1W09A

Solution structure of the cis form of the human alpha-hemoglobin stabilizing protein (ahsp)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
92
structure length
92
Chain Sequence
b'LLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-HEMOGLOBIN STABILIZING PROTEIN
publication title NMR structure of the alpha-hemoglobin stabilizing protein: insights into conformational heterogeneity and binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 31
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1w09A00
4IDOA 3Q5EA 3QNUA 1Y01A 3IA3A 3Q5DA 4IDPA 3X1DA 3QOFA 1W0AA 4IDQA 1XZYA 1Z8UA 4IDNA 1W09A 1W0BA 3OVUA
chains in the Genus database with same CATH superfamily
2Y48B 3TLSA 1VCSA 1YKEB 2ZM8A 2WAUA 4JEUB 3KINB 4LFAT 3ZLIA 2WWUA 2X9XA 4AXPA 2KZ7B 4DV4T 1NEKA 4QXBB 4IDOA 1W0BA 3C51A 4OYJA 2EHOD 4COFA 3AA0B 2W00A 1YXRA 3CX7B 2MAWA 4HFBA 3AB3B 4LMKA 3BQLA 2CWYA 1WFDA 4BAYB 2XQ9A 3TLTA 4GYRA 4LF4T 4AQFC 4FI5A 2IHR1 3PUZF 4YTMA 4E7ZA 2ZLYA 2JQ9A 1ZP0A 4ILUA 4LMJA 1HFAA 2ZM0A 4I0UA 1ZEEA 4JV5T 4X64T 1N36T 4TWFA 2CMRA 4XZCA 2E2AA 3ZC1A 4KMCA 2ODVA 2H3RA 3PJAJ 5LHIB 3FXDB 2W0GA 4ZZBA 4IIJE 3ZT7A 3AAAB 3NWIA 5LGTB 1OXZA 4UEMA 2DNXA 4X62T 2LKGA 5HEUA 5ABGA 3CX8B 4IHJE 2X51A 2E8IA 3A7MA 3UU4A 4HEAA 2LKHA 2WDVA 5J2UE 2Q9QB 2XQAA 1OWAA 3RYFE 3N2OA 3ZJ2A 3OYZA 3QB5K 2FBWA 2YU2A 2CHNA 2BBHA 2V26A 3HKDE 3RF1A 5EK2A 2W67A 2V8SV 3CKDA 5LJNA 4CQIA 2VL8A 2V7KA 3ZYKA 2JQQA 3DP7A 3W15B 3F31A 3CIRA 3RYHE 1SA0E 4JI4T 3KVAA 3RQUA 4EEBA 5FXZA 3EDUA 4GOUA 2VKJA 2LSYA 4CN4A 5HEHA 3OPCA 3UUNA 2LT3A 4KI0F 1E2AA 4Z8XA 4O4IE 2UUBT 3ZCJA 4MBQA 5LNKA 1XZYA 4YY3T 2QYWA 4GYSA 1B7TA 4UV9B 1HG2A 2LSKA 3NZPA 4O2AE 2YDRA 3B5MA 2XSAA 4ISTA 2D9DA 3ZN1B 2Y8DA 4OFZA 2YEVC 4GIWA 5ADXL 4IE5A 4ZI3D 3QNUA 4A98A 2LRLA 4BA9A 5DQWA 4EB6E 1HX8A 4K0UA 2DL1A 5FVKA 4P0AA 3UU5A 2DWGA 2YOEA 4QWNB 2DHRA 5C2TA 4C91A 4L0RA 5IUXA 2IC9A 4QXHB 5JDQA 2XAHB 2QGSA 2HH7A 3RYCE 4CI2B 2NW7A 2W66A 3AAIA 4EV6A 2ES0A 4DUYT 2N2NA 4NUUA 4TNVA 2EHOC 3AA6B 3Q2MA 3UT5E 3MACA 5LG3A 5HWXA 4BJMA 2X9HA 3VKGA 4PJLA 3ANWB 5L4EA 4CI1B 3UU6A 2DWKA 3ZMUB 4DR5T 3SFDA 1ZOYA 1FMWA 1E1HB 2BG9A 4CN1A 3NZQA 3RIAA 2X0YA 2IUBA 4M1PA 2UXBT 3X1DA 3EUHA 3AE6A 3JAFA 2XAQB 2QVAA 3BQKA 3E22E 1WYBA 4NXMT 3LBXA 2EHOA 3C4WA 3AEAA 5AQUB 3V5SA 2UXCT 2YN6A 3LG7A 4ZS2A 2I0MA 3ONXA 3HKEE 4IE4A 2J62A 2OLTA 1IZNB 5LGUB 1Y64B 4YSXA 3ETVA 1BR4A 3OTOT 2CWOA 1KNPA 3RHWA 1U4QA 1HTJF 3N9PA 4ZI2C 3AE5A 2BS3A 3FZFB 3KV4A 3J9X1 1MIVA 1Z8UA 2E9XC 2KINB 2NP9A 2A9UA 5AQNB 1UX4A 2L9QA 3UULA 3RIFA 3WI3A 4YHJA 3J7Yq 2ZMAA 3AEBA 4AQGA 4KX6A 1XDOA 1OEDC 2BS2A 3BQIA 3LK3B 1KNZA 2OA5A 3A8YC 3RH3A 1YQ4A 2K3WA 5C3JA 5HYAA 3AVSA 3ZYLA 2VVNA 3PURA 4PFPA 3KBUA 4LF7T 1Y01A 4O2BE 4DNDA 2LSIA 2DLRA 