1W0CA

Inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
276
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDVGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Leishmania Major Pteridine Reductase by 2,4,6-Triaminoquinazoline: Structure of the Nadph Ternary Complex
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 98
structure length 276
sequence length 283
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w0cA00
4QO8A 4UVGA 4TVBA 1HT0A 3WNVA 3B20A 5IJZA 3D5TA 1SMKA 2IYPA 2PNFA 3KYBA 2O4UX 4CMIA 2Q50A 1U3UA 2VTDA 1OZAA 4IJUA 4RVSA 3SX2A 3ZI0A 1ENYA 3PYMA 2AW5A 5JCJA 3L77A 1E6UA 2QG4A 2V6GA 1I3LA 4E2XA 3TL3A 1LBEA 4OHUA 1BW9A 3TFQA 4OM8A 2DTEA 5JLAA 1LI4A 4P4NA 3W6ZA 4Y6SA 4D3SA 4I9UA 3DAFA 2EF1A 3S1LA 3W1VA 4BV9A 4CL3A 1W0CA 4BQRA 2PWZA 4KDEA 1M66A 3SC4A 3KSDO 2EKLA 4PG8A 3DTYA 5CHEA 4DUPA 4BO0A 5A1TA 4BL5A 4E12A 3A28A 3NDRA 4BO4A 1EE9A 4J0FA 3CMCO 3WMXA 4LW8A 1V3VA 1GDHA 4RQUA 3W4KA 1HZJA 5CFZA 4II3A 5AXBA 2TMGA 5T67A 2RCYA 3P19A 2I9PA 1O8CA 7ADHA 2E4AA 1WAMA 3E9MA 4WNIA 4DYVA 4EW6A 4EBFA 4FJ0A 1MFZA 2NWQA 3GN2A 4PLWA 2FZWA 2ZATA 4FGSA 4FFPA 3FHLA 3RI3A 1ZVMA 2HMWA 3L6DA 4NK4A 3PRJA 3LVFO 4A27A 3MJSA 1B26A 1IPFA 1NQOA 2Y93A 4CMCA 1U3TA 4XGKA 5IXYA 5L7WA 4D44A 5KWEA 3OECA 4G81A 4DLAA 3SC6A 3KYCA 4QUKA 2XAAA 1JW9B 3OH8A 4FD3A 1GUZA 1WNTA 3AJRA 4K26A 2NU6A 1QSGA 1VSVA 4UEJA 2OHXA 1BG6A 2DFVA 3H4VA 1P0FA 2RH8A 2YHIB 3BMQB 1WDMA 4R5HA 5GMOA 3LU1A 4XB2A 4BNHA 4ZQEA 4E5PA 1IULA 5CG1A 1J5PA 1B8VA 3ZWYA 5JC8A 1E1KA 1T25A 3PPIA 4CM5A 4ALIA 4XKJA 1LSOA 3A4VA 3FPLA 4CM9A 3U49A 3CMMA 1OI7A 3EMKA 4NPCA 4TZKA 1EUCA 4ILKA 3D3EA 3VKVA 2VZ8A 1P1KA 3P7MA 3R1IA 2DTDA 5T8KC 4YCAA 4BNZA 1HXHA 2VHWA 1J6UA 2O2YA 1RM5A 3VKUA 4E6PA 4J9UE 4R16A 3OFSA 4JP2A 1LSUA 4MIOA 3FCOA 3OJEA 2JCYA 4AJKA 1HDCA 3IMFA 1IB6A 3JD1A 3PHGA 2BD0A 3I52A 2YQ4A 2WEKA 3FWZA 3EK2A 1A7AA 4PN3A 3H2ZA 1LDBA 1WLYA 4YRDA 3RJ5A 5H83A 1RKXA 3BMNB 1I2CA 4UVIA 1YDWA 2VUSA 2H63A 2X9GA 4JLWA 5TS3A 1IL0A 3I9NA 4ZA2A 1XKQA 4PFJA 2PH3A 3PJGA 3QVXA 4YPOA 3NRCA 3ZZNA 2O48X 2GSDA 3A1NA 3Q2KA 5AXDA 1WDKA 3DC2A 3RC2A 4WLOA 3BMQA 1EE2A 4TWRA 3ZWMA 1NFRA 3F46A 3H6KA 1G0NA 1GR0A 3AY3A 3D3WB 3NT2A 3NTRA 5F5LA 4GWKA 1GYQA 4BKRA 4DVJA 4R3WA 3PP8A 3Q3CA 1EK6A 3WLFA 2ZJ0A 3PVZA 4PLHA 2NADA 4CPDA 4ZN6A 1E3WB 2OMEA 1X0XA 1ZUD1 4YJFA 4NIMA 4IXWA 2C20A 2VHVA 4YA6A 1KVQA 4J7UA 4WCDA 1ZCJA 3DWFA 4U0JA 5FWNA 2D4AA 1EZ4A 1UXIA 3FNGA 5CPFA 4XDYA 1ENZA 1BW9B 4FFOA 2YHIA 4IMRA 4D3FA 3D4PA 2AG5A 1PSDA 1B16A 2BFPA 2ZCUA 3RKRA 1IPEA 1EQUA 1ZXLA 2DBVO 1T2FA 1RM3A 2J5KA 1QV7A 1X1TA 2EWMA 5TT0A 2FP4A 1EUZA 3NEPX 4U6SA 5FYDA 4EZBA 2EGHA 2EV9A 2IZZA 3FR7A 1UDAA 2DBRA 3H5NA 3GY0A 2DKNA 1V3UA 3PWKA 3WR5A 4CV1A 5F1KA 1R0KA 2CDCA 1KETA 3AI1A 1DFHA 4LSWA 1FXSA 1JDJA 5DZSA 1LUAA 3G79A 4CLXA 5KJCA 3IDSA 3GFGA 5G4KB 4EDFA 1JA9A 1PJ4A 4BV8A 2Y1OA 1P44A 4YXFA 2IE0A 4KZPA 4IDAA 3GA0A 4TQGA 3ON5A 2WTBA 1ZK2A 2TMDA 4YQZA 3PJEA 1FK8A 3AM5A 4IQ0A 3ZHBA 5A9RA 1E0DA 3VZSA 3JQBC 3L9XA 4XZ3A 4DRYA 1EVIA 3U0BA 4BNUA 1T2AA 1VJ1A 2DUWA 2ET6A 3QWBA 4OGWA 3GR6A 1HYHA 3GC6A 2GO1A 3KEQA 3DMTC 3RASA 2FPIA 5EPOA 3V1YA 1V6AA 5A02A 3OMLA 4GX5A 4U6QA 1MB4A 3GEGA 3QWFA 3KYDB 2BI7A 1ID1A 4GI2A 3MJVA 2I3GA 1E7RA 3TZQA 4CLOA 2VRCA 5C37A 3JQ8A 3WGTA 1C3VA 1NVTA 2NTVA 1ISHA 4HWKA 5AOVA 3SLKA 2CNBA 1VKOA 4DTIA 1X0VA 4L74A 5HA5A 4EYEA 1Y7TA 2ZB4A 4CM8B 3IS3A 3KUXA 5KVCA 1R66A 2IXAA 5G0TA 4XWYA 4MVJF 4QEDA 4IY1A 3HFGA 1I2BA 3CINA 1YB5A 3ZHZA 1SBYA 3RUAA 1MG0A 5JS6A 2VOJA 1A27A 4M55A 3GLQA 1PJLA 2EGGA 1PZHA 3G49A 1UP7A 2P68A 3AUUA 5T5QA 1LXCA 3GNQA 2H5LA 4NNJA 1VL8A 5COQA 3ONFA 1O89A 3QVTA 2HRBA 4BKPA 3I9KA 3JQDA 4Y6RA 4YT2A 2W2KB 2SCUA 5CDTA 4YT5A 1XHLA 1QRRA 1RWBA 1I5RA 3I4CA 1Q7BA 2YW9A 9LDTA 4PLPA 4MVJD 1V8BA 3PHHA 3DR3A 1YE3A 4UVEA 3WFIA 4FR5A 1A9ZA 2CF5A 3SEFA 2C82A 1PZFA 3BTVA 5IDWA 3Q9NA 4J4TA 3HDHA 5IZCC 2VWHA 4ZRNA 4GMGA 4BO6A 4ALKA 3AM4A 1JU9A 4H15A 4RLSA 1ADCA 2PLAA 3R0IA 1U7TA 1T1RA 1V35A 1I30A 2QRKA 4JX8A 1BGVA 2IEDA 1TT7A 2HJRA 4BO3A 3V2GA 1HLPA 5A3VA 4G5HA 2PY6A 3OBBA 3PEFA 3O38A 2F1KA 4BMNA 4M86A 5DDIP 4O59O 2WSBA 4K9DA 2B83A 3WICA 1ZMTA 3PYLA 4AJIA 2EG9A 4IZHA 1GTMA 3FBTA 3UCEA 4OO3A 4CM3A 1QYCA 2AHRA 1XG5A 2AXQA 4WECA 3VH4A 5L4LA 2HMVA 4QTZA 1XU7A 3LC1O 4CMEA 1H94A 1PJ2A 1XDWA 1E6EA 2NQTA 4DC0A 3C7DB 1LA2A 2PGDA 4YT8A 1C0PA 4WLNA 4Z3DA 1UXHA 3K8ZA 3F47A 1YWGO 3BA1A 1JTVA 4WJZA 1RPNA 1Z7EA 4OOEA 3DHYA 8ADHA 3D4OA 5C3MA 4AVYA 4E3ZA 5HRUA 5JE8A 2Q99A 3HUDA 2ZIZA 1YJQA 1NR7A 5KVQA 2I65A 1SZJG 1IZ0A 3LSYA 1LRJA 1DC5A 1IUKA 3Q0EA 3DAPA 4BNJA 3ONEA 4FFNA 1KEWA 3E8XA 3OEYA 4B3JA 4GQAA 3O8QA 4JJFA 3GT0A 3QWIA 1H9AA 1SEPA 3RSHA 3ZWXA 4EUHA 5KVSA 1B15A 3TOZA 4IS3A 3TNLA 1JKFA 4J16A 2Z95A 2UVDA 4Q39A 4IDCA 3T4EA 3KBOA 4R69A 1F8FA 5HTOA 3HN7A 5I7VA 2J3JA 5ENDA 4DC1A 3DHNA 2B4QA 3STHA 2HU2A 1XELA 3NYWA 3NTQA 1HWYA 4MIEA 4FGWA 4YQYA 1A72A 3MJEA 5FI3A 2UAGA 1M2WA 4B7XA 2YDXA 3VPHA 3HNPA 1OBFO 2CSUA 3Q2IA 3WWYA 3KEOA 1Q7CA 4O5OA 5DCUA 5L45A 4E30A 4NH4A 3FNHA 3QE3A 1GV0A 3BTUA 4KDFA 2PR2A 4CMJA 1ZJZA 3OJ0A 1DSSG 