE A;  1OAC A;  4PEJ A;  1Q86 4;  2OTJ 3;  5IG4 A;  2W6J H;  3UB1 A;  3KII A;  1M9G A;  1UI8 A;  3B4O A;  4N6T A;  3V98 A;  3UNL A;  2KRT A;  1IVU A;  1QVG 2;  5IEN A;  3PS8 A;  5TGN A;  3NQZ A;  2XRX B;  2V1L A;  2E2U A;  1IVV A;  4N6O B;  2BT3 A;  2WOH A;  3CCV 3;  4XM4 A;  3KZT A;  3FCS B;  2OQE A;  3F8H A;  1VQM 3;  2CFG A;  3T8N A;  3KN4 A;  1OF5 B;  3WMD A;  1D6Y A;  1RN7 A;  1M1K 4;  5DRV A;  4R1K A;  3ER7 A;  1ISK A;  5BXQ A;  2F98 A;  2Q07 A;  1WMP A;  5ELU A;  1AVK A;  1YJW 3;  1WMN A;  3GWR A;  3LTB A;  2GEX A;  3HI7 A;  1JKG A;  2YFJ B;  3G6E 3;  4KZ1 A;  2XR8 B;  2R4I A;  1YHQ 3;  1SIH A;  1AVL A;  4HBR A;  1K28 A;  3LT8 A;  3T8U A;  2CFL A;  2CIU A;  1O7H B;  3GAX A;  2Z7A A;  3G0K A;  4H3U A;  3GZX B;  2IUJ A;  2IMJ A;  1IV7 A;  2LYX A;  2YFI B;  4HM1 B;  4Q53 A;  1UW1 A;  4HM5 B;  5A0O B;  3PYJ A;  1SII A;  4FR9 A;  2HMK B;  4MEI A;  3CCL 3;  3SED A;  2KCD A;  2W56 A;  5AI1 A;  1D6U A;  2YX9 A;  3FLJ A;  1QVF 2;  3CNM A;  5BVB A;  4MMZ B;  3NBJ A;  3BND A;  3JVC A;  3KFQ C;  5AIF A;  4AKY A;  3MSO A;  3F7S A;  1NJI 4;  3KSP A;  5JBS A;  3DGO A;  3CCU 3;  1S5A A;  3CC4 3;  2MC8 A;  2INX A;  1YJ9 3;  5I97 A;  4AKZ A;  3WA2 X;  1IQX A;  1TUH A;  3WDG B;  3LML A;  6STD A;  3G71 3;  1O7N B;  1W6Y A;  3NBB A;  3J7Y d;  1NU3 A;  1DVC A;  1F8N A;  1UI7 A;  3X41 A;  3S5C A;  3O8Y A;  1N9E A;  1GD3 A;  1IK3 A;  5DRE A;  2XSO B;  3AMO A;  2HMJ B;  1DYU A;  3PXM A;  1EA2 A;  4LMI A;  4BTW A;  3MPH A;  4J9A A;  3H51 A;  1A90 A;  5D83 A;  2BMO B;  4N6N B;  3GZB A;  1YGE A;  4H61 A;  1N9J A;  3I0Y A;  4XDW A;  3X3Y A;  2XH9 A;  2SBL A;  4LSO A;  3X42 A;  1TFK A;  1QJG A;  2RSX A;  1RKY A;  1JKG B;  2ML6 A;  3VSY A;  2W2C A;  4IT7 A;  3IPT A;  5STD A;  4R9L A;  3S28 A;  1VQP 3;  3WA3 A;  3A76 A;  3QK9 A;  4EV2 A;  2QEX 3;  4RBN A;  3D3L A;  4FMC A;  2JQ5 A;  4FCZ A;  2HMM B;  3Q90 A;  4U13 A;  1OGX A;  4KFE A;  2E2V A;  2F99 A;  3GZR A;  3G8Z A;  3OX9 A;  3OWS A;  1DMM A;  5AEW B;  2W56 B;  2RCD A;  2HML B;  4ZM8 A;  1N5P A;  1CYU A;  3U97 A;  3CCJ 3;  5D82 A;  1V74 A;  4N6L A;  4EXR A;  3DUK A;  3OXA A;  4J8T A;  4N6M A;  4I4K A;  3KSE D;  3F7X A;  4K90 B;  2Y73 A;  3WOE B;  1FUW A;  2WGQ A;  3N8B A;  2Z76 A;  3HK4 A;  2P0X A;  3DY5 A;  1TP6 A;  3NBR A;  1WTH A;  3K0Z A;  2L4V A;  1VQ4 3;  3L0R A;  3BNB A;  2YFL B;  1U5O A;  1JV2 B;  3LYG A;  3NM7 A;  2JDI H;  5ELJ A;  3CXC 2;  3OWU A;  3NQY A;  3T0U A;  1D6Z A;  2Z77 A;  3CME 3;  1C7H A;  2BNG A;  5IF6 A;  1N8Q A;  1DMN A;  3CC7 3;  2WOF A;  2GBX B;  3KE7 A;  1W2B 2;  4XBX A;  1UUV B;  3JUQ A;  4HM0 B;  2FGT A;  4WP5 A;  3VF1 A;  3OW2 2;  4HM8 B;  1VQK 3;  1QAF A;  3AMO B;  4BTX A;  2Y74 A;  2W0Q A;  2UX0 A;  2OOV C;  3EHC A;  1E3V A;  4GB5 A;  3LTD A;  3JUM A;  2CH9 A;  1FGR A;  1GY6 A;  2RFR A;  1ULJ B;  1E97 A;  1ZO2 A;  3EQQ B;  3EF8 A;  1IQY A;  2FXT A;  1CQS A;  4MMX B;  3CD6 3;  1O7P B;  3N9H A;  1OHO A;  1SQW A;  2B24 B;  5FGO A;  4L8P A;  4EV5 A;  3Q1C A;  2XGL A;  3RGA A;  4X2O A;  3EB8 A;  1VQO 3;  3B8L A;  2ZDJ A;  3ROB A;  1YIT 3;  3ECF A;  1HU9 A;  3FG1 A;  4HM6 B;  1OCV A;  3LT9 A;  1GY5 A;  1Q40 A;  1W2Z A;  2K0M A;  4O8S A;  1Q7Y 4;  1K8A 4;  3F9S A;  5G2G A;  4R80 A;  4OUQ A;  2XEP A;  4XBT A;  3V92 A;  4FMB A;  3CMA 3;  1EG9 B;  1R4C A;  3K9M C;  3I55 3;  3PCR A;  4RNY A;  2BO9 B;  3NX0 A;  3LOY A;  1Z1S A;  3MG2 A;  3JUO A;  1O7W B;  5IW9 A;  1VQ6 3;  2E2T A;  3TDG A;  2CHC A;  4KVH A;  5JPU A;  3CCQ 3;  1VQ9 3;  3EC9 A;  2K54 A;  3DGN A;  1IV9 A;  1DVD A;  1NO3 A;  1A67 A;  3CCS 3;  3PCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...