1W02A

Crystal structure of mutant enzyme y16f/d103l of ketosteroid isomerase from pseudomonas putida biotype b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
126
structure length
119
Chain Sequence
NLPTAQEVQGLMARFIELVDVGDIEAIVQMYADDATVEDPFGQPPIHGREQIAAFYRQGLKVRACLTGPVRASHNGCGAMPFRVEMVPCALDVILVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STEROID DELTA-ISOMERASE
publication title Structural Double-Mutant Cycle Analysis of a Hydrogen Bond Network in Ketosteroid Isomerase from Pseudomonas Putida Biotype B.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 33
structure length 119
sequence length 126
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2004-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1w02A00
5IG0A 4K1UA 3NUVA 3LZAA 2I9WA 5IG5A 4L8OA 4XBXA 5EVHA 3OXAA 1VZZA 2INXA 5KP3A 3JUOA 2W2CA 3VGNA 3S5CA 5IG4A 1BUQA 3B8LA 1NU3A 5CLKA 3EF8A 4FCMA 1Q40B 3NV0A 3NBRA 1DMNA 3DM8A 1O7MB 3SOAA 3KZTA 4X2HA 2HMJB 3E99A 2IMJA 1UUVB 3MHEA 4WYKA 2Z7AA 4H3UA 3B4OA 3HZPA 2B24B 4ORLA 3GZRA 1OGXA 2STDA 3LYGA 3K0ZA 1DMQA 1O7NB 3SEDA 1GYBA 1S5AA 4XDWA 2RFRA 1NDOB 5CK6A 5AIGA 1K41A 1WQLB 3MG2A 4HM1B 5IEPA 4HM5B 3CU3A 4KVHA 2Z77A 2HMMB 5FW5A 1JN5B 2RCDA 3ER7A 2RGQA 1GY6A 5TGNA 3VSYA 1W6YA 4R9KA 5DREA 2QIYA 4HZ9B 3EN8A 4XBTA 2XSHB 4L7KA 3SOYA 2UX0A 2QGUA 2BMRB 1OCVA 4XBYA 4RZMA 1JKGB 5JPUA 3RGAA 3ECFA 2YFLB 3KSPA 1OGZA 3EQQB 1TP6A 4K1VA 5D83A 2Z76A 3G16A 3NXJA 5CXOA 2XRXB 1W00A 2B1XB 3OWUA 4HM8B 5CF2A 1ISKA 4Q53A 4LEHA 3UNLA 1JB5A 3K7CA 1W01A 3FLJA 5AIFA 2GBWB 3DMCA 3T8UA 2GXFA 2R4IA 4XM4A 1Z1SA 4HJLB 1OUNA 5BXQA 4L8PA 1O7WB 3EJVA 5IG3A 1SJWA 2XSOB 3DZLA 1ASKA 5KP4A 4STDA 1O7GB 2XR8B 1EA2A 3CNMA 3F8HA 1GY5A 1OPYA 3BLZA 3FKAA 3FZWA 3JUQA 2JQ5A 5AIIA 3HK4A 3CNXA 3EBYA 3H51A 2YFJB 3KE7A 2CHCA 2BMQB 4FCJA 5IEOA 5JPPA 1Q42A 2HMKB 3EHCA 4HM3B 3MSOA 1OF5B 4CDLA 3FF2A 4WP5A 5D81A 1E97A 1IDPA 3GWRA 3RGRA 3NHXA 1JB4A 2CKFB 3GRDA 3FSDA 3EBTA 3BB9A 2F99A 3CPOA 3KKGA 1C7HA 3HX8A 1STDA 5IENA 4R9LA 1HKXA 3B7CA 1A2KA 1Q40A 2HMOB 5KP1A 1EG9B 5D82A 3UJMA 2BNGA 3F9SA 4GB5A 2F98A 3NV0B 4I4KA 1ZO2A 3FGYA 2GEXA 4HM2B 4PEJA 2GBXB 3ROBA 8CHOA 4U13A 3Q90A 1DMMA 3F7SA 5AI1A 7STDA 2F86B 3OV4A 4WYKB 3F40A 4HM0B 4J9AA 5HGRA 4OVMA 1TUHA 4WWUC 3A76A 3FF0A 1JN5A 2BMOB 4LGQA 3GZYB 3JUNA 4R1KA 1O7PB 4IIAA 3IPTA 3EC9A 3T8NA 3OWYA 1JKGA 4X2OA 3M8CA 3G0KA 3EX9A 4HM6B 1O7HB 3G8ZA 1AR0A 5CF1A 1GY7A 3FH1A 1QJGA 5AIHA 2OWPA 1OH0A 1QMAA 1W02A 6STDA 5AEWB 1GS3A 1OHSA 1OHPA 2GEYA 1U5OA 3F8XA 2HMLB 4HKVB 1UUWB 5IERA 4LMIA 3F7XA 3EN1B 4MJDA 1ZX2A 4N3VA 1NWWA 5AEUB 3NM2A 3JUPA 3D9RA 3STDA 3MKIA 5G2GA 3JUMA 1E3RA 2PZVA 3WMDA 4HM7B 3GZBA 2YFIB 5BVBA 3MG1A 2K54A 3I0YA 2HMNB 5DRVA 4HM4B 3OWSA 1ULJB 3DUKA 3OX9A 3MYTA 3B4PA 3GZXB 1E3VA 4J8TA 4OUQA 3MG3A 1JB2A 5IF6A 4XDVA 1OHOA 3DXOA 1OF5A 1CQSA 4HVNA 3F14A 2A15A 4HZBB 1ULIB 4XB5A 3H3HA 5STDA
chains in the Genus database with same CATH superfamily
1RRLA 2GU3A 5JBSA 1LRAA 5IG0A 1EKMA 1VQQA 2FXTA 4K1UA 1YVBI 1V57A 3NUVA 3LZAA 3N54B 2I9WA 1N9JA 1G02A 2R41A 1M1XB 4L8OA 4RNTA 5IG5A 3J7Yd 5BU4A 4RNZA 1CH0A 1PFPA 2KRTA 2Q07A 2Y73A 3DY5A 3GAXA 4XBXA 5EVHA 3OXAA 1VZZA 2CFLA 1RHLA 2INXA 4N6OB 5KP3A 3JUOA 2W2CA 3X3ZA 1RGFA 2OCTA 3VGNA 2CG1A 2CFDA 3S5CA 4OK0A 4ZM8A 5IG4A 3V98A 1R4YA 1BUQA 3PGBA 3B8LA 3CXC2 4AKZA 3X40A 3DGMA 4O2HA 2WGQA 3PZWA 1YIT3 1NU3A 1SIIA 5CLKA 3EF8A 4FCMA 3WOFB 1JV2B 2P0XA 5G1KA 1Q40B 2M7OA 3NBRA 3NV0A 3CCJ3 3HI7A 3BNBA 2H0IA 1BUJA 1DMNA 7GSPA 3DM8A 1G0TA 3LTDA 9RNTA 1O7MB 3X3XA 5M1AA 2OTJ3 2CIUA 1UCKA 3SOAA 1X1WA 1QAKA 3KZTA 1IVWA 4KFDA 1WNHA 3KSED 1BIRA 1RGHA 4X2HA 3CC23 1KD14 2HMJB 3NBJA 3E99A 1Q824 4CPKA 3D5GA 2IMJA 2KF4A 1T2HA 1UUVB 3MHEA 4WYKA 2Z7AA 4EW5A 1B2ZA 4H3UA 3B4OA 3HZPA 2B24B 4ORLA 1BNJA 1FGTA 3GZRA 1OGXA 2STDA 1VQ93 3LYGA 2Y74A 3K0ZA 1BU4A 1DMQA 2W6JH 1SQWA 1I2EA 3AMOB 1O7NB 3SEDA 1D6UA 1QVG2 1GYBA 1K734 4HOHA 4R4KA 2SBLA 4JF8A 1S5AA 3DGLA 1YI23 4XDWA 1YJW3 2RFRA 1I0XA 1NDOB 5CK6A 1U8CB 5AIGA 1K41A 1WQLB 3MG2A 4IT7A 3RNTA 3UB1A 4HM1B 2XF3A 5IEPA 1I0VA 4HM5B 1IVVA 2XGLA 3CU3A 3LT8A 3U1WA 3LTBA 5M19A 3KCHA 4KVHA 2KF6A 2Z77A 4MEIA 2KCDA 1NB3I 1I3FA 2HMMB 3UL6A 3WODG 5FW5A 1B27A 1IQXA 1IT7A 1JN5B 1HYFA 1TTOA 2RCDA 2W56B 3ER7A 2CH9A 1HU9A 3CCR3 2RGQA 1GY6A 3G4S3 5TGNA 3VSYA 1JZDA 1UGIA 1W6YA 1QAFA 4R9KA 1GSPA 5DREA 