2RAFA 4FC6A 4ZRMA 1HSZA 2VT2A 2EXXA 3ROPA 1VE9A 4EEZA 4FN4A 1W6UA 4K6FA 3QJ5A 3ZU5A 1PL7A 2O2SA 2IZ0A 5L53A 1E3JA 1ZZEA 2IYOA 5EQFA 2X5OA 3JQ8B 3ZWCA 2G82A 3ICPA 3AUSA 2X1HA 3DAGA 5BQFA 2Q1UA 3RC1A 2Y1CA 5MGBA 3O8QB 3ZNPA 1D3AA 2YZ7A 4QFDA 3L6EA 3WJ7A 2I6TA 3GG9A 2OORA 1MGOA 3OJFA 2GDZA 4GVLA 5DCYA 2ZYDA 3UUWA 3ZWAA 1DDOA 1NQTA 4OIMA 2PZKA 3BTSA 1QYVA 1TI7A 3PI7A 3CZRA 1LTHR 3OJLA 1JVSA 2EJVA 5EINA 1HF3A 2O7QA 4BKUA 4DLBA 1U4SA 1E3LA 4J49A 4CLRB 2FR8A 4GX2A 3WG9A 1QP8A 1GQQA 1XU9A 2BI8A 4CQMD 1LLDA 3QVSA 3VH3A 3FTNA 4CMEC 2PKQO 2X0IA 1UP6A 3FNEA 4FDAA 1H2BA 3WQSB 3LF1A 4YJHB 4ZGWA 3QWAA 4HADA 4RPKA 5TX7A 1XLTA 5BSFA 3H3JA 4Q3CA 3W6UA 4AG3A 3GQVA 1BXGA 3RU9A 2CDBA 4IJWA 2AG8A 3GVHA 4J2OA 2XF8A 1NHWA 2FPGA 4CQLA 4IUYA 5TRTA 3FN4A 5ENVA 3A9WA 4KQXA 4DPKA 3OICA 1GADO 4E13A 4NQZA 4I5FA 2VHXA 1TLTA 1ZNQO 1MLDA 5CEFA 2EP5A 3UHAA 4RL6A 2XXBA 1DBVO 4Y98A 4LGVA 2WJPA 4J43A 3DOJA 3QSGA 4RPJA 2EHDA 3GGGA 1HRDA 4MJLA 3AI3A 2UYYA 1KY4A 4WKGA 3HQ4O 4A03A 2Q1TA 3P2OA 4OH1A 1OOEA 4DWVA 3NUGA 5THQA 3VPGA 5A5EA 2X23A 1LDYA 5GZ3A 4UEKA 1U1IA 4A7PA 3HZZA 2P9CA 5TSDA 4XYLA 1V3TA 2FWMX 1DLIA 3VVBA 2BMAA 4XQ9A 5TC4A 4OJNA 4TMFA 2HQ1A 2VUTA 5BT9A 2X7HA 1PTJA 4R5MA 1EVJA 4J90A 1DFGA 1HYGA 2EKQA 1UR5A 1LSSA 3JYPA 4IXTA 4N5MA 3X2FA 4WLUA 3AK4A 5ITVA 2V6BA 3OEWA 1PJTA 1KC3A 4QT0A 3JYQA 1Y81A 2OL4A 2QX7A 1MP0A 2ZB8A 3EVTA 4Z0TA 4R68A 4YTEA 4ND1A 1SNYA 2D5CA 5A9SA 2CD9A 3OIGA 4KP7A 2DBZA 3RC7A 3U5TA 3E03A 1FJHA 3VOSA 2C0CA 4ND4A 3ITKA 1VL6A 4BNTA 2D1YA 1WZIA 4WCFB 4J7XA 3WTCA 3G3EA 3I3OA 3BMOB 1DHTA 1UXGA 1W4ZA 5T8KA 3V2HA 4K6CA 2X4GA 1I2ZA 3CXRA 2V7PA 3L4SO 4B8ZA 1LRLA 2CZCA 4J9VA 3OIFA 1BTOA 2JD1A 1ZSVA 1BSVA 2YY7A 1NPYA 2FY8A 2DU8A 1W73A 3I5MA 4IJKA 1Q0LA 2FOIA 1MC4A 3AUTA 3PFWO 2BH9A 2X6TA 5KKAA 4MVJM 1U3WA 3QWHA 4XR9A 4IBOA 5IAAA 4FCCA 3WNQA 2BF7A 4R01A 1GUYA 3K73O 3ST7A 1AN9A 3FPCA 1KEPA 4BO7A 1MA0A 5JDIA 4MP3A 1VPDA 3C7AA 4XRRA 1UP4A 2P9GA 2X58A 1PR3A 1E1LA 1HDGO 4CQMA 4A2CA 1YBAA 3TL2A 1H2HA 3TSCA 1QLJA 4IMPA 1AHHA 3KM0A 3C85A 2PV7A 4YAIA 5C7IO 5I7SA 4LRSB 3BHIA 4XGIA 1SOVA 1KYQA 4YAEA 1E5QA 1NX6A 3E5RA 1E7QA 4UULA 5GZ1A 4GGPA 1YOVA 5IFLA 3SJ7A 1LQUA 3KHUA 3E48A 4YJGA 4KUEA 1A4UA 4IDDA 2OXIA 3S8MA 2BFMA 2JKVA 2PK3A 1PEDA 4YBZA 5KVVA 5FEUA 3KXDA 1ISGA 2YYYA 3DEYX 5U4QA 1BWSA 1GQYA 1QKIA 2OZPA 2VWQA 4OOFA 2J6IA 4B8WA 4ZQGA 1Z45A 4S1VA 2A35A 1LU9A 2B4RO 2O3QA 2E37A 3KB6A 3E9NA 5DP2A 4ZHSA 3DBLA 3QVOA 3VH1A 1ENOA 3OM9A 2P4HX 4YVFA 3ZGYA 4O6VA 4NFSA 1ARZA 3GN1A 4OQZA 3WOHA 4ITUA 4W7HA 1TT5A 1AXEA 5JDCC 1K5HA 1GD1O 1SAYA 3GVXA 4C7JA 4DGSA 4MP6A 1XSEA 4AL4A 4PG4A 3RBZA 4J4HA 1CETA 2BELA 1LDGA 4N54A 1U3VA 3VDQA 1PS8A 3NAQA 4CLRA 3M1LA 2Y0EA 4NZ9A 3OQBA 3F9IA 4WLVA 4DBVO 2J8ZA 4EJ6A 2C5AA 2C29D 1EK5A 5DBFA 2X22A 4UREA 3QLJA 4GKVA 5JSFA 4BO9A 3QRWA 3GG2A 2NACA 2Y67A 3X2EA 4CLDA 4J4BA 2C2XA 3GH3A 4XIJA 1Z75A 1UXJA 1EVZA 4ZU3A 1U5CA 3H9QA 3VPSA 2AQHA 3QY9A 1EMDA 1J4AA 1P74A 3GVIA 5JC1A 2DLDA 4LMPA 3GMDA 3U9LA 2VQ3A 3NDIA 3PK0A 3F6YA 3H9JA 4MIYA 5JCJD 1WZEA 4XGNA 5L95A 2QYSA 3B70A 1EDZA 1ML3A 1MXFA 4FFRA 1OAAA 3E18A 1E77A 2FSVA 1DRVA 3HB5X 4E0BA 5H82A 3PZRA 1DLJA 1T1SA 3TF5A 2D59A 4HV4A 4E5NA 1PJBA 2JCVA 4XEHA 5KOIA 5DBIA 3WGZA 1YB1A 4PLFA 4G65A 1GPDG 4IIVA 2NU7A 4L4XA 1Q1NA 4I5EA 2D2IA 2UUPA 1C14A 1R16A 2D8AA 3IOYA 5JNLA 2Y05A 3MJCA 2GN8A 4B7CA 1E3IA 3RFXA 3AOEC 1E7WA 1MFPA 4IGFA 1YBVA 3TQHA 4XA8A 1BMDA 2CY0A 2DPGA 5FI5A 3ZHXA 3NKLA 5KTKA 2BLLA 3DBVO 4U5QA 3BMCB 3OHSX 4MVJH 4HUJA 4F6CA 3W4IA 5KCZA 1D7OA 4K28A 4YACA 2BKAA 3RUFA 4FOOA 3N58A 4URFA 4Y6PA 3RWBA 1LRKA 3ETDA 3G0OA 4EJ0A 1YJ8A 3GDGA 1SC6A 1TEHA 4F3YA 1PL8A 3BMCA 1KVUA 1T24A 3DXFA 5BNTA 5JAIA 3I83A 4BVAA 4NDNE 1I3MA 3NV9A 2QRLA 2VYVA 4KOAA 2I3AA 4XB1A 2HDHA 2JL1A 4E2YA 4MVJP 4XJSA 2WE7A 4RORA 4CJXA 3ZV4A 3GOHA 3Q9UA 3VVCA 4BNNA 4I08A 1DAPA 2Z5LA 3TDKA 3IC5A 4WOJA 3ZCXA 5G0SA 4ZQHA 4C4OA 1O5IA 4NHEA 5K6AC 5I9NA 3ETGA 1S6YA 1KVTA 1CJCA 1GL3A 2FN7A 2ZCVA 3C24A 3TJRA 1I0ZA 4CMHA 3QW2A 4FSHA 4CMIB 1ISJA 1E1MA 2BGLA 3OJOA 1B2LA 5I7EA 1UUFA 4BNYA 4PRLA 1UDCA 2YV2A 1SO8A 3DZHA 4JNKA 3MEQA 1ZW1A 3IL2A 2A9FA 4S3MA 5A06A 1WW8A 4RVHA 3V8BA 4XDZA 3AW9A 1M76A 1IE3A 4FFMA 1MC5A 3JQ9C 5JO9A 1XGKA 2YFHA 2B5WA 2C59A 3H9UA 4GSKA 3F5QA 3LYLA 4F46A 1CQIA 5L4NA 1IYZA 1Y8QA 3NX4A 4JGBA 1E7SA 2WYUA 4MVJG 1DIRA 5T6BA 5EN4A 4J1NA 1L7DA 1PJCA 2VHZA 2HAEA 3IAHA 3R3SA 1C1XB 3GGPA 1NQAO 1HE4A 1GV1A 1K0UA 2G0TA 2ZKLA 1O94A 3D1LA 4IIUA 3ZNNA 1GCUA 2C07A 2JFFA 3RKUA 1DXYA 2X5KO 3GUYA 2GN4A 4IQGA 4ZQFA 4AJEA 2JFHA 4YJDA 3KLMX 4N5NA 1K6XA 1BDBA 3GPIA 3WGGA 3K92A 4PVCA 1DJQA 2NSDA 2VT3A 3ITDA 4L0QA 2B5VA 4BKQA 2HMSA 3HG7A 4DA9A 2PD6A 2JD2A 3P2YA 2AQ8A 3L4BC 3TZKA 2QZZA 4P4LA 3EGOA 4JBGA 5AQ1A 2C7VA 1Q0HA 2Q1SA 4FFLA 4H3VA 4MVJA 4ZQBA 4E5YA 3TZCA 4L4RA 3WWZA 4DMLA 1T4BA 1NWCA 3KLPX 1AGNA 1I01A 4MVJI 1TT5B 3JTMA 4TKMA 1B8UA 1HDXA 1UZNA 1EBFA 3IP1A 4XJTA 1GQ2A 3K30A 5A9TA 3WDSA 1K2WA 1DB3A 4HFNA 4QO7A 2FRDA 4D41A 3HJAA 3INGA 1DIHA 1LC3A 2W2LD 1FMCA 2HMTA 2Y1GA 1LDNA 4CM7A 1XEAA 4R41A 3EZYA 2QRJA 4TKLA 2BGMA 2JAHA 3KTDA 