4NUVA 5L3EB 2QA7A 3KDSE 4X1KE 4HFHA 1HR0T 3PUAA 3CQGB 1UGOA 5H6QB 2PJQA 3FBLA 4EOZB 3VKHA 2FJAA 4ASKA 3JAEA 2XSBA 5CFBA 1QLBA 5L3FB 4QX7B 4A5XA 4JI5T 4X65T 4TWHA 3MZKB 3RIUC 4IDQA 1T8BA 1AJ3A 2V6YB 4X5TA 3MJXA 2XHEB 3O4XE 4UVBB 2WMNA 4DV6T 2KNDA 2PFVA 3C98B 3LJCA 5CA1E 1FIOA 3SFEA 4AQYT 5EZYE 5JDGA 1US7B 5KX5E 3CWZB 1D0XA 2V7MA 4DR3T 4ILCA 2WDQA 2LEHA 5JR9C 4ZZCA 3JADA 2VASA 3P8CD 2Q9QD 2VK9A 1UCUA 2BBJA 2VKDA 4DV5T 4EIWA 3C50A 4AISA 4NPPA 4NIQA 3HR0A 3HKBE 4EEDA 5CJ5A 2CE7A 3TKLB 1LRZA 2IDOB 2XAGB 4DV0T 4H9QC 4U74A 2M67A 4X1IE 2NW9A 1VOMA 2LSGA 4UELA 1UURA 5HXEA 2LOSA 2V7JA 3NKZA 2V5DA 2P9BA 5L3BB 5BR8T 5JR9A 2H7OA 4P1NA 2CPTA 1V9DA 3E08A 1ZKEA 5FL0A 3MXZA 2A72A 4L9IA 5BMVE 5HXRA 3P4RA 2Y6XA 3O9XA 3PUVF 5H6RB 4O4JE 3O1HA 1HNWT 5FKYA 2NW8A 4I43B 2V7IA 4YJ2E 5LBMA 2X9YA 3RGLA 3HI2A 4IDNA 1IBMT 2C5IT 5F5WA 2QRXA 3U3IA 5L2LA 4DR7T 4YTPA 4PJMA 3EI0A 3RRCA 1D1CA 4HFEA 2SPCA 4DR4T 4JI3T 2KWHA 3AE2A 3AE8A 2LM9A 1MIYA 2XTLA 2K24A 1S35A 3NRXA 4LF8T 4MLKA 1U5PA 4QH1A 2WS3A 4U33A 2LM2A 1KNRA 3N9LA 5A1LA 4DR6T 4ILAA 4G63A 2A3DA 2IIUA 2JRKA 5L3CB 2LOPA 4IDPA 4EYUA 3N2GE 1XNQT 3L09A 1T98A 2MTQA 1I6ZA 3HL6A 2YK0A 2X66A 4HE8A 5JDMA 1G73A 4TZ4C 3ZMSB 5LA6E 3K3NA 1I94T 1UK5A 1FJGT 2BVMA 4KHPT 3ONJA 2YINA 2CXFA 3HKCE 4LF9T 2K48A 4DUZT 3ESLA 2GK9A 4JBWF 2E5LT 1IJ6A 3WAKA 2DCFA 3H37A 3ZT5A 2NOXA 1W09A 2KXPB 2XQ7A 3OYXA 5L4HA 4E7SA 3G06A 4MALA 5ABFA 1FEWA 1YQ3A 2WDRA 5AQLB 2K5BB 2WMOA 2IW5B 3SS1A 4LFBT 5JDLA 3H3AA 1XDPA 2YU1A 4DR2T 3AEGA 3EABA 2YKSA 4WBNE 4U7YA 4CZZB 4PJJA 3AE7A 1XMOT 4IGUA 2Q9QA 4WZXA 5AFUL 1SE7A 3GA8A 5JRCB 3OBVE 3UFEA 3C4XA 5HEGA 2N1GA 2BZBA 4ZI7E 2BG9B 3PDYA 3NRYA 1QSDA 4QX8B 2BG9C 1BR2A 5AQRB 5F8PA 4ZHQE 1VRBA 3UQ7A 4PK4A 3TLWA 4B3RT 1NWMX 1JNRA 2J1DG 5AQIB 3RC3A 3LBXB 2M6BA 2XAFB 2EHOB 4MHCA 4H9RC 3GWHA 3VRBA 3R6NA 4B3MT 3UUXB 2HN1A 4CXXA 2BKPA 1O3XA 1LVKA 1E7PA 4QKNA 3T1HT 4N78D 5E0OA 2RA1A 4U31A 3M65A 2CRBA 4PJNA 3VRAA 3O1JA 3ZMZB 3P4WA 3AE9A 3AXJB 3SRZA 1KF6A 1HF8A 2WBLA 2X67A 3UFGA 4HN9A 1VCTA 3OKQA 4H9NC 2B1EA 3CQCB 5CB4E 3RYIE 3PUWF 4IE0A 2H89A 4Q25A 2C0SA 4IL9A 3UUBA 5JQGE 3ZPOA 2YDQA 4JYAT 4F8HA 2LHRA 1HNXT 2WU2A 3AAEB 2WWVA 4DBRA 3GN5B 3SWHA 2X0LB 3HA4A 5F3JA 5DJQC 3ZJ1A 1LVFA 3N9OA 3KV5A 3ANWA 2E9XB 3F2EA 4B6XA 4KUMB 2KSRA 3RC8A 3EDVA 4HFVA 4AKGA 2JQKA 5DQVA 3MA9A 2JIWA 2LE8A 4DV1T 2D0UA 4GKKT 1OEDB 2H88A 4DV7T 5HXHA 3PV0F 4OX9T 2XPKA 2WU5A 2VWAA 4GK5E 3ZMVB 4KP3C 3D0TA 5LHHB 4EXTA 2JQHA 4U3CA 3KV6A 5AQFB 3QK6A 2CHOA 2X9WA 2UXXB 5FMNA 3RRWA 2LLYA 4JI7T 5IHYA 1IJ5A 2WZIA 3PUGA 3FZLB 4EGWA 1ZHCA 2VL0A 5JREA 2XJ7A 4TV9E 4ZI3C 1X79A 3PUQA 2CM0A 4LMLA 2HHHT 4CN6A 5FVLA 3I9YA 4BJNA 4DIDB 4TX5A 3JC6D 4GK0E 4QXCB 3L39A 5FY1A 3RI5A 2DI4A 1WYCA 4LF5T 2L8KA 2HN2A 4UR9A 1WRDA 