1BANA 2QIYA 1Q7HA 1G96A 4HZ9B 3EN8A 4R80A 4XBTA 2XSHB 3DH2A 3CCQ3 2BT3A 3GSPA 4L7KA 1CEWI 3SOYA 3I563 2UX0A 1LVNA 2WOHA 2QGUA 1EEJA 2BMRB 2SARA 5G1LA 4BL2A 1YJN3 4LYLB 1OCVA 3WR2A 3UL5A 1FA3A 4XBYA 2KF3A 3AGOA 1RJOA 1A2PA 2MC8A 4RZMA 1BNFA 4H61A 1IU7A 1JKGB 4EV2A 1LNHA 2XFTA 5JPUA 1MWSA 3RGAA 2ZDJA 3ECFA 2YFLB 1BSEA 2CWTA 3KSPA 1ZGXA 3WOEB 1IVUA 1OGZA 3EQQB 1TP6A 3T0UA 3BNEA 1RMSA 4K1VA 5D83A 7RNTA 3I553 2Z76A 4FMDA 1VQN3 2IYJA 3LOYA 2C4BA 1VQ63 1GMRA 2CC3A 1W6GA 2CFKA 3G16A 2E2VA 1BAOA 2W9QA 1N9EA 3Q2PA 4WHAA 3NXJA 2H0GA 5CXOA 2XRXB 1W00A 5M18A 2CW9A 1RKYA 1LNIA 3MPHA 2OTL3 1BRGA 2B1XB 3JVCA 2J8XB 2WGOA 1AVLA 1UGHI 3OWUA 4HM8B 2XGNA 1MWRA 3D5IA 5CF2A 1K8A4 4J5GA 5LC7A 1J2BA 3LT9A 1BVIA 1FYSA 1ISKA 4Q53A 2IUJA 1YJ93 4LEHA 3UNLA 4K61A 3SLUA 1JB5A 4CJNA 3NBBA 1BNIA 2RSXA 1I3IA 1RGAA 1W01A 3FLJA 3K7CA 5AIFA 3NQZA 1BRJA 2GBWB 3DMCA 3TDGA 3T8UA 2GXFA 1IQYA 2R4IA 2WOFA 4XM4A 1Z1SA 4HJLB 1OUNA 2CFGA 1GOYA 1N8QA 5BXQA 1Q9EA 4HBRA 2UGIA 2BO9B 3OW22 1FGQA 1SIHA 1LOVA 1ZS7A 5LC6A 4O3VA 4L8PA 3WA2X 3CCV3 4G1MB 1A67A 1KWIA 1O7WB 3ALAA 3EJVA 4CCVA 4EC6A 1B2SA 1MGWA 1RGEA 3ZG5A 5IG3A 4WFOA 1SJWA 2F5WA 2F5MA 2XSOB 3DZLA 3SX1A 1JBRA 1ASKA 5KP4A 1K28A 6RNTA 4STDA 1O7GB 1YGEA 2XR8B 1EA2A 3CNMA 1TJDA 1BNRA 1RTUA 3F8HA 3ZFZA 1CYVA 1BSDA 1GY5A 1JJ22 1UI8A 3QK9A 1OPYA 3N8BA 4GL6A 3AHWA 3BLZA 1US1A 3K63A 1RRHA 1TU5A 3LXUX 3FKAA 3FZWA 2KXGA 3JUQA 2JQ5A 5AIIA 3HK4A 1ROVA 5I97A 1ROAA 2AAEA 3CNXA 1DETA 4KT3B 1PYLA 3EBYA 3EE1A 3H51A 1NB5I 1AQZA 2GSPA 1LQGC 2P38A 2YFJB 3KE7A 2CHCA 3FG4A 2BMQB 4BTYA 4EV5A 4FCJA 5IEOA 5JPPA 1BSAA 1Q42A 2HMKB 3ZG0A 1RDSA 2CX1A 3DGOA 5RNTA 3EHCA 2XEPA 4HM3B 2E2TA 1UCLA 2CX0A 3MSOA 3S27A 1Q7Y4 1QALA 1RCKA 1RN4A 4FCZA 3WA3A 4FMBA 1OF5B 4N6TA 4CDLA 2XH9A 3FF2A 4WP5A 3PCRA 4O8SA 1CYUA 4FMAA 5D81A 1E97A 1IDPA 3GWRA 1MGRA 1EUIC 1NNVA 3NHXA 3RGRA 1JB4A 2CKFB 1RN7A 1UCIA 3GRDA 1NO3A 2L4VA 3EBTA 3FSDA 1A90A 3BB9A 2D1WA 1I70A 2D42A 3FG3A 1JRQA 1WMOA 3K9MC 3S29A 2F99A 3QRDA 1TIJA 3CPOA 1LOYA 3CC43 3A5EA 1AVKA 1M9GA 3D3LA 3KKGA 4N6LA 1UCJA 2C10A 3HIGA 1C7HA 2KF5A 3HX8A 1DVCA 1STDA 5HOHA 1MWUA 2OQEA 4R9LA 4AKYA 5IENA 2KAAA 1JZOA 1HKXA 1N5PA 3B7CA 1A2KA 2OOVC 1SARA 3KFQC 1MNLA 1Q40A 1DYUA 2MF7A 2HMOB 1WMNA 4I5QA 4KFEA 4BTWA 5KP1A 1GD3A 1EG9B 3KN4A 3O8YA 1KSIA 5D82A 3CCE3 1VQM3 1I8VA 3SVAA 3UJMA 1YVSA 1IVXA 1EQKA 1FUWA 1RNTA 2BNGA 2H0HA 3HOHA 3F9SA 4DKIA 3L0RA 1F8NA 1GOUA 1W2ZA 1RGKA 1RGCA 3LMLA 4GB5A 1M904 2CG0A 2F98A 1FGRA 2W0QA 3LTAA 2F4YA 3CD63 3NV0B 1KC84 4ILFA 4K90B 1L5GB 3AGNA 1ZO2A 3PXMA 4I4KA 1SPUA 3FGYA 2IA7A 2K3DA 1BOXA 2GEXA 4N6NB 4HM2B 4PEJA 1LQMB 1T3BA 2CFWA 2GBXB 4AEQA 3ROBA 3AMOA 4U13A 8CHOA 3Q90A 1DMMA 2ZA4A 4EBGA 3F7SA 3U97A 3NX0A 5AI1A 1W4NA 2JDIH 7STDA 3MWZA 2F86B 3OV4A 4MMXB 4WYKB 1PY3A 3FG1A 4MMYB 3LTCA 3CMA3 3F40A 4HYZA 2P05A 1X1YA 4NHFA 3NM7A 2W9PA 2BU4A 4HM0B 4J9AA 5HGRA 4RBNA 4OVMA 1TUHA 2PNCA 1BNEA 3FCSB 4WWUC 2QA43 3A76A 2CWVA 1BRSA 1JN5A 1OACA 2W56A 1RGLA 3FF0A 1LOXA 3S28A 2BMOB 1RSNA 4LGQA 3GZYB 3JUNA 1C54A 1VQK3 1MOLA 4R1KA 1O7PB 2LYXA 1UW1A 5BIRA 1KQS2 1B2UA 4IIAA 2IY2A 1RLSA 4MMZB 1IT8A 2ZHXB 1QVF2 3DGYA 3IPTA 1FZUA 1N5HA 1STFI 3V92A 1RNBA 3DGNA 3EC9A 4RNYA 1PU4A 1TFKA 4NPBA 3T8NA 3OWYA 2CWUA 1R4CA 1JKGA 4NREA 4HAAA 4LSOA 3Q1CA 4X2OA 3M8CA 3G0KA 3EX9A 4TX4A 1DVDA 2CK3H 2Z6BA 4HM6B 4FMCA 3CPW2 1O7HB 1GMQA 3G8ZA 1AR0A 3IJEB 1BRHA 5CF1A 1VQ53 3BU4A 1GY7A 3FH1A 1QJGA 5AIHA 1FW7A 2UUGC 5FGOA 2OWPA 3BIRA 1OH0A 3D79A 1B2MA 1JBSA 5ELJA 1JBTA 1B3SA 1QMAA 3KIIA 1W02A 4IPBA 6STDA 3CC73 1K9M4 2W04A 1BRIA 2ZL8A 3AHSA 3SYUA 1YIJ3 1B2XA 1RCLA 5AEWB 1GS3A 1FGMA 1GOVA 1BNGA 1BNSA 2FGTA 1OHSA 3Q3FA 2AADA 2BHMA 1FUTA 1S723 1OHPA 4LZIA 1VQ43 4BU4A 1YHQ3 1TFOA 3NQYA 2GEYA 5EEOA 1U5OA 4QWTA 3F8XA 1VQ73 2O3OA 2HMLB 3CCL3 2YX9A 3BNCA 4HKVB 1UUWB 5IERA 1Y4KA 1W6CA 4LMIA 1GMPA 3EB8A 3EN1B 3F7XA 4MJDA 5IW9A 1BSBA 2FNQA 1LXEA 1YGWA 1T5YA 2F56A 4BIRA 3RDEA 1ZX2A 3LH4A 1NWWA 4N3VA 3URPA 1B20A 5AEUB 4N6MA 3NM2A 1W5ZA 3HIIA 1IV9A 3JUPA 1A2VA 3D9RA 5AYRB 1TRPA 5GSPA 3STDA 2OQEC 1FGOA 1B21A 3MKIA 5G2GA 3K5TA 1I2FA 1D6ZA 1T2IA 3JUMA 1IK3A 1YNVX 1LOWA 3PYJA 1V58A 2RBIA 1E3RA 2HOHA 2PZVA 3X41A 3WMDA 1MWTA 4KFFA 4HM7B 2O9UX 8RNTA 3GZBA 1IV7A 1JNQA 5ELUA 4BTXA 1UDII 2P09A 2YFIB 4JRFA 1BRKA 5BVBA 3MG1A 2K54A 3VF1A 3I0YA 1UUGB 1VQO3 3G6E3 2HMNB 1RGGA 3PS8A 