4CR8A 1QV6A 3N7UA 4TRRA 3I6QA 5G0WA 4D0RA 3GNTA 2CVZA 3NT4A 5L9AA 3RJ9A 4YAJA 3AY7A 1U28A 2GZ3A 4FJ1A 5BNFA 4D42A 1A71A 1PJQA 4OMUA 1YONA 3VPFA 3KYCB 1DIGA 1YQDA 2VZ0A 3ZWBA 4K1LA 3UICA 3MOIA 3TWOA 1P1HA 1Z7BA 5ADHA 3E1KA 3HDYA 5KJEA 1SB8A 5JMWA 1LJ8A 1OFGA 5L4SA 2IZ1A 2Y66A 5BSGA 3GHYA 1ONNA 4NBWA 2B37A 1DPGA 3GFBA 5G2OA 4CMAA 2A4KA 3WB9A 4E21A 1VI2A 4MOWA 2FMUA 2PTGA 1ZKMA 4PRKA 4J0EA 1ZK0A 3MWEB 1PWXA 1PWZA 1YRLA 4B4WA 3WQRA 3M1AA 1D4FA 4YT4A 1RJWA 3PFFA 4LK3A 2ZTVA 4FPXA 4GWGA 2WD7B 4GMFA 4RVGA 2GD1O 4BMVA 3MJTA 1H6AA 3AFMA 4ALLA 1PJ3A 2AMFA 1U8FO 3Q1LA 4TZTA 1E5LA 4DREA 2G17A 2NU9A 4BB6A 3KO8A 1T26A 3TZHA 4GH5A 3WGHA 1YVEI 3OA0A 2Z1NA 4QSMA 4Z3KA 4J1QA 4NJOA 3IP3A 4YR9A 4IS2A 3PZBA 5FF9A 4R1NA 5CDSA 3AY6A 3OSUA 4Q3AA 1F06A 4GBJA 3V1TC 3S2EA 4ZJUA 3GK3A 4YJFB 4BGVA 3VTZA 2AEJA 3HE3A 1N7HA 4I9NA 3VH2A 3FWNA 1SOWA 4NJMA 2JHGA 2X0JA 4L4SA 1YXMA 2W4QA 3AI2A 1K6IA 4ALNA 3BMOA 3ASVA 1H5QA 2QYTA 4PLYA 5EL0A 4B3IA 2F00A 4RJTA 2NVWA 2EERA 3CH6A 2D0IA 4ZD6A 3RD5A 1SCUA 4A73A 3DTTA 3LF2A 3ZW9A 1Y9AA 3A14A 2UV8A 4DLLA 3OA2A 2DTXA 3PGXA 2HJSA 2Y0DA 5IDYA 4BNGA 4I5GA 2Q2QA 4JCOA 4ND2A 3NJ8A 3VHRA 1Z74A 4G2NA 1O9BA 1Z73A 2UUOA 3PIDA 4R1UA 1XIVA 4YYZA 5B4VA 1T2DA 2NVUA 5A4DA 2IEBA 4HFMA 1C0KA 1P31A 2W2LA 3H5RA 3K6JA 5U1PA 2Q2VA 1PQUA 1OC2A 3M2PA 1UAYA 4CUJA 2P5UA 2PGJA 1TXGA 5T57A 4AJJA 3I9MA 3IQDB 3QIVA 4B3HA 1J0XO 2DBQA 1C0IA 2P5YA 4RDHA 1VJTA 4CV3A 4XR4A 5L40A 3WMWA 3ZU2A 2LDBA 4UUOA 1AUPA 2QZ9A 1WP4A 1ZSYA 1ZXBA 3ULKA 4UUNA 5I8WA 4D7AA 3WJAA 3RUHA 2VNAA 1NNUA 1D1SA 3EVNA 4RO0A 2VUUA 4JBIA 3U4DA 1N1EA 3GAFA 1R0SA 3EHEA 1JWAB 2RHCA 3ZH2A 3NDJA 2AQKA 2DUUA 2OP1A 1BXGB 3GHHA 2VHYA 4Y9DA 1GZ4A 2CUKA 3MWDB 1N9GB 2ILTA 5JAQA 3RFTA 3ZW8A 2GN6A 4XQEA 1FF9A 3MZ0A 5HM8A 5F1OA 4H7PA 2VCYA 2D3TA 4XQCA 2J3KA 1WVGA 3L9WA 3S55A 5CDYA 2A94A 3JQAA 4P4GA 2O23A 2FSSA 3EY4A 3DZFA 3LQFA 3PQFA 4R51A 3DDNA 3GF4A 3ETEA 3ZHYA 1WXDA 4BNLA 1Y1PA 3WYCA 2C7GA 1DFIA 1O0SA 4Q9NA 3KSUA 4M87A 1R37A 5LDHA 2IDZA 4N5LA 3HB4X 2O3TA 5I9LA 4LISA 4OSOA 3OIDA 2Q49A 3ADOA 3DBHB 1KY5A 1P1RA 4HFJA 4DIBA 2FR1A 1PGJA 3M2TA 2ZTMA 5A05A 1HE3A 4I8XA 1YO6A 1N1GA 5IZCA 5G4LA 1YOVB 2Q46A 3DB2A 3B1FA 4CR6A 9LDBA 4XQGA 3L0DA 4RF3A 5J23A 2Q45A 2WM3A 4GPD1 4C7KA 5KKCA 2HK9A 3BXXA 1I8TA 4CM4B 1DJNA 3I4FA 4J6FA 4JROA 6LDHA 3DZGA 1VRWA 5AYVA 4GKBA 1RYDA 4Z9FA 3EC7A 4AJ4A 1FDTA 3RVDA 3F1KA 4B4VA 4YAGA 4MO2A 1M67A 4D0SA 3JQAB 2D5AA 2Y68A 3LT0A 2Z1MA 4PZEA 3OF2A 2VRCD 2ZK7A 1I3NA 2RIRA 4R9SA 1C1DB 2GASA 3JYLA 3T7EA 3DBRA 4OL9A 4RF2A 1B8PA 5EESA 1F0YA 1SEVA 4WUVA 1ULSA 4F6LA 5JO0A 2PKQP 2CDAA 4YRAA 5IDQA 1ADBA 2WDZA 2EP7A 3AUAA 3SJUA 1DC4A 4KTVE 3JQGB 3PJFA 1P1FA 1Z82A 4QQRA 4DXHA 4NG5A 3MJ4A 1NM5A 3L4BA 5AXCA 1ONPA 1HE5A 1JVBA 1JLLA 2VRBA 4NMHA 1KEUA 4GL4A 4WPGA 4Z0PA 3JV7A 4HP8A 4A0SA 1B0AA 2PGLA 3JQGA 2OO5A 3RUIA 3VZRA 3ZV5A 5CG2A 1RM4A 4EITA 1NP3A 1DOHA 1NQ5A 2DFDA 1I36A 4I1IA 1NYTA 4XYGA 2B69A 4W4TA 4TSKA 5C7LO 3SLGA 1HSOA 4FQ8A 3DONA 1ZFNA 4AJPA 4JK3A 1HLDA 1HZZA 3JD0A 4M54A 2XXJA 1E92A 3ROQA 3BYZA 3LLSA 3GNSA 3TRIA 4DIFA 1JAXA 1L1FA 1NXQA 4MKZA 4OXNA 1Y5MA 2Q4BA 3AU8A 1NPDA 1JKIA 3ANLA 1ZIDA 3D4NA 5THKA 3OETA 5TNXA 2PZMA 4Q3NA 5JPIA 4E5KA 1PR9A 2ZB7A 3G1UA 4EEXA 3JYNA 3V5NA 1U2DA 2GZ1A 1LLQA 1PQWA 4CM4A 3BAZA 4BGIA 1I32A 2V6FA 4IZIA 3WGQA 4BS9A 2O3SA 3WTBA 2B0JA 2ZJ1A 3KOUA 3N74A 2GRAA 3I1JA 4HBGA 2H6EA 4XD2A 2C54A 1PU2A 2R00C 4R54A 4RPLA 2CF6A 4WNCA 4IGEA 1T4DA 3DBHA 4N7RA 3M6IA 3TFOA 4ALMA 3R6DA 4MKRA 5B4UA 3VTFA 1X1EA 4CLOB 3I6IA 4OYRA 1FDWA 1VC2A 3CE6A 1NWHA 1WMAA 1ORRA 5JAMA 4RZIA 4MP8A 3BZUA 4AFNA 4TVOA 5I7FA 3EAGA 1IOLA 1ADGA 2Q4EA 4LCEA 2I67A 3ZWNA 4CL8A 3ORFA 4Y67A 1M6WA 3GDFA 4FBGA 4CR7A 1YB4A 2OGUA 3UCXA 1R4MB 3ZV3A 1XQ6A 4YJGB 1MV8A 4OSPA 3FD8A 2PFGA 4LSMA 5AXAA 2O7SA 2WD7A 5IG2A 3D7LA 4J1TA 3IIEA 2NTJA 4YEDA 4FOSA 3DZBA 5LDGA 3WX0A 4QX6A 2GR9A 3HDJA 4PG6A 4U8GA 3SVTA 4BGUA 2JCXA 5G0UA 1DHRA 4B7UA 3FR8A 3PYXA 5CDUA 4RZHA 3E9QA 3ZWWA 4GVXA 4II2A 3ASUA 3LC7O 1UAGA 2W90A 1LEHA 4RVUA 4R1SA 3ZU3A 1CDOA 4GX0A 3HFSA 2WE8A 2JFGA 3VZPA 4NU5A 2P9EA 1PGOA 4HXYA 1ZO8A 5FFFA 3F3SA 3PQEA 4CV0A 2J5QA 1NAHA 5JYEA 4ZICA 4RDIA 1LDEA 5EERA 5ER6A 3WGIA 2XPCA 5F1PA 1E7YA 5EQDA 1A7KA 2XOXA 1CQJA 1CEQA 2DM6A 3U4HA 1R15A 2OBNA 3RAJA 3H2SA 5B12A 2HKIA 4DQVA 3LT2A 1GYRA 1LQTA 4KTTE 5U9CA 1QYDA 3UW3A 3IUPA 4BQPA 2OP0A 1TB4A 1P1IA 1WWKA 3D64A 2YV3A 4Q3DA 5CP8A 4BB5A 1GEGA 5KJFA 2X5JO 5KIAA 1EEHA 1DRUA 1GCOA 4O0LA 4KUHA 4IDBA 4GX1A 4XYMA 5CDGA 1PGPA 4BO2A 4B4OA 3PXXA 5GZ6A 3S2GA 3FF4A 4PCVA 1I24A 4WCFA 2E6UX 3G17A 3JQEA 4BNIA 1ZJYA 3P5SA 4IM7A 2DC1A 1HDOA 2IXBA 1U4OA 3JQ6A 5BSEA 2QHXA 5TT1A 5A3JA 1XQ1A 3KETA 3QP9A 3C1TA 4W82A 3LK7A 4J7CA 4DL9A 3WSVA 3UOGA 3ONDA 1C0LA 1KOLA 2DAPA 2YDYA 1HYEA 3KYDA 4BO5A 1UZMA 3H8VA 1GZ6A 3DOCA 4JQCA 1NVMB 3KV3O 4L76A 5G4KA 5TIIA 4PG5A 4MVJE 4GLOA 3DO5A 3DHEA 1X7HA 5TJHA 5C5IA 1JN0A 1YBMA 1UZLA 3QQPA 4BNFA 3EDMA 3PLNA 4DPMA 4A10A 2ZTUA 4YDRA 3PDUA 4AICA 3DFZA 4P8RA 3B1KA 2ZQYA 4E4YA 2B4TO 3DQPA 3K9QO 4UEOA 5CAEA 1PIWA 1PX0A 3ROMA 4E5MA 5B37A 4B4UA 