5FY7A 5CA0E 3AA7B 2F4VT 1W0AA 5LCYA 3IHRA 2XZEA 3PE0A 2XASB 4DV2T 4HWIB 4P09A 4HFCA 2J47A 3LDQB 5AQJB 2LSJA 3N2KE 5JR9B 4WBOA 1HCIA 2XM1A 2X68A 4AIUA 3CVRA 1N32T 3ZSSA 1KFYA 4YSYA 2A2FX 5AQGB 2WZHA 2HPJA 4IT4A 2UUCT 4ISSA 2FJDA 1T72A 4UF0B 4CXYA 2ACZA 3UQ4A 4L5GA 5FP3A 2B76A 3FHNA 2NWBA 2C5KT 2V6YA 2E5VA 5CGMA 3EAMA 1D0YA 4TN7B 1HS7A 2WP9A 3AEDA 5LJMA 5KDMC 5AQMB 4A97A 3QUJA 2I6HA 3VHLA 3Q5EA 1T7SA 4CI3B 4HWCA 4TNWA 3OVUA 4DBQA 3SOLA 4TUYE 5LYJE 1CHUA 2JPFA 2NTXA 5ETWA 3I0OA 2JMKA 4HWDA 3N5LA 3QB5A 2IC6A 4YTNA 5HEJA 3ZEFB 4X1YE 3RLFF 4ZOLE 3AA1B 1MIWA 1NAFA 1G8XA 4HFIA 2PBIA 1HNZT 3Q5XA 5FXVA 2VB6A 3AE1A 3EVYA 4H9PC 4O8SA 1SHZC 5FY0A 5M4YA 2N9DA 4U2YA 2V5CA 3PUXF 4HGAA 4PK6A 5L3DB 4DMVA 5FXWA 3Q5DA 3AE3A 4B3ST 2FUPA 2LHNA 2R6GF 3S4UA 2ODUA 1YD8G 3AVRA 2CCQA 4YJ3E 4H63H 2K9AA 4DMWA 3ONLC 2XQ8A 3JCFA 2XQ4A 2VKHA 3ETUA 5ABHA 3JC6C 5IYZE 4EZ4A 5HXSA 3N9NA 1OEDE 3C64A 5J2TE 5HEOA 5JVDE 5ABFB 3PJAA 5LBQB 4AI6A 5FL1A 5FYMA 2CXLA 5C8YE 4LFCT 5LXTE 4ZXLA 5HAXA 2CXDA 3AE4A 2WCAA 2XQ6A 4Z90A 4QHOA 4X20E 3RKGA 3FB2A 1KK7A 4G2AA 3A5XA 4I4TE 4OK0A 3RX6A 3V5UA 2M6IA 4DR1T 3FZMB 1MMNA 4YHHT 2UUAT 3I0QA 5AQTB 4NXNT 2MPKA 4AQFA 3AECA 2BS4A 1MMDA 3H3MA 5LGNB 5DABA 4AKHA 1J5WA 2CBIA 4CXWA 3PU3A 5FXXA 2L3LA 4OYKA 2Q9QC 4HTEA 1YKHB 3MKDA 4JLEA 5IWAT 4ZI2D 1D0ZA 4H63V 5LB7B 3MK7C 3Q9DA 2MOZA 4PFOA 2MBGA 4ILBA 2E9XD 4JI2T 3L3PA 4XAXB 3IEEA 3BK9A 1D1BA 4I55E 4UIGA 2I59A 2Z6EA 2VVSA 1WR6A 3ZYMA 3FXEB 4IE7A 4F6RC 4ZS3A 1M62A 3UTKA 3VU7H 3EHZA 4TWDA 5AQHB 5AQPB 3LK2B 4HWHA 2W62A 3RQWA 5AQVB 1ZV4X 5AQQB 2MYSA 4O4HE 4JUYA 1UX5A 4B3TT 5L3GB 4PNIA 5LMNT 1WLXA 1IBLT 3KV9A 2PTFA 5FNVE 1D1AA 5LG4A 2IAKA 3O1IA 4JI8T 1BR1A 4HKAA 3GMIA 4UV8B 1W9RA 1IBKT 1MNEA 5EK3A 4GKJT 1MNDA 2UXNB 5JH7E 4DVDA 4WYVA 2CEAA 4DO0A 5AQOB 3QOFA 3P7IA 3WAJA 4EYYR 3AEFA 2XUEA 3UU8A 3KBTA 4H9OC 1WCRA 4X66T 4DV3T 2VQFT 3LK42 4IE6A 4ADZA 3K8PC 2VKOA 4K0KT 3ZMTB 4JI1T 5JRCA 2CLYB 4KBMB 3AEEA 3RPUA 5HCJA 2VURA 1J5ET 1UUSA 2CLYC 5J0ZA 3VR8A 2NR4A 4IREA 2CBJA 2RPAA 4PAGA 4A56A 1BR0A 4I50E 4KHZF 3ZN0B 1S94A 4XBFB 5HWYA 4AKIA 3TLUA 4J2CA 4PW8A 3C4ZA 2D5UA 4ERRA 4YFSA 1QUUA 1MMAA 1M7KA 2WY2A 1LKXA 3DJBA 2H7VC 3UU3A 4AKLA 4YXDA 5GONE 3ZT6A 3KVBA 3ZCIA 3U78A 5ABEA 3R84B 1L0VA 3UUMA 3P4QA 1YW0A 3I9WA 5HCMA 5LP6E 2UU9T 2WM9A 3AXJA 4FJOA 4U7IA 4EAHA 3DTOA 2AE9A 2XAJB 4IDZA 2D0TA 2G0UA 3ABVA 2ACXA 3B13A 3F57A 3FBZA 3L8RA 4WW0A 5J1GA 3CMLA 2XQ3A 2JJ9A 1N33T 3NVOA 4V1Av 3T1YT 3PUSA 2J4GA 2XQ5A 3FZKB 5JDFA 1HX1B 2HPLA 3CPZA 3E0ZA 2BDEA 5LOVE 2BKNA 3GN5A 4JI0T 4UVAB 2KWIB 1Z0PA 2RP4A 2V7LA 3IBPA 2UXDT 2LRKA 2FJBA 4O4LE 2KMFA 1FMVA 1KEYA 2E9XA 4QH4A 4P0BA 5AQKB 1DU2A 3N9MA 1N34T 3LSVA 3P50A 4OHFA 3PUYF 3N9QA 1MMGA 3K3QC 3IF8B 3CX6B 1OEDA 2X0HA 3CK6A 1CUNA 