4HM4B 5DRVA 3CCM3 3CME3 1HZ1A 2LQVA 1VQP3 1Q864 1IQ8A 3BNDA 3OWSA 1ULJB 3S67A 5A0OB 2E2UA 2P0MA 1VQ83 1VQL3 1FUSA 1TRQA 3DUKA 3G713 2V1LA 4O02B 2L1SA 3OX9A 2ML5A 1Q814 3MYTA 2ML6A 5EQLA 3IMAB 1NJI4 2IUKA 3WDGB 3B4PA 3GZXB 4N6UA 1E3VA 4J8TA 4OUQA 2QEX3 3MG3A 4KZ1A 1JB2A 2RNTA 1V74A 2OOVA 1DE3A 5IF6A 4XDVA 1IYYA 4J5KA 1BRNL 3SXXA 4N6V0 1W2B2 4GSPA 1AY7A 1OHOA 2W03A 2C11A 3DXOA 3PCSA 1UI7A 3WHOA 3D4AA 3CCS3 1OF5A 2GU1A 1M1K4 1N8R4 3X42A 4BL3A 3CCU3 1D6YA 1GD4A 3V99A 1CQSA 1WMPA 1X1UA 4HVNA 3F14A 4FR9A 2BIRA 1WTHA 2A15A 4EYCA 4HZBB 3X3YA 1I2GA 1ULIB 4XB5A 3H3HA 5AYSC 1X1XA 2K0MA 2WO0A 1BSCA 5STDA 1BGSA 4EXRA 3N9HA 1RN1A 4GHOA 1W7CA 6GSPA 1AV4A 2XFSA
chains in the Genus database with same CATH topology
1RRLA 2GU3A 5JBSA 5IG0A 1EKMA 4K1UA 2FXTA 1YVBI 3NUVA 3LZAA 3N54B 2I9WA 1N9JA 5IG5A 4L8OA 1M1XB 3J7Yd 4RNZA 1PFPA 2KRTA 2Q07A 2Y73A 3DY5A 3GAXA 4XBXA 5EVHA 3OXAA 1VZZA 2CFLA 2INXA 4N6OB 5KP3A 3X3ZA 3JUOA 2W2CA 2OCTA 3VGNA 2CG1A 2CFDA 3S5CA 4OK0A 4ZM8A 5IG4A 3V98A 1BUQA 3PGBA 3B8LA 3CXC2 4AKZA 3X40A 3DGMA 4O2HA 2WGQA 3PZWA 1YIT3 1NU3A 1SIIA 5CLKA 3EF8A 4FCMA 3WOFB 1JV2B 2P0XA 1Q40B 2M7OA 3NBRA 3NV0A 3CCJ3 3HI7A 3BNBA 1DMNA 3DM8A 3LTDA 1O7MB 3X3XA 2OTJ3 2CIUA 3SOAA 3KZTA 1QAKA 1IVWA 4KFDA 1WNHA 3KSED 3CC23 4X2HA 1KD14 2HMJB 3NBJA 3E99A 1Q824 2IMJA 1UUVB 3MHEA 4WYKA 2Z7AA 4H3UA 3B4OA 3HZPA 2B24B 4ORLA 1FGTA 3GZRA 1OGXA 2STDA 1VQ93 3LYGA 2Y74A 3K0ZA 1DMQA 2W6JH 1SQWA 3AMOB 1O7NB 3SEDA 1D6UA 1QVG2 1GYBA 1K734 4R4KA 2SBLA 4JF8A 1S5AA 3DGLA 1YI23 4XDWA 1YJW3 2RFRA 1NDOB 5CK6A 1U8CB 5AIGA 1K41A 1WQLB 3MG2A 4IT7A 3UB1A 4HM1B 2XF3A 5IEPA 4HM5B 1IVVA 2XGLA 3CU3A 3LT8A 3U1WA 3LTBA 4KVHA 2Z77A 4MEIA 2KCDA 1NB3I 2HMMB 3UL6A 3WODG 5FW5A 1IQXA 1IT7A 1JN5B 2W56B 2RCDA 3ER7A 3CCR3 2CH9A 1HU9A 2RGQA 1GY6A 3G4S3 5TGNA 3VSYA 1W6YA 1QAFA 4R9KA 5DREA 2QIYA 4HZ9B 1G96A 4R80A 3EN8A 4XBTA 2XSHB 3CCQ3 2BT3A 4L7KA 3I563 1CEWI 3SOYA 2UX0A 1LVNA 2WOHA 2QGUA 2BMRB 1YJN3 1FA3A 1OCVA 3UL5A 4XBYA 1RJOA 2MC8A 4RZMA 4H61A 1IU7A 1JKGB 4EV2A 1LNHA 2XFTA 5JPUA 3RGAA 2ZDJA 3ECFA 2YFLB 2CWTA 3KSPA 3WOEB 1IVUA 1OGZA 3EQQB 1TP6A 3T0UA 3BNEA 1VQN3 4K1VA 5D83A 3I553 2Z76A 4FMDA 3LOYA 1VQ63 2CC3A 2CFKA 1W6GA 3G16A 2E2VA 2W9QA 1N9EA 3Q2PA 4WHAA 3NXJA 5CXOA 2XRXB 1W00A 2OTL3 2CW9A 1RKYA 3MPHA 2B1XB 3JVCA 2WGOA 1AVLA 3OWUA 4HM8B 2XGNA 1K8A4 5CF2A 5LC7A 1J2BA 3LT9A 1ISKA 4Q53A 2IUJA 1YJ93 4LEHA 3UNLA 4K61A 3SLUA 1JB5A 3NBBA 2RSXA 3K7CA 1W01A 3FLJA 5AIFA 3NQZA 2GBWB 3DMCA 3TDGA 3T8UA 2WOFA 1IQYA 2GXFA 2R4IA 4XM4A 1Z1SA 4HJLB 1OUNA 2CFGA 1N8QA 5BXQA 4HBRA 2BO9B 3OW22 1FGQA 1SIHA 5LC6A 4O3VA 4L8PA 3WA2X 3CCV3 4G1MB 1A67A 1KWIA 1O7WB 3ALAA 3EJVA 4CCVA 4EC6A 5IG3A 4WFOA 1SJWA 2XSOB 3DZLA 3SX1A 1ASKA 5KP4A 1K28A 4STDA 1O7GB 1YGEA 2XR8B 1EA2A 3CNMA 3F8HA 1JJ22 1CYVA 1GY5A 1UI8A 3QK9A 1OPYA 3N8BA 4GL6A 3BLZA 3K63A 1US1A 1RRHA 1TU5A 3LXUX 3FKAA 3FZWA 2KXGA 3JUQA 2JQ5A 5AIIA 3HK4A 1ROVA 5I97A 1ROAA 3CNXA 3EBYA 3EE1A 3H51A 1NB5I 2P38A 2YFJB 3KE7A 2CHCA 3FG4A 2BMQB 4BTYA 4EV5A 4FCJA 5IEOA 5JPPA 1Q42A 2HMKB 3DGOA 3EHCA 2XEPA 4HM3B 2E2TA 3MSOA 3S27A 1Q7Y4 1QALA 4FCZA 3WA3A 4FMBA 1OF5B 4N6TA 4CDLA 2XH9A 3FF2A 4WP5A 3PCRA 4O8SA 1CYUA 4FMAA 5D81A 1E97A 1IDPA 3GWRA 3NHXA 3RGRA 1JB4A 2CKFB 1RN7A 3GRDA 1NO3A 2L4VA 3EBTA 3FSDA 1A90A 3BB9A 2D1WA 2D42A 3FG3A 1JRQA 1WMOA 3K9MC 3S29A 2F99A 3QRDA 1TIJA 3CPOA 3CC43 1AVKA 1M9GA 3D3LA 3KKGA 4N6LA 2C10A 3HIGA 1C7HA 3HX8A 1DVCA 1STDA 2OQEA 4R9LA 4AKYA 5IENA 1HKXA 1N5PA 3B7CA 1A2KA 2OOVC 3KFQC 1MNLA 1Q40A 1DYUA 2MF7A 2HMOB 1WMNA 4KFEA 4BTWA 5KP1A 1GD3A 1EG9B 3KN4A 3O8YA 1KSIA 5D82A 3CCE3 1VQM3 3SVAA 3UJMA 1IVXA 1EQKA 1FUWA 2BNGA 3F9SA 3L0RA 1F8NA 1W2ZA 4GB5A 3LMLA 1M904 2CG0A 2F98A 1FGRA 2W0QA 3LTAA 3CD63 3NV0B 1KC84 4K90B 1L5GB 3PXMA 1ZO2A 4I4KA 1SPUA 3FGYA 2IA7A 4N6NB 2GEXA 4HM2B 4PEJA 2CFWA 4AEQA 2GBXB 3ROBA 3AMOA 4U13A 8CHOA 3Q90A 1DMMA 4EBGA 3F7SA 3U97A 3NX0A 5AI1A 1W4NA 2JDIH 7STDA 3MWZA 2F86B 3OV4A 4MMXB 4WYKB 3FG1A 4MMYB 3LTCA 3CMA3 3F40A 4HYZA 2P05A 4NHFA 3NM7A 2W9PA 4HM0B 4J9AA 5HGRA 4RBNA 4OVMA 1TUHA 2PNCA 3FCSB 4WWUC 2QA43 3A76A 2CWVA 3FF0A 1JN5A 1OACA 2W56A 1LOXA 3S28A 2BMOB 4LGQA 3GZYB 3JUNA 1VQK3 1MOLA 4R1KA 1O7PB 2LYXA 1UW1A 1KQS2 4IIAA 4MMZB 1IT8A 1QVF2 3IPTA 1N5HA 1STFI 3V92A 3DGNA 3EC9A 4RNYA 1PU4A 1TFKA 3T8NA 3OWYA 2CWUA 1R4CA 1JKGA 4NREA 4LSOA 3Q1CA 