1M75A 2HSDA 3T4XA 4YRBA 1KS9A 2QQ5A 1N92A 1XWFA 3CSDA 5L3ZA 4BOYA 2E49A 5DCWA 2EJWA 3PGJA 8LDHA 3GDOA 3K2BA 2BFAA 1E3SA 1R4NA 3MCVA 5DNAA 1VKNA 3JYOA 1GAEO 2FR0A 3H5AA 3DMYA 3PHLA 5COBA 3V2UA 1N5DA 5ER9A 4BNMA 2HO5A 2X8LA 1QORA 4ALJA 1U2GA 4U7WA 3ADPA 2VOEA 2DT5A 2DVMA 1R12A 1G0OA 3UAGA 3TZ6A 2BGKA 4PIVA 1KVSA 4XCVA 2CMDA 1ZK3A 2GN9A 4F45A 2BHLA 4GAEA 3D3WA 5LC1A 5TLSA 4TRMA 5F5NA 3ZWPA 1MXHA 3R3JA 3KSZO 2WD8A 3PHIA 4RLHA 1F8GA 5F21A 3INTA 4NBUA 4D79A 3JQFA 4BNWA 3W4JA 4JP3A 3ANNA 3QA9A 4HKTA 1R4NB 3JD4A 4NK5A 5JDIC 2ZYAA 3S2FA 5L51A 5JFOA 2EKPA 3GMSA 3KVOA 3PTZA 4DPLA 4IDFA 5IXSA 2GLXA 3WGYA 2I66A 3E82A 3ZWVA 3K31A 3RROA 2E48A 4RPGA 4Y8VA 1TVEA 3CPSA 4XYEA 4IDGA 3S2IA 3FNFA 3JD3A 4I9HA 2JJYA 5JAZA 1NR1A 5BSHA 3INRA 4P38A 1T2EA 1QLHA 3AOEA 1PS9A 1W8DA 1X15A 3NGLA 4BO1A 4NBVA 3LDHA 4XIYA 1KERA 1R6DA 1MUUA 4B79A 3HHPA 4KQWA 1DRWA 5DOZA 3HDQA 1A9YA 1PJSA 3COSA 4CMKA 3PDJA 1P3DA 3ENKA 4NFYA 5MDHA 4WCFC 4XRGA 4RVFA 3UGKA 1TA4A 3UH1A 4J1SA 2V6MA 2DQ4A 3CTMA 5KJ1A 4DIOA 4HX5A 3KZVA 4P22A 4L75A 5HS6A 1EUDA 1PL6A 2Q2WA 1P77A 2FZEA 5L7TA 4ZVVA 3DMTA 1Y5RA 4YB8A 2GUGA 2HK7A 2HUNA 2OBYA 1A4IA 3I9LA 2Y0CA 2YFQA 2EIHA 5ES3A 4E32A 2NM0A 1DAOA 3DL2A 1GZ3A 3E5MA 5TJ9A 1PZEA 3O26A 1ISIA 1BXKA 3LLVA 3GUCA 3OQ1A 3IKTA 5DF1A 1ONOA 4NBRA 1LNQA 3AM3A 2RBEA 1BRMA 1ZEMA 3GVPA 3ENNA 3LZ6A 4U0KA 2CFCA 4BHTA 1NBOA 1E6WA 3F1LA 3LT4A 3W8DA 3ZWOA 3U4IA 1U9JA 1UJMA 2OFPA 4JN6B 5I9MA 3GZ4A 2VTEA 4GGOA 4OKNA 4PLZA 2O50A 3H9GA 3JQBA 5GY7A 1H0KA 3H65A 1QXSA 1ZEJA 5TGDA 1VJ0A 4QXMA 5TF4A 1QYWA 2GNAA 3WFJA 4DQXA 3NJ4A 3MTJA 3GZNA 3WGOA 1X7DA 1FDVA 1YH3A 2PD3A 1VL0A 1YQXA 1YS4A 3PJDA 4FJ2A 4W9NA 4BUCA 3NTOA 1B14A 5JY6A 4JJGA 1HL3A 1M6HA 1AE1A 3C1AA 1L7EA 2YUTA 1Y8QB 2AA3A 2EW8A 1JKJA 2CVOA 2BFOA 4FC7A 3ZN2A 3KRTA 4PZDA 4L9RA 4NFHA 4PLTA 3IKVA 1XCBA 1Q2XA 4MPDA 2GCGA 5IN4A 2WYVA 1WMBA 2NLOA 4BNKA 4MINA 4FW8A 5JMPA 2QW8A 1DIAA 1CF2O 3JQFC 3WS7A 4Z6KA 1J49A 1E7MA 2NUAA 2P4QA 2PH5A 4OAQA 4LMRA 2GYYA 1GEEA 2GZ2A 2AEMA 4OXYA 2B35A 1D1TA 1OC4A 1GY8A 5COAA 1ULUA 4RV9A 4UVHA 3CIFA 3VAZA 3CZMA 3RCBA 5BNIA 1R0LA 3O9ZA 3PLRA 4NR0A 1BXZA 3W8EA 4CQMB 2HLPA 3WIDA 1XA0A 2VYVD 2O3RA 4WGGA 2Y1EA 1PGNA 2AEFA 2VZ9A 1LDMA 1Y8RA 4GLLA 4BGEA 2EEZA 1EDOA 4M8SA 4UAGA 3WLEA 3UFXA 1YKFA 1D8AA 5AVOA 5ICMA 4R3NA 3C3XA 2YQ5A 3BHJA 1K3TA 3LC2O 1F12A 1G1AA 2BRUA 2HCTA 2G5CA 4OXKA 3A06A 2PKRA 5JDCA 1H6DA 5CPBA 2UDPA 1DC3A 1ZH8A 1PZGA 4O1MA 5LCXA 5A03A 3JQAD 3PIIA 5ILGA 2QIOA 4WEQA 5CEJA 1OMOA 5JW6A 4EGFA 4NU6A 3WQQA 4D45A 5KJ6A 4J3FA 4LVUA 2RHRA 2C2YA 3UXYA 2G1UA 1BVUA 3O03A 3L6OO 4CODB 5ILOA 2PA3A 2W2KA 1IHYA 4HFRA 2HMUA 3DBRB 5IDXA 3UF0A 2O3JA 4IINA 4D46A 1KC1A 1ZMOA 2GPTA 4JBHA 2YHUA 4RPHA 5T64A 4M89A 2LDXA 2Y1DA 5I8ZA 3JSAA 1IZ9A 2J5RA 2W8ZA 1JAYA 4NBTA 4OKIA 1ISMA 4BNVA 1FDUA 1ZK4A 3TOXA 4BKOA 1C1DA 4CMBA 4CUZA 3WYBA 4W6ZA 4E33A 3IJRA 4R4JA 3CEAA 1O6ZA 3U3XA 2ZQZA 1B3RA 2G76A 3JQCA 4RCVA 4MDHA 4DBZA 3SXPA 1ENPA 3O4RA 3W8FA 5HBRA 1N8KA 3WXBA 4M1QA 1N2SA 1V0JA 1Y6JA 2ZTLA 3E6AA 4R1TA 5JXWA 1CERA 1Y9EA 2E82A 3NGXA 4WASA 1R4MA 3DBLB 2DPHA 1LLCA 4GSLA 1SPXA 4L73A 5DOVA 3D5QA 4FS3A 5A9SB 4LCJA 1VM6A 4BO8A 2VNSA 4QFCA 3RUCA 3VDRA 3WBBA 1DIBA 3LT1A 1ISFA 3RQSA 5CEEA 4BNXA 1E1NA 1DO8A 2NTNA 3RIHA 1QMGA 2A92A 4L8VA 4Q3EA 1PS0A 1ADFA 2VYNA 3I9OA 4YAKA 1QYXA 1GPJA 3VZQA 2O4CA 1GUFA 5EJ2A 2X0RA 3AOGA 1EVYA 2J3HA 4PLGA 3GZNB 1Q7GA 5DP1A 3ANMA 1YL7A 2H1SA 1ZSNA 4HY3A 5C7OO 4HNHA 4N18A 3FSRA 4CQLB 2WMDA 3UCFA 3EW7A 5DBGA 2NNLD 3GPDG 1JWBB 5IZ4A 1NAIA 1PGQA 3TPCA 1HDYA 3JQ7B 1EBUA 5F3RA 2VWGA 4CM6A 1NVGA 3CKYA 3RC9A 3ROKA 4ID9A 1O95A 2PZJA 5HS4A 4R9RA 4A26A 1NHGA 1P0CA 2OUIA 4IPTA 4OQYA 1BVRA 1N9GA 4BIIA 2H9IA 3BHMA 4CLEA 3PHJA 3CUKA 3EZLA 4O63O 3C8MA 4XX0A 4WOKA 3SBOA 4PLCA 1ZK1A 1GYPA 5L7YA 4CMGA 3RBVA 3RFVA 1WDLA 1X14A 2JD0A 1P1JA 4RQTA 1H9BA 1LSJA 1KBZA 4ONEA 1DC6A 2FHSA 2WYWA 4UUMA 4KMSA 5K6AA 3DZJA 1B3BA 2J3IA 3U4CA 4CM9D 1E3WA 4RVDA 2WWRA 4W7IA 1BDMA 1HE2A 1S7CA 4IDEA 3F5SA 4E2WA 1UXKA 4XYBA 1VLLA 1LX6A 3JD2A 2P91A 4AJHA 3ZNOA 2NVBA 3QHAA 4A5OA 7MDHA 4IJVA 3K5PA 4RGBA 3K96A 5IF3A 5A5FA 1GU7A 1RM0A 2IRWA 4CV2A 3BTOA 4KUGA 4M49A 4MKXA 3AWDA 2JAPA 1FDSA 4DQUA 4E2ZA 4WLFA 3BMNA 3TN7A 3H9EO 4EUEA 3ABIA 2PZLA 5ITWA 1DEHA 2VYND 2JHFA 3GRPA 2Y99A 1LLUA 5EMHA 4Q3BA 4WK6A 5HWSA 1EQ2A 4JIGA 3GEDA 1N7GA 1GFSA 4ESOA 2CVQA 1I3KA 1QR6A 1H6BA 2R6JA 1NASA 4ROSA 3T7CA 2IODA 3Q11A 1B7GO 1I10A 3HN2A 1G6KA 2AE2A 5EIOA 4I5DA 3Q6IA 1KEVA 4Z0HO 3FTPA 4LN1A 1F14A 1MX3A 4EJMA 3JQ9A 4HNGA 4CM1A 4JJIA 4AJNA 3IUSA 3HWRA 3H3FA 4LVCA 5G0VA 2NV6A 1P9LA 2ZB3A 6ADHA 3PQDA 3QV1A 2O3UA 3JQ7A 5JYDA 1CRWG 3DFUA 2NVUB 3PWSA 1HKUA 1YL6A 1CYDA 5TQVA 4WEOA 3RUDA 4BMSA 3MOGA 1VSUA 2R2GA 2B36A 1YDEA 2HK8A 1H6CA 1P45A 4TRNA 3D0OA 3GGOA 3HSKA 3G1TA 4D43A 2HRZA 2OOSA 2X9NA 1U7HA 1JQBA 2C5EA 3AFNA 3F4BA 2I5PO 5BR7A 1XYGA 1NPTO 5JCXA 3QVWA 5IN5A 2PD4A 3GVCA 4NI5A 3H7AA 4E31A 2NU8A 5KNLA 2Q3EA 1Z6ZA 4NJMB 1EFLA 3AU9A 3C1OA 1UH5A 1K6JA 1XR3A 5DULA 3GEMA 4Z9XA 1WPQA 3WBFA 3EUWA 5H81A 5ICSA 2POQX 1QG6A 4AJ1A 4YWJA 3GRKA 1HTBA 