1WR0A 2LJLA 2W61A 5JDHA 1GQEA 2AXDS 3P4SA 4Z91A 3VR9A 2C5JA 4YLHA 2CA5A 3ZSTA 1JNZA 1X9BA 2NTYA 4AKRB 4UXNB 2XQYA 3PU8A 5KMGP 3IA3A 3CQXC 4MFRA 3ZC0A 3PTRB 2OV9A 2WQYA 2PG8A 2BKOA 2BG9E 4LF6T 2XM2A 1EZ3A 3LFMA 4EZHA 1H7CA 4HFDA 4YSZA 2IMLA 1IAPA 2BVLA 1J1JA 5HXCA 2KT9A 3T8OA 3RIUA 5TAOA 4HWFA 4ANJA 3FZHB 4U2ZA 1HG5A 4H9SE 5EK4A 1SUMB 4YT0A 2JMHA 4WNKA 1XWMA 5JTGA 2W4XA 2ZM6T 4JI6T 4IL4A 2FJEA 3K3OA 3QC9A 2W63A 2W2UA 1XMQT 2VQET 4JEHB 5AQSB 3K1SA 3NBXX 3OJAA 2WSSV 5LMUT 3M3ZB 2V1DB 2V6XA 2XY8B 2WB5A 3B57A 5JDNA 5KXJA 4QH5A 4UVCB 1XNRT 2KLQA 3P4PA 4TV8E 4ZEYA 2ZM2A 2D2SA 3I1AA 3TLVA 5L47A 4PK5A 4UF0A 3ZKRA 3RKOA 3Q5WA 1NENA 2YDSA 5LHGB 1R8IA 4C90A 4U72A 3KFWX
chains in the Genus database with same CATH topology
4IDOA 3Q5EA 3QNUA 1Y01A 3IA3A 3Q5DA 4IDPA 3X1DA 3QOFA 1W0AA 4IDQA 1XZYA 1Z8UA 4IDNA 1W09A 1W0BA 3OVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDO A;  3Q5E A;  3QNU A;  1Y01 A;  3IA3 A;  3Q5D A;  4IDP A;  3X1D A;  3QOF A;  1W0A A;  4IDQ A;  1XZY A;  1Z8U A;  4IDN A;  1W09 A;  1W0B A;  3OVU A; 
#chains in the Genus database with same CATH topology
 2Y48 B;  3TLS A;  1VCS A;  1YKE B;  2ZM8 A;  2WAU A;  4JEU B;  3KIN B;  4LFA T;  3ZLI A;  2WWU A;  2X9X A;  4AXP A;  2KZ7 B;  4DV4 T;  1NEK A;  4QXB B;  4IDO A;  1W0B A;  3C51 A;  4OYJ A;  2EHO D;  4COF A;  3AA0 B;  2W00 A;  1YXR A;  3CX7 B;  2MAW A;  4HFB A;  3AB3 B;  4LMK A;  3BQL A;  2CWY A;  1WFD A;  4BAY B;  2XQ9 A;  3TLT A;  4GYR A;  4LF4 T;  4AQF C;  4FI5 A;  2IHR 1;  3PUZ F;  4YTM A;  4E7Z A;  2ZLY A;  2JQ9 A;  1ZP0 A;  4ILU A;  4LMJ A;  1HFA A;  2ZM0 A;  4I0U A;  1ZEE A;  4JV5 T;  4X64 T;  1N36 T;  4TWF A;  2CMR A;  4XZC A;  2E2A A;  3ZC1 A;  4KMC A;  2ODV A;  2H3R A;  3PJA J;  5LHI B;  3FXD B;  2W0G A;  4ZZB A;  4IIJ E;  3ZT7 A;  3AAA B;  3NWI A;  5LGT B;  1OXZ A;  4UEM A;  2DNX A;  4X62 T;  2LKG A;  5HEU A;  5ABG A;  3CX8 B;  4IHJ E;  2X51 A;  2E8I A;  3A7M A;  3UU4 A;  4HEA A;  2LKH A;  2WDV A;  5J2U E;  2Q9Q B;  2XQA A;  1OWA A;  3RYF E;  3N2O A;  3ZJ2 A;  3OYZ A;  3QB5 K;  2FBW A;  2YU2 A;  2CHN A;  2BBH A;  2V26 A;  3HKD E;  3RF1 A;  5EK2 A;  2W67 A;  2V8S V;  3CKD A;  5LJN A;  4CQI A;  2VL8 A;  2V7K A;  3ZYK A;  2JQQ A;  3DP7 A;  3W15 B;  3F31 A;  3CIR A;  3RYH E;  1SA0 E;  4JI4 T;  3KVA A;  3RQU A;  4EEB A;  5FXZ A;  3EDU A;  4GOU A;  2VKJ A;  2LSY A;  4CN4 A;  5HEH A;  3OPC A;  3UUN A;  2LT3 A;  4KI0 F;  1E2A A;  4Z8X A;  4O4I E;  2UUB T;  3ZCJ A;  4MBQ A;  5LNK A;  1XZY A;  4YY3 T;  2QYW A;  4GYS A;  1B7T A;  4UV9 B;  1HG2 A;  2LSK A;  3NZP A;  4O2A E;  2YDR A;  3B5M A;  2XSA A;  4IST A;  2D9D A;  3ZN1 B;  2Y8D A;  4OFZ A;  2YEV C;  4GIW A;  5ADX L;  4IE5 A;  4ZI3 D;  3QNU A;  4A98 A;  2LRL A;  4BA9 