4X2OA 3M8CA 3G0KA 3EX9A 4TX4A 1DVDA 2CK3H 2Z6BA 4HM6B 4FMCA 3CPW2 1O7HB 3G8ZA 3IJEB 1AR0A 1VQ53 5CF1A 1GY7A 3FH1A 1QJGA 5AIHA 5FGOA 2OWPA 1OH0A 5ELJA 1QMAA 3KIIA 1W02A 4IPBA 6STDA 3CC73 1K9M4 2W04A 2ZL8A 1YIJ3 5AEWB 1GS3A 1FGMA 2FGTA 1OHSA 2BHMA 1S723 1OHPA 4LZIA 1VQ43 1YHQ3 1TFOA 3NQYA 2GEYA 5EEOA 1U5OA 4QWTA 3F8XA 1VQ73 2O3OA 2HMLB 3CCL3 2YX9A 3BNCA 4HKVB 1UUWB 5IERA 1Y4KA 1W6CA 4LMIA 3F7XA 3EB8A 3EN1B 4MJDA 5IW9A 2FNQA 1LXEA 1T5YA 3RDEA 1ZX2A 3LH4A 1NWWA 4N3VA 5AEUB 4N6MA 3NM2A 1W5ZA 3HIIA 1IV9A 3JUPA 1A2VA 3D9RA 5AYRB 3STDA 2OQEC 1FGOA 3MKIA 5G2GA 3K5TA 1D6ZA 3JUMA 1IK3A 3PYJA 1E3RA 2PZVA 3X41A 3WMDA 4KFFA 4HM7B 2O9UX 3GZBA 1IV7A 1JNQA 5ELUA 4BTXA 2P09A 2YFIB 4JRFA 5BVBA 3MG1A 2K54A 3VF1A 3I0YA 1VQO3 3G6E3 2HMNB 3PS8A 4HM4B 5DRVA 3CCM3 3CME3 1VQP3 2LQVA 1Q864 1IQ8A 3BNDA 3OWSA 1ULJB 3S67A 5A0OB 2E2UA 2P0MA 1VQ83 1VQL3 3DUKA 3G713 2V1LA 4O02B 3OX9A 2ML5A 1Q814 3MYTA 2ML6A 5EQLA 3IMAB 1NJI4 2IUKA 3WDGB 3B4PA 3GZXB 4N6UA 1E3VA 4J8TA 4OUQA 2QEX3 3MG3A 4KZ1A 1JB2A 1V74A 2OOVA 5IF6A 4XDVA 3SXXA 4N6V0 1W2B2 1OHOA 2W03A 2C11A 3DXOA 3PCSA 1UI7A 3CCS3 1OF5A 2GU1A 1M1K4 1N8R4 3X42A 3CCU3 1D6YA 1GD4A 3V99A 1CQSA 1WMPA 4HVNA 3F14A 4FR9A 1WTHA 2A15A 4EYCA 4HZBB 3X3YA 1ULIB 4XB5A 3H3HA 5AYSC 4EXRA 2K0MA 2WO0A 5STDA 3N9HA 1W7CA 1AV4A 2XFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IG0 A;  4K1U A;  3NUV A;  3LZA A;  2I9W A;  5IG5 A;  4L8O A;  4XBX A;  5EVH A;  3OXA A;  1VZZ A;  2INX A;  5KP3 A;  3JUO A;  2W2C A;  3VGN A;  3S5C A;  5IG4 A;  1BUQ A;  3B8L A;  1NU3 A;  5CLK A;  3EF8 A;  4FCM A;  1Q40 B;  3NV0 A;  3NBR A;  1DMN A;  3DM8 A;  1O7M B;  3SOA A;  3KZT A;  4X2H A;  2HMJ B;  3E99 A;  2IMJ A;  1UUV B;  3MHE A;  4WYK A;  2Z7A A;  4H3U A;  3B4O A;  3HZP A;  2B24 B;  4ORL A;  3GZR A;  1OGX A;  2STD A;  3LYG A;  3K0Z A;  1DMQ A;  1O7N B;  3SED A;  1GYB A;  1S5A A;  4XDW A;  2RFR A;  1NDO B;  5CK6 A;  5AIG A;  1K41 A;  1WQL B;  3MG2 A;  4HM1 B;  5IEP A;  4HM5 B;  3CU3 A;  4KVH A;  2Z77 A;  2HMM B;  5FW5 A;  1JN5 B;  2RCD A;  3ER7 A;  2RGQ A;  1GY6 A;  5TGN A;  3VSY A;  1W6Y A;  4R9K A;  5DRE A;  2QIY A;  4HZ9 B;  3EN8 A;  4XBT A;  2XSH B;  4L7K A;  3SOY A;  2UX0 A;  2QGU A;  2BMR B;  1OCV A;  4XBY A;  4RZM A;  1JKG B;  5JPU A;  3RGA A;  3ECF A;  2YFL B;  3KSP A;  1OGZ A;  3EQQ B;  1TP6 A;  4K1V A;  5D83 A;  2Z76 A;  3G16 A;  3NXJ A;  5CXO A;  2XRX B;  1W00 A;  2B1X B;  3OWU A;  4HM8 B;  5CF2 A;  1ISK A;  4Q53 A;  4LEH A;  3UNL A;  1JB5 A;  3K7C A;  1W01 A;  3FLJ A;  5AIF A;  2GBW B;  3DMC A;  3T8U A;  2GXF A;  2R4I A;  4XM4 A;  1Z1S A;  4HJL B;  1OUN A;  5BXQ A;  4L8P A;  1O7W B;  3EJV A;  5IG3 A;  1SJW A;  2XSO B;  3DZL A;  1ASK A;  5KP4 A;  4STD A;  1O7G B;  2XR8 B;  1EA2 A;  3CNM A;  3F8H A;  1GY5 A;  1OPY A;  3BLZ A;  3FKA A;  3FZW A;  3JUQ A;  2JQ5 A;  5AII A;  3HK4 A;  3CNX A;  3EBY A;  3H51 A;  2YFJ B;  3KE7 A;  2CHC A;  2BMQ B;  4FCJ A;  5IEO A;  5JPP A;  1Q42 A;  2HMK B;  3EHC A;  4HM3 B;  3MSO A;  1OF5 B;  4CDL A;  3FF2 A;  4WP5 A;  5D81 A;  1E97 A;  1IDP A;  3GWR A;  3RGR A;  3NHX A;  1JB4 A;  2CKF B;  3GRD A;  3FSD A;  3EBT A;  3BB9 A;  2F99 A;  3CPO A;  3KKG A;  1C7H A;  3HX8 A;  1STD A;  5IEN A;  4R9L A;  1HKX A;  3B7C A;  1A2K A;  1Q40 A;  2HMO B;  5KP1 A;  1EG9 B;  5D82 A;  3UJM A;  2BNG A;  3F9S A;  4GB5 A;  2F98 A;  3NV0 B;  4I4K A;  1ZO2 A;  3FGY A;  2GEX A;  4HM2 B;  4PEJ A;  2GBX B;  3ROB A;  8CHO A;  4U13 A;  3Q90 A;  1DMM A;  3F7S A;  5AI1 A;  7STD A;  2F86 B;  3OV4 A;  4WYK B;  3F40 A;  4HM0 B;  4J9A A;  5HGR A;  4OVM A;  1TUH A;  4WWU C;  3A76 A;  3FF0 A;  1JN5 A;  2BMO B;  4LGQ A;  3GZY B;  3JUN A;  4R1K A;  1O7P B;  4IIA A;  3IPT A;  3EC9 A;  3T8N A;  3OWY A;  1JKG A;  4X2O A;  3M8C A;  3G0K A;  3EX9 A;  4HM6 B;  1O7H B;  3G8Z A;  1AR0 A;  5CF1 A;  1GY7 A;  3FH1 A;  1QJG A;  5AIH A;  2OWP A;  1OH0 A;  1QMA A;  1W02 A;  6STD A;  5AEW B;  1GS3 A;  1OHS A;  1OHP A;  2GEY A;  1U5O A;  3F8X A;  2HML B;  4HKV B;  1UUW B;  5IER A;  4LMI A;  3F7X A;  3EN1 B;  4MJD A;  1ZX2 A;  4N3V A;  1NWW A;  5AEU B;  3NM2 A;  3JUP A;  3D9R A;  3STD A;  3MKI A;  5G2G A;  3JUM A;  1E3R A;  2PZV A;  3WMD A;  4HM7 B;  3GZB A;  2YFI B;  5BVB A;  3MG1 A;  2K54 A;  3I0Y A;  2HMN B;  5DRV A;  4HM4 B;  3OWS A;  1ULJ B;  3DUK A;  3OX9 A;  3MYT A;  3B4P A;  3GZX B;  1E3V A;  4J8T A;  4OUQ A;  3MG3 A;  1JB2 A;  5IF6 A;  4XDV A;  1OHO A;  3DXO A;  1OF5 A;  1CQS A;  4HVN A;  3F14 A;  2A15 A;  4HZB B;  1ULI B;  4XB5 A;  3H3H A;  5STD A; 