1A5ZA 1F17A 1YL5A 3FBGA 4W9NC 3DZKA 2X0NA 3VPXA 4AJOA 1K89A 4EI2A 4QECA 1NTOA 1KVRA 5K9ZA 3ICCA 4KWIA 1RYEA 3L07A 3RUEA 1AXGA 4X54A 3U62A 2X9VA 4TRJA 3K2EA 4YJHA 4J91A 5K0ZA 3ZDFA 2RH4A 4FIZA 3ZV6A 2V65A 3OP4A 2EW2A 2YJZA 4DYDA 2GF2A 1X13A 3B6ZA 1HETA 1BHSA 4WLEA 3FI9A 4KWHA 3NT5A 3UVEA 3B1JA 3UKOA 4UUPA 4PG7A 1CWUA 1LC0A 3FRJA 5B4TA 4W99A 1CIVA 3EYWA 4WE3A 4ND5A 2I99A 1UDBA 2Y1FA 2R00A 4PVDA 3RU7A 3WIEA 4DMMA 5JBIA 1IY8A 4FB5A 1NFQA 4PGFA 1MG5A 4J2HA 3U09A 2ZYGA 5A04A 2W98A 2VWPA 1I33A 3GAZA 3OQ6A 1Q0QA 3I9JA 2YV1A 1P33A 2NQ8A 3HADA 3DZIA 4ND3A 4PLVA 2VN8A 1T2CA 1V9LA 4INAA 4RF5A 4CLHA 4UVDA 3UN1A 3F4LA 1SB9A 3IJPA 4LRTB 1HEUA 4IQ8A 3WYEA 3JCZA 3MTGA 5DT9A 3RBXA 2Q1WA 4CUKA 3PWZA 4H16A 3ZU4A 1YGYA 4RF4A 1YQGA 1HDZA 3I23A 4TROA 2P2SA 1ZBQA 1PQPA 1C1XA 1H93A 1NFFA 1U5AA 1HDRA 2GGSA 4AJLA 1E3EA 4D3DA 2I76A 3ZNQA 3DOOA 4CM8A 2AE1A 4JXKA 1AHIA 4Z9YA 3WSWA 5B1YA 3C7CB 2FPPA 2GERA 3VC7A 4AJ2A 1EFKA 4EUFA 1IHXA 2X86A 4PZCA 5DN9A 5JY1A 1U8XX 1Y8RB 1KIFA 2AQIA 3V1UA 1X7GA 3BIOA
chains in the Genus database with same CATH superfamily
1JE1A 5C3UA 3G2IA 3BILA 3WRVA 4UQLA 2WY2D 5FNZA 1HT0A 4ZQCB 1QPGA 1CY1A 1N6RA 1NY6A 5F7XA 4JDUA 5SYMA 1QFXA 3IQIX 2XJ4A 4IWXA 1Z6XA 1BDJA 1SURA 2IYPA 3UTDA 4CMIA 1BH6A 2E1PA 3DP7A 4EPVA 5SV2A 4EH1A 1U3UA 4OP1A 5JV5A 4IJUA 1Y48E 3VMMA 3A37A 3MN1A 3UO8B 1JA1A 3AR3A 1FYVA 3SR0A 1V47A 2AW5A 3L77A 4C7VA 2XRMA 3PL1A 2BJWA 4M8NE 3GJ5A 1E6UA 4AKEA 4KR6A 5JR3A 3JAWB 3KPJA 3LUAA 3L8FA 4F3RA 5DLYA 1K68A 3THRA 2AN9A 1LBEA 2G71A 1SD1A 3QF4A 1ZZGA 3KXIA 3DXYA 3TFQA 1XJWA 2QTCA 4OM8A 2EFJA 3T4PA 3DJYA 2EKDA 1IY1A 1MC8A 2EKBA 3W6ZA 4Y6SA 3SM9A 1TUEA 5ECYA 3DAFA 3RT9A 4YCDA 4ASUA 4QLOA 1HOXA 2R79A 3W2IA 3S1LA 3W1VA 1CEEA 3K0AB 5TF0A 4YCCA 4BQRA 2XVZA 2PWZA 1H3NA 1M66A 2KMLA 4ND6A 3GRVA 1IONA 5GV7A 2ZJOA 4IYRA 1PFKA 1XLWA 4F3NA 4J6EA 1GGMA 3B12A 4ZK6A 4EJ2A 4BWVA 3NDRA 4E46A 2FSGA 3CMCO 3WMXA 2FEXA 4RQUA 2H1OA 1IAQA 3AR2A 3W4KA 1Y0BA 4RHYA 1KSFX 4YRSA 4J0IA 2ECKA 4KO2S 3O82A 4ZVPA 2HT6A 1U4NA 2QMHA 2I9PA 4D9JA 3IBGA 4WNIA 3DEZA 3E9MA 3RYIA 4FJ0A 4ZGBA 3GN2A 1ZRHA 2FZWA 4GI1A 3ZDYB 3IT3A 4V38A 1C7IA 2M1XA 5JANA 3STUA 3RVSA 1C9NA 1GG9A 1XPJA 1YHNA 4M1EA 4A27A 1G9SA 2NSYA 3MJSA 4Q9DA 3GRFA 4HXFB 5B3KA 3AL2A 4W5TA 3VXKA 3OECA 3QUTA 4DLAA 3OLYA 1DS6A 3ZY4A 5I45A 1TGYA 3MWGA 1GUZA 2FSIA 2O14A 1QF6A 3U2QA 1VSVA 3NBQA 1DG9A 5DWQA 1WHSA 2CFRA 1RIIA 3QV2A 5BW4A 2Q0SA 3H11B 2OB2A 2YHIB 4M9XA 1IBRA 1WDMA 3TEJA 4DA6A 4MRMB 1EFCA 4BNHA 2XYGA 4N5HX 2P35A 2IHUA 3JU3A 4GOMD 1S89A 1IDN1 1GT91 3DEIA 3Q1KA 1E1KA 1FX0B 3RT1A 3NYQA 2JH3A 4OHXA 3A4VA 4NAUA 5HF9A 4NWIA 4DDTA 1QHHA 1OI7A 2V97A 3NM5A 1K9VF 1EUCA 4TZKA 2GEKA 2QGZA 3GA7A 3KEGA 3N0VA 3VZDA 1Y3CE 3MJDA 5KNCD 3ZDEA 5HF5A 4P3OA 3TD9A 3VKVA 3QPVA 1CDEA 2GCEA 3R1IA 3ZHCA 2VF5X 2QNBA 1HXHA 1X7ZA 3CW8X 4IRMA 4CU2A 1XXHE 3TLCA 1QHXA 1J6UA 1H9CA 1XTVA 3HWX1 4DEYA 4E6PA 2XA9A 3KB8A 4JWKA 4MIOA 5GJCA 3HPRA 4RCZA 2IEZA 3PGKA 1JR4A 1EUDB 3IMFA 1QP0A 2JFNA 2YQ4A 3V4OA 1HV8A 3QXXA 1C7JA 1GUBA 3FFAA 3PC8C 1XCGB 3H2ZA 1WLYA 4HGZA 5ALSA 3OUZA 2QAGA 4ZO8A 2XMQA 4AECA 5LIPA 1RKXA 4LDNA 4DARA 2JVJA 4OUKX 3I9NA 4ZA2A 3L0SA 4JUCA 1XKQA 4F4UA 5K8LA 4PFJA 4YAOA 3QVXA 2PSJA 1XCJA 4YPOA 3NRCA 4UE2A 4E2FA 1Z68A 2GSDA 3Q2KA 1AMNA 2ZRMA 2BRUC 2IEGA 4G01B 5AXDA 3VYVA 2XTJA 3IAFA 4K9OA 2ID4A 4LHEA 1N6OA 2C5SA 3I39X 3ITNA 1YI8A 3LW7A 5FWXB 1E6MA 3PFHA 4RM3A 4TYNA 1OXTA 1PFGA 4MZXA 3O1LA 3G2JA 4IILA 4TWRA 2SBTA 4PXSA 2R8PA 5JEDA 1JHRA 1ZM4A 2NO9A 3AY3A 3H6KA 4HEJA 3NHRA 3A05A 3B51X 3NTRA 5DXFA 3R9IA 4WK2B 1GYQA 1TK3A 2JVIA 1MPTA 4CG0A 1CD5A 4ZP1A 5DX1A 1G20B 4H7DA 2QI9C 3W5CA 1WSAA 2QD2A 2R84A 5EMNA 4AX4A 4JLKA 1PBTA 2W6OA 3OFKA 4CGYA 4DTCA 3C3PA 3UK0A 1SQ6A 5LQKA 4CPDA 3G13A 5EKDA 2VYQA 2UXCB 4K40A 2XTMA 2EQBA 3U1VA 1OXVA 2BUBA 2V5UA 2H1IA 3E7DA 3RWOA 2VHVA 1OWOA 4D74A 4LJKA 4J7UA 5AKIA 4FXOA 3DWFA 1VRVA 3H75A 1W5BA 3NO4A 4TT8A 1NMYA 2PH1A 2NO6A 2Y3IA 2X3UA 4XDYA 1ENZA 1U2TA 2JFVA 2YHIA 5CPFA 3AEQA 2XLBA 3Q85A 5F3DA 2AJBA 1Y1QA 2DBVO 3PC6A 3K20A 4IV5A 1ZINA 1XEWY 4US0R 1U3DA 3E7PA 2EWMA 3IPLA 1EGAA 2R6DA 4B3TB 4D4GA 1XC7A 2IZZA 3U13A 3GJYA 2RHTA 1NF8A 2BGNA 3GY0A 1PJAA 4Y9SA 4M1OA 4UBKA 3FKSA 3P32A 5E6UB 3VU8A 3U6BA 1KGDA 1U02A 2BGWA 3AHHA 1SXGA 3GRCA 3OCUA 2ZJYA 4LSWA 1FXSA 3IVXA 5DZSA 3G79A 3OM8A 4JA0A 3Q0TA 1J8VA 3IDSA 3GFGA 5G4KB 1JUDA 4MWDA 1B8NA 3FGZA 4IIGA 2ZRGA 1G21B 4IDAA 1N5KA 3DVQX 3WNBA 1W34A 2NYRA 4HH4A 2CHQA 1E2QA 2VQEB 4MQEA 5D85A 2W0SA 2H7CA 2W2QA 4DLZA 2TMDA 5EJ9A 3QTLA 1SIBE 4YQZA 2A9OA 3AM5A 4IQ0A 4HR7A 3ER9A 3VDNB 3S0JA 5IAOA 3KQPA 3C4QA 5I7AA 4RA9B 3HO8A 1T2AA 4KBYA 2DUWA 2ET6A 3QWBA 3VBCA 4F9FA 3ENQA 1VCMA 1A1SA 4G25A 2QJRA 3FTFA 3N2GA 2P9ZA 4ZVUA 3IMCA 3V7UA 4DHEA 5IKPA 1XTQA 2DEUA 3H99A 3HXLA 4MMZB 2K2WA 1QWOA 3EMDA 4RY2A 1V45E 2XMBA 1RC1A 1R88A 4JI2B 4ZK2A 1FMJA 1EM6A 2XDWA 3MJVA 4CLOA 2ECFA 1J9EA 2FPUA 1PKEA 3A1TA 3ANYB 5FD8A 3I2KA 1NMEA 2NTVA 5BUCA 5JNTA 3RYTC 2HCRA 4PYRA 3SLKA 3VR2D 3PB3A 4NG4A 1UBLS 3ZHTA 4CW7A 4XIGS 4EYEA 2ZB4A 3IS3A 5EWMB 5KVCA 1ZOIA 4XWYA 1J5XA 1WKBA 