A;  5DQW A;  4EB6 E;  1HX8 A;  4K0U A;  2DL1 A;  5FVK A;  4P0A A;  3UU5 A;  2DWG A;  2YOE A;  4QWN B;  2DHR A;  5C2T A;  4C91 A;  4L0R A;  5IUX A;  2IC9 A;  4QXH B;  5JDQ A;  2XAH B;  2QGS A;  2HH7 A;  3RYC E;  4CI2 B;  2NW7 A;  2W66 A;  3AAI A;  4EV6 A;  2ES0 A;  4DUY T;  2N2N A;  4NUU A;  4TNV A;  2EHO C;  3AA6 B;  3Q2M A;  3UT5 E;  3MAC A;  5LG3 A;  5HWX A;  4BJM A;  2X9H A;  3VKG A;  4PJL A;  3ANW B;  5L4E A;  4CI1 B;  3UU6 A;  2DWK A;  3ZMU B;  4DR5 T;  3SFD A;  1ZOY A;  1FMW A;  1E1H B;  2BG9 A;  4CN1 A;  3NZQ A;  3RIA A;  2X0Y A;  2IUB A;  4M1P A;  2UXB T;  3X1D A;  3EUH A;  3AE6 A;  3JAF A;  2XAQ B;  2QVA A;  3BQK A;  3E22 E;  1WYB A;  4NXM T;  3LBX A;  2EHO A;  3C4W A;  3AEA A;  5AQU B;  3V5S A;  2UXC T;  2YN6 A;  3LG7 A;  4ZS2 A;  2I0M A;  3ONX A;  3HKE E;  4IE4 A;  2J62 A;  2OLT A;  1IZN B;  5LGU B;  1Y64 B;  4YSX A;  3ETV A;  1BR4 A;  3OTO T;  2CWO A;  1KNP A;  3RHW A;  1U4Q A;  1HTJ F;  3N9P A;  4ZI2 C;  3AE5 A;  2BS3 A;  3FZF B;  3KV4 A;  3J9X 1;  1MIV A;  1Z8U A;  2E9X C;  2KIN B;  2NP9 A;  2A9U A;  5AQN B;  1UX4 A;  2L9Q A;  3UUL A;  3RIF A;  3WI3 A;  4YHJ A;  3J7Y q;  2ZMA A;  3AEB A;  4AQG A;  4KX6 A;  1XDO A;  1OED C;  2BS2 A;  3BQI A;  3LK3 B;  1KNZ A;  2OA5 A;  3A8Y C;  3RH3 A;  1YQ4 A;  2K3W A;  5C3J A;  5HYA A;  3AVS A;  3ZYL A;  2VVN A;  3PUR A;  4PFP A;  3KBU A;  4LF7 T;  1Y01 A;  4O2B E;  4DND A;  2LSI A;  2DLR A;  4NUV A;  5L3E B;  2QA7 A;  3KDS E;  4X1K E;  4HFH A;  1HR0 T;  3PUA A;  3CQG B;  1UGO A;  5H6Q B;  2PJQ A;  3FBL A;  4EOZ B;  3VKH A;  2FJA A;  4ASK A;  3JAE A;  2XSB A;  5CFB A;  1QLB A;  5L3F B;  4QX7 B;  4A5X A;  4JI5 T;  4X65 T;  4TWH A;  3MZK B;  3RIU C;  4IDQ A;  1T8B A;  1AJ3 A;  2V6Y B;  4X5T A;  3MJX A;  2XHE B;  3O4X E;  4UVB B;  2WMN A;  4DV6 T;  2KND A;  2PFV A;  3C98 B;  3LJC A;  5CA1 E;  1FIO A;  3SFE A;  4AQY T;  5EZY E;  5JDG A;  1US7 B;  5KX5 E;  3CWZ B;  1D0X A;  2V7M A;  4DR3 T;  4ILC A;  2WDQ A;  2LEH A;  5JR9 C;  4ZZC A;  3JAD A;  2VAS A;  3P8C D;  2Q9Q D;  2VK9 A;  1UCU A;  2BBJ A;  2VKD A;  4DV5 T;  4EIW A;  3C50 A;  4AIS A;  4NPP A;  4NIQ A;  3HR0 A;  3HKB E;  4EED A;  5CJ5 A;  2CE7 A;  3TKL B;  1LRZ A;  2IDO B;  2XAG B;  4DV0 T;  4H9Q C;  4U74 A;  2M67 A;  4X1I E;  2NW9 A;  1VOM A;  2LSG A;  4UEL A;  1UUR A;  5HXE A;  2LOS A;  2V7J A;  3NKZ A;  2V5D A;  2P9B A;  5L3B B;  5BR8 T;  5JR9 A;  2H7O A;  4P1N A;  2CPT A;  1V9D A;  3E08 A;  1ZKE A;  5FL0 A;  3MXZ A;  2A72 A;  4L9I A;  5BMV E;  5HXR A;  3P4R A;  2Y6X A;  3O9X A;  3PUV F;  5H6R B;  4O4J E;  3O1H A;  1HNW T;  5FKY A;  2NW8 A;  4I43 B;  2V7I A;  4YJ2 E;  5LBM A;  2X9Y A;  3RGL A;  3HI2 A;  4IDN A;  1IBM T;  2C5I T;  5F5W A;  2QRX A;  3U3I A;  5L2L A;  4DR7 T;  