#chains in the Genus database with same CATH topology
 1RRL A;  2GU3 A;  5JBS A;  1LRA A;  5IG0 A;  1EKM A;  1VQQ A;  2FXT A;  4K1U A;  1YVB I;  1V57 A;  3NUV A;  3LZA A;  3N54 B;  2I9W A;  1N9J A;  1G02 A;  2R41 A;  1M1X B;  4L8O A;  4RNT A;  5IG5 A;  3J7Y d;  5BU4 A;  4RNZ A;  1CH0 A;  1PFP A;  2KRT A;  2Q07 A;  2Y73 A;  3DY5 A;  3GAX A;  4XBX A;  5EVH A;  3OXA A;  1VZZ A;  2CFL A;  1RHL A;  2INX A;  4N6O B;  5KP3 A;  3JUO A;  2W2C A;  3X3Z A;  1RGF A;  2OCT A;  3VGN A;  2CG1 A;  2CFD A;  3S5C A;  4OK0 A;  4ZM8 A;  5IG4 A;  3V98 A;  1R4Y A;  1BUQ A;  3PGB A;  3B8L A;  3CXC 2;  4AKZ A;  3X40 A;  3DGM A;  4O2H A;  2WGQ A;  3PZW A;  1YIT 3;  1NU3 A;  1SII A;  5CLK A;  3EF8 A;  4FCM A;  3WOF B;  1JV2 B;  2P0X A;  5G1K A;  1Q40 B;  2M7O A;  3NBR A;  3NV0 A;  3CCJ 3;  3HI7 A;  3BNB A;  2H0I A;  1BUJ A;  1DMN A;  7GSP A;  3DM8 A;  1G0T A;  3LTD A;  9RNT A;  1O7M B;  3X3X A;  5M1A A;  2OTJ 3;  2CIU A;  1UCK A;  3SOA A;  1X1W A;  1QAK A;  3KZT A;  1IVW A;  4KFD A;  1WNH A;  3KSE D;  1BIR A;  1RGH A;  4X2H A;  3CC2 3;  1KD1 4;  2HMJ B;  3NBJ A;  3E99 A;  1Q82 4;  4CPK A;  3D5G A;  2IMJ A;  2KF4 A;  1T2H A;  1UUV B;  3MHE A;  4WYK A;  2Z7A A;  4EW5 A;  1B2Z A;  4H3U A;  3B4O A;  3HZP A;  2B24 B;  4ORL A;  1BNJ A;  1FGT A;  3GZR A;  1OGX A;  2STD A;  1VQ9 3;  3LYG A;  2Y74 A;  3K0Z A;  1BU4 A;  1DMQ A;  2W6J H;  1SQW A;  1I2E A;  3AMO B;  1O7N B;  3SED A;  1D6U A;  1QVG 2;  1GYB A;  1K73 4;  4HOH A;  4R4K A;  2SBL A;  4JF8 A;  1S5A A;  3DGL A;  1YI2 3;  4XDW A;  1YJW 3;  2RFR A;  1I0X A;  1NDO B;  5CK6 A;  1U8C B;  5AIG A;  1K41 A;  1WQL B;  3MG2 A;  4IT7 A;  3RNT A;  3UB1 A;  4HM1 B;  2XF3 A;  5IEP A;  1I0V A;  4HM5 B;  1IVV A;  2XGL A;  3CU3 A;  3LT8 A;  3U1W A;  3LTB A;  5M19 A;  3KCH A;  4KVH A;  2KF6 A;  2Z77 A;  4MEI A;  2KCD A;  1NB3 I;  1I3F A;  2HMM B;  3UL6 A;  3WOD G;  5FW5 A;  1B27 A;  1IQX A;  1IT7 A;  1JN5 B;  1HYF A;  1TTO A;  2RCD A;  2W56 B;  3ER7 A;  2CH9 A;  1HU9 A;  3CCR 3;  2RGQ A;  1GY6 A;  3G4S 3;  5TGN A;  3VSY A;  1JZD A;  1UGI A;  1W6Y A;  1QAF A;  4R9K A;  1GSP A;  5DRE A;  1BAN A;  2QIY A;  1Q7H A;  1G96 A;  4HZ9 B;  3EN8 A;  4R80 A;  4XBT A;  2XSH B;  3DH2 A;  3CCQ 3;  2BT3 A;  3GSP A;  4L7K A;  1CEW I;  3SOY A;  3I56 3;  2UX0 A;  1LVN A;  2WOH A;  2QGU A;  1EEJ A;  2BMR B;  2SAR A;  5G1L A;  4BL2 A;  1YJN 3;  4LYL B;  1OCV A;  3WR2 A;  3UL5 A;  1FA3 A;  4XBY A;  2KF3 A;  3AGO A;  1RJO A;  1A2P A;  2MC8 A;  4RZM A;  1BNF A;  4H61 A;  1IU7 A;  1JKG B;  4EV2 A;  1LNH A;  2XFT A;  5JPU A;  1MWS A;  3RGA A;  2ZDJ A;  3ECF A;  2YFL B;  1BSE A;  2CWT A;  3KSP A;  1ZGX A;  3WOE B;  1IVU A;  1OGZ A;  3EQQ B;  1TP6 A;  3T0U A;  3BNE A;  1RMS A;  4K1V A;  5D83 A;  7RNT A;  3I55 3;  2Z76 A;  4FMD A;  1VQN 3;  2IYJ A;  3LOY A;  2C4B A;  1VQ6 3;  1GMR A;  2CC3 A;  1W6G A;  2CFK A;  3G16 A;  2E2V A;  1BAO A;  2W9Q A;  1N9E A;  3Q2P A;  4WHA A;  3NXJ A;  2H0G A;  5CXO A;  2XRX B;  1W00 A;  5M18 A;  2CW9 A;  1RKY A;  1LNI A;  3MPH A;  2OTL 3;  1BRG A;  2B1X B;  3JVC A;  2J8X B;  2WGO A;  1AVL A;  1UGH I;  3OWU A;  4HM8 B;  2XGN A;  1MWR A;  3D5I A;  5CF2 A;  1K8A 4;  4J5G A;  5LC7 A;  1J2B A;  3LT9 A;  1BVI A;  1FYS A;  1ISK A;  4Q53 A;  2IUJ A;  1YJ9 3;  4LEH A;  3UNL A;  4K61 A;  3SLU A;  1JB5 A;  4CJN A;  3NBB A;  1BNI A;  2RSX A;  1I3I A;  1RGA A;  1W01 A;  3FLJ A;  3K7C A;  5AIF A;  3NQZ A;  1BRJ A;  2GBW B;  3DMC A;  3TDG A;  3T8U A;  2GXF A;  1IQY A;  2R4I A;  2WOF A;  4XM4 A;  1Z1S A;  4HJL B;  1OUN A;  2CFG A;  1GOY A;  1N8Q A;  5BXQ A;  1Q9E A;  4HBR A;  2UGI A;  2BO9 B;  3OW2 2;  1FGQ A;  1SIH A;  1LOV A;  1ZS7 A;  5LC6 A;  4O3V A;  4L8P A;  3WA2 X;  3CCV 3;  4G1M B;  1A67 A;  1KWI A;  1O7W B;  3ALA A;  3EJV A;  4CCV A;  4EC6 A;  1B2S A;  1MGW A;  1RGE A;  3ZG5 A;  5IG3 A;  4WFO A;  1SJW A;  2F5W A;  2F5M A;  2XSO B;  3DZL A;  3SX1 A;  1JBR A;  1ASK A;  5KP4 A;  1K28 A;  6RNT A;  4STD A;  1O7G B;  1YGE A;  2XR8 B;  1EA2 A;  3CNM A;  1TJD A;  1BNR A;  1RTU A;  3F8H A;  3ZFZ A;  1CYV A;  1BSD A;  1GY5 A;  1JJ2 2;  1UI8 A;  3QK9 A;  1OPY