4LDQA 3O4IA 1PNRA 4QEDA 1NBEA 4H7EA 4IY1A 1W5FA 2PQ2A 1YB5A 1UJNA 2F8LA 4OJQA 2JBAA 5IULC 2DP4E 1SBYA 2G9ZA 2JA2A 4ND7A 3L0PA 3RUAA 4IEFB 3HRHA 5U4XA 5JS6A 3B48A 4M55A 4RHEA 3GLQA 4KWEA 1PJLA 2QUKA 3OCCA 1NVDA 1PZHA 4P2GA 4QVKA 2QN9A 3V8VA 3G9ZA 3GNQA 3T5PA 3OPMA 4MJXA 3DV2A 3HYRA 2ORVA 3P20A 1VL8A 4H18A 2IBMA 2XE8A 2YIJA 5AKYA 2HRBA 5IW8A 5KYTA 4DMUB 4BFTA 3R0QA 2HLHA 4YT2A 4DV2B 2W2KB 4RSRA 4F2PA 3LP8A 5CDTA 3HPQA 3ND5A 3PUXA 5ABPA 2BGUA 2JI9A 1XHLA 4MW2A 3A7DA 4F4HA 3LBFA 1A4RA 4JP8A 3I4CA 3GGDA 2YW9A 3LO5A 3KBBA 5C52B 1V8BA 2N46A 4MR9B 2C2ZA 3IOMA 1RDFA 1YE3A 4UBLA 1DJMA 2DQKA 1R18A 4CEJA 1A9ZA 1FDOA 2CNWD 3SEFA 3RVNA 2HWXA 2QORA 3IMKA 4C4AA 4D6YA 4DR5B 5HKOA 3RG8A 3HDHA 5AI0A 2VWHA 2W5UA 2FXVA 4OQEA 5ITZA 3NIGB 4U2FA 1ZUIA 2PLAA 1CUYA 4MV6A 5CRIA 5J5VA 4HEQA 4PNPA 2F3TA 5CJ2A 2C88A 2YYZA 5FA8A 1BGVA 1JHZA 3MS4A 2IEDA 4QREA 4BO3A 4P3YA 4EX7A 3CRZA 4Z4QA 5IKEA 4RDXA 1O4VA 4HB3A 3V2GA 4RGQA 5A4FS 1JPNA 2JPDA 2J9XB 3M6XA 3OBBA 4HAXA 4JC0A 1XJCA 2ZDGA 5IVPA 2V4UA 4L08A 2IS2A 2DPLA 3DKPA 4C6HA 5CMLA 3QNMA 1QBKC 3L05A 4WHMA 2Q6IA 1E3DA 1NVBA 3IAM6 3AETA 4O59O 4K9DA 1UM9A 4EGSA 3C74A 1GPNA 2XYHA 1J8DA 2A9VA 2E1RA 3TMKA 1EDEA 2QYOA 4CM3A 4K9RA 2YYSA 1CUWA 2F59A 2PZ8A 1HYBA 1X2BA 3ET4A 4UMDA 4AG6A 5K8TA 5L4LA 3PDIB 4NV1A 3TW6A 3E5NA 4CMEA 3IIJA 4G1VA 4FT4A 4DC0A 2EFHB 2JJ1D 1GCAA 4K05A 2X76A 3TAHA 3X2SA 1BU5A 2PGDA 4FM9A 4EYOA 4F1KA 4B1FA 4Z3DA 4C0SA 4O2AB 1DOAA 1YRAA 2H17A 3B78A 4UNRA 4EBBA 3G23A 4PEVA 3S4YA 1Q22A 1AGPA 3TI9A 1IIBA 3F47A 1T3SA 2XZTA 3KJEA 4KQJA 8MHTA 3EFEA 4EATA 2YV5A 1JEOA 1BFUA 3N7TA 1ABBA 3BA1A 3VR4H 4DDMA 3W3ZB 3WZMA 1RPNA 3ZQ4A 1SHUX 3DHYA 3M33A 4OOEA 4N65A 4G4SO 4PYLA 5ALNA 5C3MA 4QFMA 2AD5A 3ZDZB 4AUKA 3QOFA 4AVYA 2FAXA 4E3ZA 5HRUA 1RCUA 2Q99A 5GVSA 1VCOA 2ZIZA 1QCCA 3HUDA 3P0IA 4HK4A 5BN5B 5J2TF 3SNKA 1FP6A 3UATA 3MFYA 4HNTA 3DDWA 2AR7A 3K1YA 4INZA 2FMKA 3JRNA 5B7QA 2A9KA 2HNBA 2IF0A 3DAPA 4FFNA 4EG0A 3R8FA 1QVWA 1Z5PA 3O8QA 1J56A 3GQBB 4JJFA 3A4NA 3G8BA 3QWIA 4HL6A 4M9CA 4FE3A 4ZAGA 3RKSA 1KARA 1VL5A 2XNJA 4MQ5A 4E03A 4EUHA 2VP5A 2OQ2A 4IVRA 4MWTA 2PRKA 1L5KA 3VYWA 2O8EA 4W5NA 3RTEA 3BQ9A 3TNLA 1F8YA 1P2TA 1T9GS 2FRXA 2Z95A 4H6WA 1CRZA 4K9QA 4BC1A 1JDZA 1DP4A 2G72A 1NR5A 4IXMA 5BSWA 3L43A 2BZ0A 1RBMA 1V7CA 3CKMA 5ENDA 3ZCSA 5FWYB 2HDOA 1QQBA 3GFPA 2CC2A 4TMVA 1TMKA 2VPIA 3FH0A 1EA5A 1XELA 5HIKA 2GAJA 3NYWA 1HWYA 4IH4A 4YV2A 2P2NA 3T3PB 2YYAA 1JV2B 1M2WA 2JJ2D 2H57A 3C5VA 3HNPA 3Q2IA 4IP0A 4B7XA 1DDGA 1OIXA 1IWBB 2CB9A 2QAIA 4P58A 5EJ8A 1DNPA 4DAEA 2NZJA 3FPSA 1P29A 4H3SA 3CZQA 1RJ9B 4S1PA 2XXAA 1X3LA 2QM8A 3IDZA 3OTIA 3QE3A 1GV0A 1A98A 3CX6A 1NT4A 4KDFA 1OFTA 2PR2A 2ANBA 3EIQA 3KDPA 5FOWA 5J5CA 2WFZA 3IUJA 3FW1A 4FC6A 2W6NA 4A0FA 4WXEA 1NW9B 2VT2A 2EXXA 1JNYA 5EWMA 3ROPA 3MIIA 4AI6A 4EEZA 1H4QA 3PFGA 4FN4A 4RH1A 3QJ5A 4PIPA 1AO3A 3ZU5A 2O2SA 2XMDA 1ZZEA 2W6JA 2XYRA 2X5OA 3BRSA 3ZWCA 1TIBA 1D4ZA 4CF7A 2G1PA 1AY0A 2VJBA 3FYSA 3DAGA 3FCAA 3UBTA 3ZJYA 1MHTA 1NMXA 4XWTA 4IIDA 4QFDA 2I7CA 3TZEA 3FKSD 3O7WA 5IT4A 3NHWA 4GVLA 1DAKA 2I62A 4UARA 3ZWAA 1NQTA 1C3OA 2JIZD 3BXOA 4UCXA 1DGQA 5CX4A 4D9FA 1G5HA 4IHAA 3W9UA 4CKZA 1QYVA 1R4ZA 3JVUA 4OK3A 2D5IA 1F5NA 5AICA 1XVLA 2JLBA 2XWBF 2Z58A 2CLHB 1JVSA 3CZRA 4JKOA 3H4MA 3V4SA 1ID8A 1U4SA 2HZ7A 2X42A 4S24A 3D7SA 2C7OA 5BWBA 2HQSA 2DWOA 1GQQA 1XU9A 4JFRA 3UXEA 4TLCA 4CQMD 1LLDA 1ZAKA 3CT6A 3MTBA 3CB2A 1CJSA 2AYZA 4V24A 2B82A 3RSQA 3TTYA 1UP6A 4Q82A 1H2BA 2QWXA 2QN3A 2UYOA 2P0EA 4FQ5A 2O06A 2PCJA 3LHSA 1C81A 4UAUA 4XUDA 1FBNA 1DELA 4M9RA 5B1HA 4ZGWA 4KFTA 4HADA 2WG0A 2XQGA 4MW5A 5HM6A 3MELA 4LGYA 3H3JA 4Q3CA 1Q57A 2WUVA 3QVLA 3R3UA 4F56A 4BEWA 3GQVA 4FOLA 1BXGA 3TNJA 3UBMA 2P9BA 3WIVA 1XZKA 1R9JA 2AG8A 3G0GA 5FOTA 3GJ4A 2XF8A 1QDEA 4M21A 4CQLA 1ZL2A 2WG1A 3UMCA 2IS6A 2C5LA 2D8MA 4HGYA 1WCIA 2BP7A 3E9DA 3FN4A 3A9WA 3IKJA 3DEKA 2YVQA 4PFKA 4UHKA 5ENVA 4B47A 4F5WA 3DOUA 4F96A 3WB1A 3FOZA 2NXNA 3KKPA 3IEVA 1HDEA 1YR1A 1KXJA 2OZLA 5ALRA 3UHAA 3WYAA 4LOLA 1JDBB 4KN6A 5HKBA 2G5PA 3U6KA 4J43A 1U2QA 4X1IB 3RK0A 5CB4F 1C8BA 3VNAA 3B13B 4RPJA 4B5LA 1W0KA 1MAAA 4JT8A 2EHDA 5E7MA 1JBKA 3THYA 2A7XA 1HRDA 3GGGA 3WADA 1KY4A 1ZVJA 4WKGA 1A96A 2GBFA 3R5TA 1QU3A 2H9AA 1B00A 3IJEB 4OH1A 3NUGA 2QM3A 3MT7A 4P9NA 4B85A 5A5EA 3NHUA 1AKEA 4Q48A 2I6QA 3RQIA 2WKPA 1Q84A 5EWLA 3SR3A 3ZCVA 5LYJF 1P5HA 2P9CA 2H92A 1OLOA 4TTIA 5FOVA 1EFRD 1FS5A 1V3TA 3HBMA 1JHXA 1Z6PA 2D06A 1XD8A 3T7IA 2Z08A 5CLLA 4IL5A 5BT9A 3L1KA 2X7HA 3EDYA 3RLIA 4J90A 3OOJA 4AY6A 2MSEB 2OORC 1Z2CA 4BJ3A 5KTSA 2W8BA 1LSSA 1TUBA 4IXTA 4ZVRA 3A9RA 1I4DD 3DGEC 3AK4A 1R0CA 2DHDA 2IOFK 2V6BA 2VAVA 3ZKWA 4KRYA 2YXNA 3DE1X 3QMWA 1E2NA 4RXUA 1FB5A 2QX7A 2WLTA 3GPLA 3R3VA 2ZAIA 2ZB8A 3EVTA 3LBYA 4R68A 4BLWA 1IZ7A 2D5CA 1RHUA 5T7BA 2F4VB 2CD9A 3OIGA 3U5TA 1N2CE 2OEPA 2QMQA 2WV9A 1QGED 3E03A 3EDOA 3KZCA 5TGTA 3SDBA 3WA6A 1XEFA 1RW4A 5EXTA 1T8YA 3LO8A 1HDIA 1Z34A 2HF8A 3C15C 5H70A 3A2KA 3CVUA 3WGKA 2D1YA 1RHRA 3CT4A 1QVRA 2Q07A 2X2EA 2WF6A 3IEUA 3MAJA 3Q5DA 4NPHA 2V98A 2GRJA 4BN0A 2UYGA 4QBHA 2HV8A 4UZSA 2WTXA 3V32A 