4YTP A;  4PJM A;  3EI0 A;  3RRC A;  1D1C A;  4HFE A;  2SPC A;  4DR4 T;  4JI3 T;  2KWH A;  3AE2 A;  3AE8 A;  2LM9 A;  1MIY A;  2XTL A;  2K24 A;  1S35 A;  3NRX A;  4LF8 T;  4MLK A;  1U5P A;  4QH1 A;  2WS3 A;  4U33 A;  2LM2 A;  1KNR A;  3N9L A;  5A1L A;  4DR6 T;  4ILA A;  4G63 A;  2A3D A;  2IIU A;  2JRK A;  5L3C B;  2LOP A;  4IDP A;  4EYU A;  3N2G E;  1XNQ T;  3L09 A;  1T98 A;  2MTQ A;  1I6Z A;  3HL6 A;  2YK0 A;  2X66 A;  4HE8 A;  5JDM A;  1G73 A;  4TZ4 C;  3ZMS B;  5LA6 E;  3K3N A;  1I94 T;  1UK5 A;  1FJG T;  2BVM A;  4KHP T;  3ONJ A;  2YIN A;  2CXF A;  3HKC E;  4LF9 T;  2K48 A;  4DUZ T;  3ESL A;  2GK9 A;  4JBW F;  2E5L T;  1IJ6 A;  3WAK A;  2DCF A;  3H37 A;  3ZT5 A;  2NOX A;  1W09 A;  2KXP B;  2XQ7 A;  3OYX A;  5L4H A;  4E7S A;  3G06 A;  4MAL A;  5ABF A;  1FEW A;  1YQ3 A;  2WDR A;  5AQL B;  2K5B B;  2WMO A;  2IW5 B;  3SS1 A;  4LFB T;  5JDL A;  3H3A A;  1XDP A;  2YU1 A;  4DR2 T;  3AEG A;  3EAB A;  2YKS A;  4WBN E;  4U7Y A;  4CZZ B;  4PJJ A;  3AE7 A;  1XMO T;  4IGU A;  2Q9Q A;  4WZX A;  5AFU L;  1SE7 A;  3GA8 A;  5JRC B;  3OBV E;  3UFE A;  3C4X A;  5HEG A;  2N1G A;  2BZB A;  4ZI7 E;  2BG9 B;  3PDY A;  3NRY A;  1QSD A;  4QX8 B;  2BG9 C;  1BR2 A;  5AQR B;  5F8P A;  4ZHQ E;  1VRB A;  3UQ7 A;  4PK4 A;  3TLW A;  4B3R T;  1NWM X;  1JNR A;  2J1D G;  5AQI B;  3RC3 A;  3LBX B;  2M6B A;  2XAF B;  2EHO B;  4MHC A;  4H9R C;  3GWH A;  3VRB A;  3R6N A;  4B3M T;  3UUX B;  2HN1 A;  4CXX A;  2BKP A;  1O3X A;  1LVK A;  1E7P A;  4QKN A;  3T1H T;  4N78 D;  5E0O A;  2RA1 A;  4U31 A;  3M65 A;  2CRB A;  4PJN A;  3VRA A;  3O1J A;  3ZMZ B;  3P4W A;  3AE9 A;  3AXJ B;  3SRZ A;  1KF6 A;  1HF8 A;  2WBL A;  2X67 A;  3UFG A;  4HN9 A;  1VCT A;  3OKQ A;  4H9N C;  2B1E A;  3CQC B;  5CB4 E;  3RYI E;  3PUW F;  4IE0 A;  2H89 A;  4Q25 A;  2C0S A;  4IL9 A;  3UUB A;  5JQG E;  3ZPO A;  2YDQ A;  4JYA T;  4F8H A;  2LHR A;  1HNX T;  2WU2 A;  3AAE B;  2WWV A;  4DBR A;  3GN5 B;  3SWH A;  2X0L B;  3HA4 A;  5F3J A;  5DJQ C;  3ZJ1 A;  1LVF A;  3N9O A;  3KV5 A;  3ANW A;  2E9X B;  3F2E A;  4B6X A;  4KUM B;  2KSR A;  3RC8 A;  3EDV A;  4HFV A;  4AKG A;  2JQK A;  5DQV A;  3MA9 A;  2JIW A;  2LE8 A;  4DV1 T;  2D0U A;  4GKK T;  1OED B;  2H88 A;  4DV7 T;  5HXH A;  3PV0 F;  4OX9 T;  2XPK A;  2WU5 A;  2VWA A;  4GK5 E;  3ZMV B;  4KP3 C;  3D0T A;  5LHH B;  4EXT A;  2JQH A;  4U3C A;  3KV6 A;  5AQF B;  3QK6 A;  2CHO A;  2X9W A;  2UXX B;  5FMN A;  3RRW A;  2LLY A;  4JI7 T;  5IHY A;  1IJ5 A;  2WZI A;  3PUG A;  3FZL B;  4EGW A;  1ZHC A;  2VL0 A;  5JRE A;  2XJ7 A;  4TV9 E;  4ZI3 C;  1X79 A;  3PUQ A;  2CM0 A;  4LML A;  2HHH T;  4CN6 A;  5FVL A;  3I9Y A;  4BJN A;  4DID B;  4TX5 A;  3JC6 D;  4GK0 E;  4QXC B;  3L39 A;  5FY1 A;  3RI5 A;  2DI4 A;  