A;  3N8B A;  4GL6 A;  3AHW A;  3BLZ A;  1US1 A;  3K63 A;  1RRH A;  1TU5 A;  3LXU X;  3FKA A;  3FZW A;  2KXG A;  3JUQ A;  2JQ5 A;  5AII A;  3HK4 A;  1ROV A;  5I97 A;  1ROA A;  2AAE A;  3CNX A;  1DET A;  4KT3 B;  1PYL A;  3EBY A;  3EE1 A;  3H51 A;  1NB5 I;  1AQZ A;  2GSP A;  1LQG C;  2P38 A;  2YFJ B;  3KE7 A;  2CHC A;  3FG4 A;  2BMQ B;  4BTY A;  4EV5 A;  4FCJ A;  5IEO A;  5JPP A;  1BSA A;  1Q42 A;  2HMK B;  3ZG0 A;  1RDS A;  2CX1 A;  3DGO A;  5RNT A;  3EHC A;  2XEP A;  4HM3 B;  2E2T A;  1UCL A;  2CX0 A;  3MSO A;  3S27 A;  1Q7Y 4;  1QAL A;  1RCK A;  1RN4 A;  4FCZ A;  3WA3 A;  4FMB A;  1OF5 B;  4N6T A;  4CDL A;  2XH9 A;  3FF2 A;  4WP5 A;  3PCR A;  4O8S A;  1CYU A;  4FMA A;  5D81 A;  1E97 A;  1IDP A;  3GWR A;  1MGR A;  1EUI C;  1NNV A;  3NHX A;  3RGR A;  1JB4 A;  2CKF B;  1RN7 A;  1UCI A;  3GRD A;  1NO3 A;  2L4V A;  3EBT A;  3FSD A;  1A90 A;  3BB9 A;  2D1W A;  1I70 A;  2D42 A;  3FG3 A;  1JRQ A;  1WMO A;  3K9M C;  3S29 A;  2F99 A;  3QRD A;  1TIJ A;  3CPO A;  1LOY A;  3CC4 3;  3A5E A;  1AVK A;  1M9G A;  3D3L A;  3KKG A;  4N6L A;  1UCJ A;  2C10 A;  3HIG A;  1C7H A;  2KF5 A;  3HX8 A;  1DVC A;  1STD A;  5HOH A;  1MWU A;  2OQE A;  4R9L A;  4AKY A;  5IEN A;  2KAA A;  1JZO A;  1HKX A;  1N5P A;  3B7C A;  1A2K A;  2OOV C;  1SAR A;  3KFQ C;  1MNL A;  1Q40 A;  1DYU A;  2MF7 A;  2HMO B;  1WMN A;  4I5Q A;  4KFE A;  4BTW A;  5KP1 A;  1GD3 A;  1EG9 B;  3KN4 A;  3O8Y A;  1KSI A;  5D82 A;  3CCE 3;  1VQM 3;  1I8V A;  3SVA A;  3UJM A;  1YVS A;  1IVX A;  1EQK A;  1FUW A;  1RNT A;  2BNG A;  2H0H A;  3HOH A;  3F9S A;  4DKI A;  3L0R A;  1F8N A;  1GOU A;  1W2Z A;  1RGK A;  1RGC A;  3LML A;  4GB5 A;  1M90 4;  2CG0 A;  2F98 A;  1FGR A;  2W0Q A;  3LTA A;  2F4Y A;  3CD6 3;  3NV0 B;  1KC8 4;  4ILF A;  4K90 B;  1L5G B;  3AGN A;  1ZO2 A;  3PXM A;  4I4K A;  1SPU A;  3FGY A;  2IA7 A;  2K3D A;  1BOX A;  2GEX A;  4N6N B;  4HM2 B;  4PEJ A;  1LQM B;  1T3B A;  2CFW A;  2GBX B;  4AEQ A;  3ROB A;  3AMO A;  4U13 A;  8CHO A;  3Q90 A;  1DMM A;  2ZA4 A;  4EBG A;  3F7S A;  3U97 A;  3NX0 A;  5AI1 A;  1W4N A;  2JDI H;  7STD A;  3MWZ A;  2F86 B;  3OV4 A;  4MMX B;  4WYK B;  1PY3 A;  3FG1 A;  4MMY B;  3LTC A;  3CMA 3;  3F40 A;  4HYZ A;  2P05 A;  1X1Y A;  4NHF A;  3NM7 A;  2W9P A;  2BU4 A;  4HM0 B;  4J9A A;  5HGR A;  4RBN A;  4OVM A;  1TUH A;  2PNC A;  1BNE A;  3FCS B;  4WWU C;  2QA4 3;  3A76 A;  2CWV A;  1BRS A;  1JN5 A;  1OAC A;  2W56 A;  1RGL A;  3FF0 A;  1LOX A;  3S28 A;  2BMO B;  1RSN A;  4LGQ A;  3GZY B;  3JUN A;  1C54 A;  1VQK 3;  1MOL A;  4R1K A;  1O7P B;  2LYX A;  1UW1 A;  5BIR A;  1KQS 2;  1B2U A;  4IIA A;  2IY2 A;  1RLS A;  4MMZ B;  1IT8 A;  2ZHX B;  1QVF 2;  3DGY A;  3IPT A;  1FZU A;  1N5H A;  1STF I;  3V92 A;  1RNB A;  3DGN A;  3EC9 A;  4RNY A;  1PU4 A;  1TFK A;  4NPB A;  3T8N A;  3OWY A;  2CWU A;  1R4C A;  1JKG A;  4NRE A;  4HAA A;  4LSO A;  3Q1C A;  4X2O A;  3M8C A;  3G0K A;  3EX9 A;  4TX4 A;  1DVD A;  2CK3 H;  2Z6B A;  4HM6 B;  4FMC A;  3CPW 2;  1O7H B;  1GMQ A;  3G8Z A;  1AR0 A;  3IJE B;  1BRH A;  5CF1 A;  1VQ5 3;  3BU4 A;  1GY7 A;  3FH1 A;  1QJG A;  5AIH A;  1FW7 A;  2UUG C;  5FGO A;  2OWP A;  3BIR A;  1OH0 A;  3D79 A;  1B2M A;  1JBS A;  5ELJ A;  1JBT A;  1B3S A;  1QMA A;  3KII A;  1W02 A;  4IPB A;  6STD A;  3CC7 3;  1K9M 4;  2W04 A;  1BRI A;  2ZL8 A;  3AHS A;  3SYU A;  1YIJ 3;  1B2X A;  1RCL A;  5AEW B;  1GS3 A;  1FGM A;  1GOV A;  1BNG A;  1BNS A;  2FGT A;  1OHS A;  3Q3F A;  2AAD A;  2BHM A;  1FUT A;  1S72 3;  1OHP A;  4LZI A;  1VQ4 3;  4BU4 A;  1YHQ 3;  1TFO A;  3NQY A;  2GEY A;  5EEO A;  1U5O A;  4QWT A;  3F8X A;  1VQ7 3;  2O3O A;  2HML B;  3CCL 3;  2YX9 A;  3BNC A;  4HKV B;  1UUW B;  5IER A;  1Y4K A;  1W6C A;  4LMI A;  1GMP A;  3EB8 A;  3EN1 B;  3F7X A;  4MJD A;  5IW9 A;  1BSB A;  2FNQ A;  1LXE A;  1YGW A;  1T5Y A;  2F56 A;  4BIR A;  3RDE A;  1ZX2 A;  3LH4 A;  1NWW A;  4N3V A;  3URP A;  1B20 A;  5AEU B;  4N6M A;  3NM2 A;  1W5Z A;  3HII A;  1IV9 A;  3JUP A;  1A2V A;  3D9R A;  5AYR B;  1TRP A;  5GSP A;  3STD A;  2OQE C;  1FGO A;  1B21 A;  3MKI A;  5G2G A;  3K5T A;  1I2F A;  1D6Z A;  1T2I A;  3JUM A;  1IK3 A;  1YNV X;  1LOW A;  3PYJ A;  1V58 A;  2RBI A;  1E3R A;  2HOH A;  2PZV A;  3X41 A;  3WMD A;  1MWT A;  4KFF A;  4HM7 B;  2O9U X;  8RNT A;  3GZB A;  1IV7 A;  1JNQ A;  