1WMEA 1KFEB 3V2HA 4LY6A 3A25A 1COWD 3IULA 4RK5A 4D26A 3VR4D 1J97A 2CZCA 4J9VA 1C5KA 1SCBA 4RH3A 3OJWA 2XUZA 1NPYA 2BZGA 1RI5A 4WTOA 1VIVA 1T6ZA 1RTKA 2JIRA 2ZRNA 4KLZA 1SQSA 2FOIA 1Q0LA 1XRMA 3AUTA 2G88A 1N5MA 2X6TA 4MVJM 2PZGA 4P3PA 1FSFA 4KJZA 2XD4A 4ZOLB 5DEIA 3A4TA 4IBOA 3SQXA 4FCCA 3WNQA 2A3RA 5H4HA 4D8WA 2PAFA 2O8BA 3QITA 1T5OA 2PU7A 3K73O 4UM7A 1OX4B 3B6EA 2DR2A 3FPCA 1Y7PA 1TF7A 4BO7A 2KX7A 1ZJ4A 4XX0B 1PYGA 1VBMA 5HUHA 1FLNA 5FRDA 3P9ZA 2QDKA 1VPDA 4MP3A 1D03A 4MUIA 1M1YE 1FVOA 5DYYA 5T4FA 3U3ZA 3BM5A 1UP4A 2P9GA 3AYXB 1OBCA 5EUCA 1HDGO 4CQMA 3A4YA 2GHRA 1YBAA 5LLTA 3D7KA 1XZNA 2VP2A 3NYRA 2K5UA 1H2HA 4ARUA 2V9CA 4ND8A 5CB6A 1DRJA 3KM0A 3C85A 2FQQA 4FGLA 1JDNA 3BHNA 1GGNA 4YAIA 5J2UA 4W9MC 4ZZ3A 4WN9B 3THSA 1ZQ1A 4HXEB 1NVFA 1RSZA 2IYUA 3CUSA 1GPKA 4XGIA 1SOVA 3IP9A 4LNHA 4QBKA 5D87A 1Y7LA 3V8QA 4B44A 4YAEA 1E5QA 2Q5IA 3E5RA 3AB7A 4ER6A 2C9BA 4DT1B 5GZ1A 4GGPA 1KNQA 1YVUA 4M53A 3RC8A 5JU6A 1F0KA 1H2AS 1U7WA 1LQUA 3KHUA 5ELLA 2FZVA 3HJUA 3TE7A 1A4UA 4FFWA 1SUWA 3HCAA 1BGWA 3C8DA 2NVOA 5DH9A 2BFMA 2AFIA 2Q21A 3UT6A 3RSOA 1XJ5A 1YCHA 3I53A 5KVVA 4KV9A 4L0DA 3N2ZB 5EP3A 3KXDA 4EX6A 4JI7B 2PX4A 3QHPA 1WXFA 3CR3C 1E2DA 5KB3A 3FBWA 1QKIA 2VWQA 2AFRA 4OOFA 3GZTB 4X61A 2R7LA 5TY0A 1M2VB 2J1LA 4G1FA 4RZXA 3TOVA 1CB0A 4OCZA 2YJ4A 2XADA 3IIKA 3P27A 4Q19A 5K3BA 4BMPB 1EB9A 3T8YA 5CB8A 5HPYB 4ENPA 1OFUX 3A1FA 3FG9A 3KQKA 2XAUA 2EARA 1QFJA 2Z2XA 1I4WA 3GARA 4WZAE 3VH1A 4A15A 3PXEA 2X2FA 4RD6A 4YVFA 1YR6A 1Z25A 3I2HA 1RXEA 3OWOA 4PSVA 2WUFA 3GN1A 4OQZA 2ENWA 3WOHA 3PEWA 2Q5HA 3KKEA 4ITUA 1NZFA 4GFDA 1I3CA 4TS1A 4LFCB 5C34B 3GVXA 4DGSA 4HJRA 1Y5IA 1KU6A 1A2BA 2IX9A 2PG3A 2OFWA 4MP6A 4U1RA 1CR2A 3IODA 3EQ8A 1CETA 1IG0A 1VJRA 3D2BA 4FP9A 4IOJA 1NP7A 1EM8A 2O0MA 3K9NA 3HRKA 1U3VA 4N54A 5B2FA 3ENZA 1BMQA 1YIDA 3WLPA 1Z06A 1ZC3A 3CURA 3ZJUA 4J75A 3OQBA 2YBDA 4DBVO 2BWJA 2J8ZA 5KX5F 2H1LA 1KQ3A 4DV5B 2GBLC 3RABA 1N2IA 1X7YA 4NMWA 3QLJA 3S8EA 1TJYA 5KU1A 3OC6A 5LQCA 4IG9A 4EY8A 2G67A 3IPRA 3U7QA 1JTEA 2Y4NA 4H9GA 4KIUA 3REOA 1QVZA 3A27A 1YK1A 2POCA 3C6KA 2ZIAA 2C2XA 5EXSA 3T0FA 2BDEA 2JLAA 2RB5A 2O9JA 1EVZA 2SCUB 2VPYA 3LUHA 1SVNA 5IH7A 2QVZX 3T3DA 2HBYA 3QY9A 5JC1A 3LYAA 4M0CA 4LMPA 5BW8A 2XZDA 3ILVA 1EBBA 1KI6B 2JIMA 2VDKB 2VQ3A 2YIMA 3JZMA 2O2GA 3PK0A 4N5DA 5KOYA 3EIUA 5L95A 2NZ8A 1ECCA 1XJQA 1HC7A 2C0QA 1ML3A 2LCFA 3B70A 3JWGA 4UHDA 5IF9A 1ESDA 4LWPA 5M5BA 1WTCA 4RE5A 3YASA 1XZHA 3PUZA 3SX4A 1TNDA 4OBEA 5H82A 4DCVA 2C5HA 4XJXA 2D59A 3A04A 3K72B 1DC7A 2IYWA 3AHIA 1IATA 4JC5A 4Y2PA 2GVDC 1KORA 3WYFA 1Y82A 1BHO1 4XEHA 5KOIA 2IP1A 2JGDA 3V4VB 1X87A 3Q0IA 3W04A 4EVRA 4IIVA 1P72A 4X1YB 5BURA 3NS7A 4I5EA 5K8JB 3KEMA 2KBEA 4RS4A 1MOSA 2UUPA 2D8AA 3ASZA 2J6CA 3NWPA 3IIMA 2Y05A 2O2JA 4MS3B 1T1JA 4XX1A 5J1TB 4B7CA 3O3MB 2XGGA 3D6VA 3RFXA 4UM9B 1EVKA 2ZIVB 1NYRA 1U2EA 2WJGA 2P5SA 3OD5A 1ORHA 2CEKA 1ZD1A 4U6NA 5FI5A 1R5OA 2HF2A 1JBEA 1XKTA 5GAJA 3AEKB 1QO7A 4DABA 4U5QA 2HPAA 3TLMA 4PC2A 3H2JA 3EWNA 5CM2Z 3BMCB 2I7TA 3AVXA 3DOEA 2Z04A 3W4IA 3NW9A 4F6CA 3N7AA 1QRDA 5KCZA 3RRYA 1QAMA 1FUYB 4K28A 2IPNA 4YACA 3ZW7A 2H1HA 4IUCS 5AKKA 4URFA 4Y6PA 4D92A 4EJ0A 1NF3A 1LBQA 2WU0A 2ATEA 5EP1A 5C2JB 1HE1C 2MSNA 3LWDA 1O0BA 1WUYA 3EMVA 1TEHA 1FUIA 2BMDA 1PL8A 2Q3LA 4DCPA 1T24A 2H11A 4MR7A 3TEFA 5BNTA 1RQXA 3LNCA 5EXDA 4M9QA 5HJ2A 4ER5A 1K9SA 3PCXA 4BVAA 3A7EA 5AW6A 2ZT5A 3BJEA 3NV9A 2I6GA 1OYOA 2VYVA 3AKCA 1VECA 4KOAA 4GHWA 4TV8F 4XB1A 5JXJA 2JRLA 2JL1A 1Z5UA 4MVJP 3UJHA 3ZBTA 1U1EA 3SEQA 3FGPA 4G0XA 1ZUWA 3GOHA 3N2EA 2DY1A 3QUBA 4LY0A 4YREA 3RTDA 1YVRA 3AO0B 3UQYS 1UC8A 2I03A 3DV0A 1WMFA 3KKQA 4LXIA 5LP6C 3D3QA 1H1TA 3ZCXA 1RT9A 4M0KA 1K8RA 5DYNA 5G0SA 1OFHA 2YNMD 1C8LA 2ETXA 1O5IA 2H4YA 3BRWA 2FLKA 1WEKA 2JCBA 3LVQE 3GFOA 2VEDA 3CO0S 2RJ3A 4MCHA 3DEJA 4OHKA 1N2ZA 4TZ6A 4OB8A 2XNKA 4C6TA 1S6YA 4G0YA 3TJRA 4FN5A 4GKAA 3WRWA 1UZAA 4AMZA 3SX0A 1O77A 1ISJA 1E1MA 2YN0A 1B2LA 5I7EA 3ZGVA 1MMFB 2AZXA 2H4XA 3DZHA 4PQGA 3LRXA 1ZW1A 1ZI8A 1PFWA 4N0EA 5D6OA 4S3MA 4M98A 3TI7A 4DIKA 2FKNA 3SQNA 3V8BA 4HLNA 4QTTB 2OD7A 1XDGA 2Q62A 1DBQA 2R7KA 4XDZA 4FFMA 5K8VA 3HB7A 4XPIB 2GOYA 3WHIA 3HCEA 5CA1B 4ASUD 4GSKA 3SIWA 3IB3A 1Y6RA 2BKXA 1KDTA 3AIKA 2CW5A 3KT0A 3I45A 1TAQA 5G53C 1TQ4A 4D4JA 5L4NA 2A2ZA 1ANKA 3NX4A 3VTAA 3HZRA 4E88A 2PU5A 2AMLA 2QMUA 3BH6A 1F4PA 4NEQA 4RGVA 1QIIA 4D8XA 1LTQA 5J5AA 5CLGA 2WPDD 3ZE0B 4F85A 4ZZ2A 4LMAA 4TLLB 1PZMA 1QZ3A 2DECA 4K9MA 4RJ2A 3GGPA 5JASA 1D2MA 2A1UB 2Z2YA 1I6WA 2IZ5A 2ZKLA 4HQ6A 1US8B 2JB9A 2LNDA 4IIUA 3R77A 3ZNNA 4G4IA 1YJBA 1NSTA 4PC3A 4X7BA 2MYNA 1DXYA 3GUYA 3RKUA 2GN4A 1A9SA 4YHBA 1SHTX 5KYYA 1PG5A 2GCOA 3KLMX 4N5NA 3U1BA 5SZJA 1BDBA 2HL6A 4LXHA 4YQFA 5B2EA 5IVHA 4Q4AB 1CRPA 4L0QA 2VT3A 1AM4D 2XGSA 4BKQA 2CLFB 4DA9A 2PD6A 1OWPA 2QAGB 4ZC1A 5CDHA 3IE1A 3KTAA 2W8BB 4KXUA 2F64A 4WL0A 4B7ZA 4P4LA 3EGOA 4OGLA 3UOWA 4DLWA 2C7VA 2Q1SA 2R6GA 1PR1A 2GTIA 2PGXA 2PWAA 2MR5A 4FFLA 2DHCA 1NSFA 4AZ3A 4E5YA 1PNVA 2ZZMA 4CE6A 1G2QA 1J2JA 3ROGA 2VRWA 1DQZA 1U0OC 2A9PA 3OQHA 4NYIQ 4FHGA 3T1VA 3HYTA 4EUNA 6REQB 4CKEB 2ZSUA 2CL0X 1SBIA 