1WYC A;  4LF5 T;  2L8K A;  2HN2 A;  4UR9 A;  1WRD A;  5FY7 A;  5CA0 E;  3AA7 B;  2F4V T;  1W0A A;  5LCY A;  3IHR A;  2XZE A;  3PE0 A;  2XAS B;  4DV2 T;  4HWI B;  4P09 A;  4HFC A;  2J47 A;  3LDQ B;  5AQJ B;  2LSJ A;  3N2K E;  5JR9 B;  4WBO A;  1HCI A;  2XM1 A;  2X68 A;  4AIU A;  3CVR A;  1N32 T;  3ZSS A;  1KFY A;  4YSY A;  2A2F X;  5AQG B;  2WZH A;  2HPJ A;  4IT4 A;  2UUC T;  4ISS A;  2FJD A;  1T72 A;  4UF0 B;  4CXY A;  2ACZ A;  3UQ4 A;  4L5G A;  5FP3 A;  2B76 A;  3FHN A;  2NWB A;  2C5K T;  2V6Y A;  2E5V A;  5CGM A;  3EAM A;  1D0Y A;  4TN7 B;  1HS7 A;  2WP9 A;  3AED A;  5LJM A;  5KDM C;  5AQM B;  4A97 A;  3QUJ A;  2I6H A;  3VHL A;  3Q5E A;  1T7S A;  4CI3 B;  4HWC A;  4TNW A;  3OVU A;  4DBQ A;  3SOL A;  4TUY E;  5LYJ E;  1CHU A;  2JPF A;  2NTX A;  5ETW A;  3I0O A;  2JMK A;  4HWD A;  3N5L A;  3QB5 A;  2IC6 A;  4YTN A;  5HEJ A;  3ZEF B;  4X1Y E;  3RLF F;  4ZOL E;  3AA1 B;  1MIW A;  1NAF A;  1G8X A;  4HFI A;  2PBI A;  1HNZ T;  3Q5X A;  5FXV A;  2VB6 A;  3AE1 A;  3EVY A;  4H9P C;  4O8S A;  1SHZ C;  5FY0 A;  5M4Y A;  2N9D A;  4U2Y A;  2V5C A;  3PUX F;  4HGA A;  4PK6 A;  5L3D B;  4DMV A;  5FXW A;  3Q5D A;  3AE3 A;  4B3S T;  2FUP A;  2LHN A;  2R6G F;  3S4U A;  2ODU A;  1YD8 G;  3AVR A;  2CCQ A;  4YJ3 E;  4H63 H;  2K9A A;  4DMW A;  3ONL C;  2XQ8 A;  3JCF A;  2XQ4 A;  2VKH A;  3ETU A;  5ABH A;  3JC6 C;  5IYZ E;  4EZ4 A;  5HXS A;  3N9N A;  1OED E;  3C64 A;  5J2T E;  5HEO A;  5JVD E;  5ABF B;  3PJA A;  5LBQ B;  4AI6 A;  5FL1 A;  5FYM A;  2CXL A;  5C8Y E;  4LFC T;  5LXT E;  4ZXL A;  5HAX A;  2CXD A;  3AE4 A;  2WCA A;  2XQ6 A;  4Z90 A;  4QHO A;  4X20 E;  3RKG A;  3FB2 A;  1KK7 A;  4G2A A;  3A5X A;  4I4T E;  4OK0 A;  3RX6 A;  3V5U A;  2M6I A;  4DR1 T;  3FZM B;  1MMN A;  4YHH T;  2UUA T;  3I0Q A;  5AQT B;  4NXN T;  2MPK A;  4AQF A;  3AEC A;  2BS4 A;  1MMD A;  3H3M A;  5LGN B;  5DAB A;  4AKH A;  1J5W A;  2CBI A;  4CXW A;  3PU3 A;  5FXX A;  2L3L A;  4OYK A;  2Q9Q C;  4HTE A;  1YKH B;  3MKD A;  4JLE A;  5IWA T;  4ZI2 D;  1D0Z A;  4H63 V;  5LB7 B;  3MK7 C;  3Q9D A;  2MOZ A;  4PFO A;  2MBG A;  4ILB A;  2E9X D;  4JI2 T;  3L3P A;  4XAX B;  3IEE A;  3BK9 A;  1D1B A;  4I55 E;  4UIG A;  2I59 A;  2Z6E A;  2VVS A;  1WR6 A;  3ZYM A;  3FXE B;  4IE7 A;  4F6R C;  4ZS3 A;  1M62 A;  3UTK A;  3VU7 H;  3EHZ A;  4TWD A;  5AQH B;  5AQP B;  3LK2 B;  4HWH A;  2W62 A;  3RQW A;  5AQV B;  1ZV4 X;  5AQQ B;  2MYS A;  4O4H E;  4JUY A;  1UX5 A;  4B3T T;  5L3G B;  4PNI A;  5LMN T;  1WLX A;  1IBL T;  3KV9 A;  2PTF A;  5FNV E;  1D1A A;  5LG4 A;  2IAK A;  3O1I A;  4JI8 T;  1BR1 A;  4HKA A;  3GMI A;  4UV8 B;  1W9R A;  1IBK T;  1MNE A;  5EK3 A;  4GKJ T;  1MND A;  2UXN B;  5JH7 E;  4DVD A;  4WYV A;  2CEA A;  4DO0 A;  5AQO B;  3QOF