5ELU A;  4BTX A;  1UDI I;  2P09 A;  2YFI B;  4JRF A;  1BRK A;  5BVB A;  3MG1 A;  2K54 A;  3VF1 A;  3I0Y A;  1UUG B;  1VQO 3;  3G6E 3;  2HMN B;  1RGG A;  3PS8 A;  4HM4 B;  5DRV A;  3CCM 3;  3CME 3;  1HZ1 A;  2LQV A;  1VQP 3;  1Q86 4;  1IQ8 A;  3BND A;  3OWS A;  1ULJ B;  3S67 A;  5A0O B;  2E2U A;  2P0M A;  1VQ8 3;  1VQL 3;  1FUS A;  1TRQ A;  3DUK A;  3G71 3;  2V1L A;  4O02 B;  2L1S A;  3OX9 A;  2ML5 A;  1Q81 4;  3MYT A;  2ML6 A;  5EQL A;  3IMA B;  1NJI 4;  2IUK A;  3WDG B;  3B4P A;  3GZX B;  4N6U A;  1E3V A;  4J8T A;  4OUQ A;  2QEX 3;  3MG3 A;  4KZ1 A;  1JB2 A;  2RNT A;  1V74 A;  2OOV A;  1DE3 A;  5IF6 A;  4XDV A;  1IYY A;  4J5K A;  1BRN L;  3SXX A;  4N6V 0;  1W2B 2;  4GSP A;  1AY7 A;  1OHO A;  2W03 A;  2C11 A;  3DXO A;  3PCS A;  1UI7 A;  3WHO A;  3D4A A;  3CCS 3;  1OF5 A;  2GU1 A;  1M1K 4;  1N8R 4;  3X42 A;  4BL3 A;  3CCU 3;  1D6Y A;  1GD4 A;  3V99 A;  1CQS A;  1WMP A;  1X1U A;  4HVN A;  3F14 A;  4FR9 A;  2BIR A;  1WTH A;  2A15 A;  4EYC A;  4HZB B;  3X3Y A;  1I2G A;  1ULI B;  4XB5 A;  3H3H A;  5AYS C;  1X1X A;  2K0M A;  2WO0 A;  1BSC A;  5STD A;  1BGS A;  4EXR A;  3N9H A;  1RN1 A;  4GHO A;  1W7C A;  6GSP A;  1AV4 A;  2XFS A; 
#chains in the Genus database with same CATH homology
 1RRL A;  2GU3 A;  5JBS A;  5IG0 A;  1EKM A;  4K1U A;  2FXT A;  1YVB I;  3NUV A;  3LZA A;  3N54 B;  2I9W A;  1N9J A;  5IG5 A;  4L8O A;  1M1X B;  3J7Y d;  4RNZ A;  1PFP A;  2KRT A;  2Q07 A;  2Y73 A;  3DY5 A;  3GAX A;  4XBX A;  5EVH A;  3OXA A;  1VZZ A;  2CFL A;  2INX A;  4N6O B;  5KP3 A;  3X3Z A;  3JUO A;  2W2C A;  2OCT A;  3VGN A;  2CG1 A;  2CFD A;  3S5C A;  4OK0 A;  4ZM8 A;  5IG4 A;  3V98 A;  1BUQ A;  3PGB A;  3B8L A;  3CXC 2;  4AKZ A;  3X40 A;  3DGM A;  4O2H A;  2WGQ A;  3PZW A;  1YIT 3;  1NU3 A;  1SII A;  5CLK A;  3EF8 A;  4FCM A;  3WOF B;  1JV2 B;  2P0X A;  1Q40 B;  2M7O A;  3NBR A;  3NV0 A;  3CCJ 3;  3HI7 A;  3BNB A;  1DMN A;  3DM8 A;  3LTD A;  1O7M B;  3X3X A;  2OTJ 3;  2CIU A;  3SOA A;  3KZT A;  1QAK A;  1IVW A;  4KFD A;  1WNH A;  3KSE D;  3CC2 3;  4X2H A;  1KD1 4;  2HMJ B;  3NBJ A;  3E99 A;  1Q82 4;  2IMJ A;  1UUV B;  3MHE A;  4WYK A;  2Z7A A;  4H3U A;  3B4O A;  3HZP A;  2B24 B;  4ORL A;  1FGT A;  3GZR A;  1OGX A;  2STD A;  1VQ9 3;  3LYG A;  2Y74 A;  3K0Z A;  1DMQ A;  2W6J H;  1SQW A;  3AMO B;  1O7N B;  3SED A;  1D6U A;  1QVG 2;  1GYB A;  1K73 4;  4R4K A;  2SBL A;  4JF8 A;  1S5A A;  3DGL A;  1YI2 3;  4XDW A;  1YJW 3;  2RFR A;  1NDO B;  5CK6 A;  1U8C B;  5AIG A;  1K41 A;  1WQL B;  3MG2 A;  4IT7 A;  3UB1 A;  4HM1 B;  2XF3 A;  5IEP A;  4HM5 B;  1IVV A;  2XGL A;  3CU3 A;  3LT8 A;  3U1W A;  3LTB A;  4KVH A;  2Z77 A;  4MEI A;  2KCD A;  1NB3 I;  2HMM B;  3UL6 A;  3WOD G;  5FW5 A;  1IQX A;  1IT7 A;  1JN5 B;  2W56 B;  2RCD A;  3ER7 A;  3CCR 3;  2CH9 A;  1HU9 A;  2RGQ A;  1GY6 A;  3G4S 3;  5TGN A;  3VSY A;  1W6Y A;  1QAF A;  4R9K A;  5DRE A;  2QIY A;  4HZ9 B;  1G96 A;  4R80 A;  3EN8 A;  4XBT A;  2XSH B;  3CCQ 3;  2BT3 A;  4L7K A;  3I56 3;  1CEW I;  3SOY A;  2UX0 A;  1LVN A;  2WOH A;  2QGU A;  2BMR B;  1YJN 3;  1FA3 A;  1OCV A;  3UL5 A;  4XBY A;  1RJO A;  2MC8 A;  4RZM A;  4H61 A;  1IU7 A;  1JKG B;  4EV2 A;  1LNH A;  2XFT A;  5JPU A;  3RGA A;  2ZDJ A;  3ECF A;  2YFL B;  2CWT A;  3KSP A;  3WOE B;  1IVU A;  1OGZ A;  3EQQ B;  1TP6 A;  3T0U A;  3BNE A;  1VQN 3;  4K1V A;  5D83 A;  3I55 3;  2Z76 A;  4FMD A;  3LOY A;  1VQ6 3;  2CC3 A;  2CFK A;  1W6G A;  3G16 A;  2E2V A;  2W9Q A;  1N9E A;  3Q2P A;  4WHA A;  3NXJ A;  5CXO A;  2XRX B;  1W00 A;  2OTL 3;  2CW9 A;  1RKY A;  3MPH A;  2B1X B;  3JVC A;  2WGO A;  1AVL A;  3OWU A;  4HM8 B;  2XGN A;  1K8A 4;  5CF2 A;  5LC7 A;  1J2B A;  3LT9 A;  1ISK A;  4Q53 A;  2IUJ A;  1YJ9 3;  4LEH A;  3UNL A;  4K61 A;  3SLU A;  1JB5 A;  3NBB A;  2RSX A;  3K7C A;  1W01 A;  3FLJ A;  5AIF A;  3NQZ A;  2GBW B;  3DMC A;  3TDG A;  3T8U A;  2WOF A;  1IQY A;  2GXF A;  2R4I A;  4XM4 A;  1Z1S A;  4HJL B;  1OUN A;  2CFG A;  1N8Q A;  5BXQ A;  4HBR A;  2BO9 B;  3OW2 2;  1FGQ A;  1SIH A;  5LC6 A;  4O3V A;  4L8P A;  3WA2 X;  3CCV 3;  4G1M B;  1A67 A;  1KWI A;  1O7W B;  3ALA A;  3EJV A;  4CCV A;  4EC6 A;  5IG3 A;  4WFO A;  1SJW A;  2XSO B;  3DZL A;  3SX1 A;  1ASK A;  5KP4 A;  1K28 A;  4STD A;  1O7G B;  1YGE A;  2XR8 B;  1EA2 A;  3CNM A;  3F8H A;  1JJ2 2;  1CYV A;  