A;  3P7I A;  3WAJ A;  4EYY R;  3AEF A;  2XUE A;  3UU8 A;  3KBT A;  4H9O C;  1WCR A;  4X66 T;  4DV3 T;  2VQF T;  3LK4 2;  4IE6 A;  4ADZ A;  3K8P C;  2VKO A;  4K0K T;  3ZMT B;  4JI1 T;  5JRC A;  2CLY B;  4KBM B;  3AEE A;  3RPU A;  5HCJ A;  2VUR A;  1J5E T;  1UUS A;  2CLY C;  5J0Z A;  3VR8 A;  2NR4 A;  4IRE A;  2CBJ A;  2RPA A;  4PAG A;  4A56 A;  1BR0 A;  4I50 E;  4KHZ F;  3ZN0 B;  1S94 A;  4XBF B;  5HWY A;  4AKI A;  3TLU A;  4J2C A;  4PW8 A;  3C4Z A;  2D5U A;  4ERR A;  4YFS A;  1QUU A;  1MMA A;  1M7K A;  2WY2 A;  1LKX A;  3DJB A;  2H7V C;  3UU3 A;  4AKL A;  4YXD A;  5GON E;  3ZT6 A;  3KVB A;  3ZCI A;  3U78 A;  5ABE A;  3R84 B;  1L0V A;  3UUM A;  3P4Q A;  1YW0 A;  3I9W A;  5HCM A;  5LP6 E;  2UU9 T;  2WM9 A;  3AXJ A;  4FJO A;  4U7I A;  4EAH A;  3DTO A;  2AE9 A;  2XAJ B;  4IDZ A;  2D0T A;  2G0U A;  3ABV A;  2ACX A;  3B13 A;  3F57 A;  3FBZ A;  3L8R A;  4WW0 A;  5J1G A;  3CML A;  2XQ3 A;  2JJ9 A;  1N33 T;  3NVO A;  4V1A v;  3T1Y T;  3PUS A;  2J4G A;  2XQ5 A;  3FZK B;  5JDF A;  1HX1 B;  2HPL A;  3CPZ A;  3E0Z A;  2BDE A;  5LOV E;  2BKN A;  3GN5 A;  4JI0 T;  4UVA B;  2KWI B;  1Z0P A;  2RP4 A;  2V7L A;  3IBP A;  2UXD T;  2LRK A;  2FJB A;  4O4L E;  2KMF A;  1FMV A;  1KEY A;  2E9X A;  4QH4 A;  4P0B A;  5AQK B;  1DU2 A;  3N9M A;  1N34 T;  3LSV A;  3P50 A;  4OHF A;  3PUY F;  3N9Q A;  1MMG A;  3K3Q C;  3IF8 B;  3CX6 B;  1OED A;  2X0H A;  3CK6 A;  1CUN A;  1WR0 A;  2LJL A;  2W61 A;  5JDH A;  1GQE A;  2AXD S;  3P4S A;  4Z91 A;  3VR9 A;  2C5J A;  4YLH A;  2CA5 A;  3ZST A;  1JNZ A;  1X9B A;  2NTY A;  4AKR B;  4UXN B;  2XQY A;  3PU8 A;  5KMG P;  3IA3 A;  3CQX C;  4MFR A;  3ZC0 A;  3PTR B;  2OV9 A;  2WQY A;  2PG8 A;  2BKO A;  2BG9 E;  4LF6 T;  2XM2 A;  1EZ3 A;  3LFM A;  4EZH A;  1H7C A;  4HFD A;  4YSZ A;  2IML A;  1IAP A;  2BVL A;  1J1J A;  5HXC A;  2KT9 A;  3T8O A;  3RIU A;  5TAO A;  4HWF A;  4ANJ A;  3FZH B;  4U2Z A;  1HG5 A;  4H9S E;  5EK4 A;  1SUM B;  4YT0 A;  2JMH A;  4WNK A;  1XWM A;  5JTG A;  2W4X A;  2ZM6 T;  4JI6 T;  4IL4 A;  2FJE A;  3K3O A;  3QC9 A;  2W63 A;  2W2U A;  1XMQ T;  2VQE T;  4JEH B;  5AQS B;  3K1S A;  3NBX X;  3OJA A;  2WSS V;  5LMU T;  3M3Z B;  2V1D B;  2V6X A;  2XY8 B;  2WB5 A;  3B57 A;  5JDN A;  5KXJ A;  4QH5 A;  4UVC B;  1XNR T;  2KLQ A;  3P4P A;  4TV8 E;  4ZEY A;  2ZM2 A;  2D2S A;  3I1A A;  3TLV A;  5L47 A;  4PK5 A;  4UF0 A;  3ZKR A;  3RKO A;  3Q5W A;  1NEN A;  2YDS A;  5LHG B;  1R8I A;  4C90 A;  4U72 A;  3KFW X; 
#chains in the Genus database with same CATH homology
 4IDO A;  3Q5E A;  3QNU A;  1Y01 A;  3IA3 A;  3Q5D A;  4IDP A;  3X1D A;  3QOF A;  1W0A A;  4IDQ A;  1XZY A;  1Z8U A;  4IDN A;  1W09 A;  1W0B A;  3OVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...