1GY5 A;  1UI8 A;  3QK9 A;  1OPY A;  3N8B A;  4GL6 A;  3BLZ A;  3K63 A;  1US1 A;  1RRH A;  1TU5 A;  3LXU X;  3FKA A;  3FZW A;  2KXG A;  3JUQ A;  2JQ5 A;  5AII A;  3HK4 A;  1ROV A;  5I97 A;  1ROA A;  3CNX A;  3EBY A;  3EE1 A;  3H51 A;  1NB5 I;  2P38 A;  2YFJ B;  3KE7 A;  2CHC A;  3FG4 A;  2BMQ B;  4BTY A;  4EV5 A;  4FCJ A;  5IEO A;  5JPP A;  1Q42 A;  2HMK B;  3DGO A;  3EHC A;  2XEP A;  4HM3 B;  2E2T A;  3MSO A;  3S27 A;  1Q7Y 4;  1QAL A;  4FCZ A;  3WA3 A;  4FMB A;  1OF5 B;  4N6T A;  4CDL A;  2XH9 A;  3FF2 A;  4WP5 A;  3PCR A;  4O8S A;  1CYU A;  4FMA A;  5D81 A;  1E97 A;  1IDP A;  3GWR A;  3NHX A;  3RGR A;  1JB4 A;  2CKF B;  1RN7 A;  3GRD A;  1NO3 A;  2L4V A;  3EBT A;  3FSD A;  1A90 A;  3BB9 A;  2D1W A;  2D42 A;  3FG3 A;  1JRQ A;  1WMO A;  3K9M C;  3S29 A;  2F99 A;  3QRD A;  1TIJ A;  3CPO A;  3CC4 3;  1AVK A;  1M9G A;  3D3L A;  3KKG A;  4N6L A;  2C10 A;  3HIG A;  1C7H A;  3HX8 A;  1DVC A;  1STD A;  2OQE A;  4R9L A;  4AKY A;  5IEN A;  1HKX A;  1N5P A;  3B7C A;  1A2K A;  2OOV C;  3KFQ C;  1MNL A;  1Q40 A;  1DYU A;  2MF7 A;  2HMO B;  1WMN A;  4KFE A;  4BTW A;  5KP1 A;  1GD3 A;  1EG9 B;  3KN4 A;  3O8Y A;  1KSI A;  5D82 A;  3CCE 3;  1VQM 3;  3SVA A;  3UJM A;  1IVX A;  1EQK A;  1FUW A;  2BNG A;  3F9S A;  3L0R A;  1F8N A;  1W2Z A;  4GB5 A;  3LML A;  1M90 4;  2CG0 A;  2F98 A;  1FGR A;  2W0Q A;  3LTA A;  3CD6 3;  3NV0 B;  1KC8 4;  4K90 B;  1L5G B;  3PXM A;  1ZO2 A;  4I4K A;  1SPU A;  3FGY A;  2IA7 A;  4N6N B;  2GEX A;  4HM2 B;  4PEJ A;  2CFW A;  4AEQ A;  2GBX B;  3ROB A;  3AMO A;  4U13 A;  8CHO A;  3Q90 A;  1DMM A;  4EBG A;  3F7S A;  3U97 A;  3NX0 A;  5AI1 A;  1W4N A;  2JDI H;  7STD A;  3MWZ A;  2F86 B;  3OV4 A;  4MMX B;  4WYK B;  3FG1 A;  4MMY B;  3LTC A;  3CMA 3;  3F40 A;  4HYZ A;  2P05 A;  4NHF A;  3NM7 A;  2W9P A;  4HM0 B;  4J9A A;  5HGR A;  4RBN A;  4OVM A;  1TUH A;  2PNC A;  3FCS B;  4WWU C;  2QA4 3;  3A76 A;  2CWV A;  3FF0 A;  1JN5 A;  1OAC A;  2W56 A;  1LOX A;  3S28 A;  2BMO B;  4LGQ A;  3GZY B;  3JUN A;  1VQK 3;  1MOL A;  4R1K A;  1O7P B;  2LYX A;  1UW1 A;  1KQS 2;  4IIA A;  4MMZ B;  1IT8 A;  1QVF 2;  3IPT A;  1N5H A;  1STF I;  3V92 A;  3DGN A;  3EC9 A;  4RNY A;  1PU4 A;  1TFK A;  3T8N A;  3OWY A;  2CWU A;  1R4C A;  1JKG A;  4NRE A;  4LSO A;  3Q1C A;  4X2O A;  3M8C A;  3G0K A;  3EX9 A;  4TX4 A;  1DVD A;  2CK3 H;  2Z6B A;  4HM6 B;  4FMC A;  3CPW 2;  1O7H B;  3G8Z A;  3IJE B;  1AR0 A;  1VQ5 3;  5CF1 A;  1GY7 A;  3FH1 A;  1QJG A;  5AIH A;  5FGO A;  2OWP A;  1OH0 A;  5ELJ A;  1QMA A;  3KII A;  1W02 A;  4IPB A;  6STD A;  3CC7 3;  1K9M 4;  2W04 A;  2ZL8 A;  1YIJ 3;  5AEW B;  1GS3 A;  1FGM A;  2FGT A;  1OHS A;  2BHM A;  1S72 3;  1OHP A;  4LZI A;  1VQ4 3;  1YHQ 3;  1TFO A;  3NQY A;  2GEY A;  5EEO A;  1U5O A;  4QWT A;  3F8X A;  1VQ7 3;  2O3O A;  2HML B;  3CCL 3;  2YX9 A;  3BNC A;  4HKV B;  1UUW B;  5IER A;  1Y4K A;  1W6C A;  4LMI A;  3F7X A;  3EB8 A;  3EN1 B;  4MJD A;  5IW9 A;  2FNQ A;  1LXE A;  1T5Y A;  3RDE A;  1ZX2 A;  3LH4 A;  1NWW A;  4N3V A;  5AEU B;  4N6M A;  3NM2 A;  1W5Z A;  3HII A;  1IV9 A;  3JUP A;  1A2V A;  3D9R A;  5AYR B;  3STD A;  2OQE C;  1FGO A;  3MKI A;  5G2G A;  3K5T A;  1D6Z A;  3JUM A;  1IK3 A;  3PYJ A;  1E3R A;  2PZV A;  3X41 A;  3WMD A;  4KFF A;  4HM7 B;  2O9U X;  3GZB A;  1IV7 A;  1JNQ A;  5ELU A;  4BTX A;  2P09 A;  2YFI B;  4JRF A;  5BVB A;  3MG1 A;  2K54 A;  3VF1 A;  3I0Y A;  1VQO 3;  3G6E 3;  2HMN B;  3PS8 A;  4HM4 B;  5DRV A;  3CCM 3;  3CME 3;  1VQP 3;  2LQV A;  1Q86 4;  1IQ8 A;  3BND A;  3OWS A;  1ULJ B;  3S67 A;  5A0O B;  2E2U A;  2P0M A;  1VQ8 3;  1VQL 3;  3DUK A;  3G71 3;  2V1L A;  4O02 B;  3OX9 A;  2ML5 A;  1Q81 4;  3MYT A;  2ML6 A;  5EQL A;  3IMA B;  1NJI 4;  2IUK A;  3WDG B;  3B4P A;  3GZX B;  4N6U A;  1E3V A;  4J8T A;  4OUQ A;  2QEX 3;  3MG3 A;  4KZ1 A;  1JB2 A;  1V74 A;  2OOV A;  5IF6 A;  4XDV A;  3SXX A;  4N6V 0;  1W2B 2;  1OHO A;  2W03 A;  2C11 A;  3DXO A;  3PCS A;  1UI7 A;  3CCS 3;  1OF5 A;  2GU1 A;  1M1K 4;  1N8R 4;  3X42 A;  3CCU 3;  1D6Y A;  1GD4 A;  3V99 A;  1CQS A;  1WMP A;  4HVN A;  3F14 A;  4FR9 A;  1WTH A;  2A15 A;  4EYC A;  4HZB B;  3X3Y A;  1ULI B;  4XB5 A;  3H3H A;  5AYS C;  4EXR A;  2K0M A;  2WO0 A;  5STD A;  3N9H A;  1W7C A;  1AV4 A;  2XFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...