2VJNA 4M99A 2ZG6A 3WWPA 2F1HA 4KX5A 1NM5C 2NO7A 2P9HA 3IP1A 4J29A 5BOSA 5BY2A 3U44A 4B84A 4C08A 4UDXX 2FRDA 2C5FA 5DNVA 2W2LD 3CNHA 4FHDA 5ANRB 2BZ1A 3EXHB 3C7KA 3SC2B 1LDNA 5EZYF 3AR5A 1KJ9A 2HMAA 4CM7A 3DA8A 4EFMA 3DDHA 4TKLA 4LX0A 4TWIA 1NXSA 2JAHA 3CLRC 2PT5A 1U11A 3ICQB 4TRRA 4ARAA 5G0WA 1KJWA 2QTHA 2FSUA 1FFEA 4W1PA 2X4LA 4QQNA 2JIOA 3G68A 2ZYRA 5KTMA 1WETA 4EIWA 1Z0UA 3NT4A 1QHHB 4RM2A 4YAJA 2BKLA 3EA0A 4PTLA 5BNFA 1JHUA 3MLBA 2C98A 1A71A 1SHKA 5KYVA 4CTMA 1A9XB 4OMUA 1YONA 1NW7A 3KYCB 4BWFB 4RD3A 4K1LA 2J0UB 4MTLA 3MOIA 1T4MA 2PUVA 5GWXA 1KS2A 2AB0A 4OFZA 5KAMA 3S44A 4KB5A 4QRHA 3OQNA 4URHA 2HR1A 3PVSA 2LIPA 4PBRA 2O8FB 2RD2A 4MRMA 4BZPA 2IZ1A 5JI2E 5L4SA 1IH8A 4IKPA 3LGSA 3ODGA 1VSBA 5G2OA 3MUNA 1A97A 4D8YA 4ZYYA 5C1OA 1MCZA 2EBFX 5FUBA 3S1SA 2HWUA 2BBSA 2JGNA 3OZTA 1VLQA 5FTMA 3J81k 2NU8B 1WP9A 2QUBA 3HB0A 3FJYA 3N59A 1TUBB 3ZPXA 1T2VA 2AMVA 1PWXA 1PWZA 1YRLA 4B4WA 3MS7A 2WWGA 2COKA 1NBME 4P53A 3STTA 3NI2A 2PL3A 1KJIA 1L5OA 4LK3A 4O5AA 3UUEA 3WK5A 2ZTVA 4EPTA 4GWGA 2I78A 4LBVA 4KNWA 2GD1O 3PC7A 2D1FA 3AFMA 3MJTA 4M0EA 3T38A 3V6LA 4BMVA 2WD9A 1VL2A 4ALLA 2YJGA 3KAQA 2C2KA 2OKGA 2B1RA 3Q1LA 5JCOA 4EY3A 4DREA 2G17A 1Z0ZA 3GJRA 3RFCA 2C9CA 2YJNA 3CLUC 1DJPA 3GJ3A 1B6GA 1Z36A 2A86A 3OA0A 1T6NA 3SHQA 3REGA 1T5DX 2H2HA 3T1QA 2RKBA 3FVTA 2RGEA 2D7CA 2CFSA 4YR9A 5GM2A 4L9WA 3PZBA 1F5SA 1L8XA 4RZSA 1DKRA 4H1UA 2GN1A 1EDBA 2J87A 2QBYB 3OSUA 4KV7A 3UB2A 1F06A 1JAZA 4J0QA 4U4AA 2WBLC 3E22B 1PLJA 3VR3A 4L02A 2ZUUA 2QTVB 3VTZA 2PYZA 2AEJA 4YUXA 1W93A 3HE3A 1I3OA 3ZLJA 3MMNA 3FIJA 4DM4A 4PO8A 1Y1RA 5KNBD 2R11A 3ID6C 5CFMA 1AMUA 2X0JA 4BJ6A 2QPLA 5T3YA 1YXMA 3LDAA 4WKOA 3PXDA 2Q3BA 3MRTA 3O6VA 4G97A 3OT5A 3AI2A 1TMYA 1K6IA 1L5HA 4QPDA 4U2GA 1FL9A 2C4MA 2HA6A 4JR2A 3VSCA 3VJLA 1UK7A 2XB2A 4PLYA 2I1VB 3AIMA 4B3IA 1BOOA 5EE0A 4BQEA 2QGNA 4EA9A 3CH6A 4H6PA 4AMYA 1HYQA 1PHPA 3JAWA 2J3MA 2XOEA 4NICA 3ROXA 1L7XA 5H8WA 1OTXA 1Z5VA 3W7BA 4BBPA 3DE7X 2BFWA 2DTXA 3A36A 4LYEA 2V96A 3AC0A 5IDYA 1G6OA 3C8UA 1KPHA 4YALA 1F2VA 4IOMA 2Q2QA 1QGZA 2FPPB 3UV7A 3BSSA 3MWYW 4FS8A 2W00A 3U80A 1Z73A 4AAYA 3IV9A 2C03A 4R1UA 5B4VA 5JI3E 1U0TA 2G9UA 3DVRX 4ZVNA 4REMA 2FETA 1DWUA 4U39A 2IEBA 1XNRB 2R66A 4K5QA 3REQB 4LTDA 1VZ2A 2JK1A 4LZAA 3FXAA 5DASA 5U1PA 1PQUA 3GAMA 4L7VA 3K53A 1I94B 1MO3A 2P5UA 2PGJA 3W5HA 3M4XA 1TXGA 3ACDA 3W2FA 3FETA 4QUDA 4AJJA 3G7NA 3KELA 1C9MA 4CIYA 3DZ8A 2UYQA 1T1EA 1XDUA 4B3HA 2WWVD 3MCWA 1JJAA 2DBQA 2OM6A 2P5YA 2R47A 2PDAA 3O94A 1CQIB 4RDHA 5AWFC 2VQ6A 2WJHA 4XR4A 1FRNA 2YHAA 1FNSA 1WZNA 5AUPB 3ORHA 3WMWA 1OXMA 1M2OB 2ZUSA 2QZ9A 4HYEA 2B99A 3C3AA 2OQIA 3EGEA 3EXIB 3R6GA 4D7AA 4ZTUB 4YP0A 4RK4A 5C32A 4LECA 4JBIA 4OQMA 3U4DA 3ZZTA 2INGX 4YMTA 3KZMA 3EHEA 3B7WA 5JZVA 2AQKA 5DGIA 4QJ5A 5A6VA 3ZJ4A 1QQTA 4LYJA 3I32A 2A0YA 1GTL1 4C04A 2VHYA 2HIMA 2QI9F 5EMKA 2R751 2FLVA 3OZSA 3AKYA 3GH1A 4MCIA 1JQEA 5JAQA 4HDKA 2PGIA 3V6MA 3AVPA 4XQEA 3MZ0A 5F1OA 2GZHA 3GGSA 3WKDA 4PANA 5FLXA 3R3WA 4EF6A 3S55A 2P90A 5CNKA 2GVNA 3X3HA 3FTCA 2O23A 1IQ0A 1Q83A 1QIEA 2FSSA 1U31A 2MJLA 1EJ2A 3C6YA 3DZFA 3LQFA 3QE2A 4WH0A 3DDNA 3TCNA 3GF4A 3TZLA 3E53A 5AVKA 5CA0B 3LA6A 5LQMA 5JXHA 2ZWMA 2O2IA 2P3SA 1M2VA 2VDJA 2WB4A 1VDMA 5H02A 3GD7A 3VGJA 5LDHA 4OFXA 2J46A 3HB4X 1G21A 3EZXA 4UHJA 2AV6A 3GT4A 4Y2UA 3OIDA 1LBIA 3EARA 1OYYA 3AILA 1NV9A 1HMPA 1WPGA 1KO8A 2IP4A 3PNVA 2PUEA 5IT0A 4DIBA 3H7IA 5ALHA 1AQNA 3DF7A 4GPZA 1RKVA 1BQ3A 2OGTA 2OGZA 5A05A 2DWQA 5HFNA 5HJEA 1KMMA 1JMVA 1WVMA 1T36A 4XQGA 3KQTA 3L0DA 2TECE 3A2MA 1HLGA 3K05A 5JWHA 3JARB 2HMYB 5IBRA 1W0JA 3GEEA 3WGNA 4QBFA 3HH8A 4A2PA 1DJNA 2J3DA 1NLYA 4PCAA 3LPLA 4Z9FA 2NU9B 3VNBA 4ACBA 3ZDCA 2A1TR 3BWMA 1JIQA 5F5XA 5BOVA 2RK3A 2F3RA 4AJ4A 3NHBA 4BZXA 4M0PA 4QELA 1B76A 1MNQA 4B4VA 2ZUFA 4MO2A 2HNAA 1JFFA 1P5ZB 2XVYA 1U9IA 4FILA 5DHTA 4BUJA 2CGEA 3BIJA 4BX9A 4O4IF 3JQAB 3I2IA 1DEKA 1RYYA 3GUUA 1L9KA 4XDGA 5ALMA 2Z1MA 3ZE8A 2IIVA 3OF2A 4I2VA 1WIWA 2ZK7A 2A33A 2FUG6 1YACA 3B36A 2JGJA 3S5UA 2AOUA 2OC4A 1IB0A 3DBRA 1L5RA 4RF2A 3A1DA 5A7FA 1B8PA 1V95A 1UFRA 4TMZA 4WUVA 1ULSA 3RBAA 4XJVA 1FXWA 5SZKB 3E15A 1ADBA 2X2OA 1SIOA 5DM2A 1X38A 2PL9A 2VVTA 2AN5A 3NWOA 3SJUA 4UOEA 3DNFA 4MDFA 3PJFA 4IG4A 2O8BB 3GFRA 1CS4C 1UDXA 1Z82A 4S35A 2GTHA 1ZA1A 2QL7A 1RXWA 1ONPA 2QTVA 1HE5A 2X4IA 1JVBA 4TLDA 5I7UA 1KEUA 3MNFA 4G5XA 4P5EA 4PC7A 5AVJA 4KE8A 3ZTWA 2XRZA 4WPGA 3OLWA 4EKYA 2VDQB 3QXSA 1E1DA 5DN6A 4Z0PA 2XT0A 4A0SA 4LXGA 1RJDA 1JQJC 5HYVA 2VPTA 3JQGA 4WZAB 3P9CA 3VZRA 5C5DA 5CG2A 1RM4A 2HIGA 1SQ0A 1HLFA 1DOHA 2Q6VA 4GPTA 5D3ZA 3LTNC 1Z0KA 3CNEA 1NYTA 4I1IA 3P4UA 1FJGB 5FL7A 5K45A 2R87A 4I2NA 1NUPA 2I3ZA 3A2LA 4P84A 1T8UA 2PX0A 1BX3A 3DONA 4FLEA 4MUBA 5K3CA 3BT7A 4QPNA 3TRIA 4LHYA 3ICVA 2RCNA 4HAUA 1G18A 4KIJA 3RGGA 1L1FA 4TXMA 3AP2A 2F8SA 2H48A 1NXQA 5KX5A 2ES4A 4RQAA 3JAKA 2R1VA 3AU8A 1NPDA 5TNXA 5KYUB 2E3JA 1JXQA 4GUAA 2PZMA 1PR9A 3K5IA 3ONNA 2IX3A 4MV4A 3G1UA 2ZETA 3JYNA 4HYTA 4EEXA 3OIYA 3ZV7A 4CM4A 4BGIA 4EL5A 2NT4A 2V6FA 3WTBA 3OLVA 5C31A 3IURA 4KQEA 1QNFA 2B0JA 1WO8A 1D4AA 2AKAB 3NALA 3IT1A 4LIPD 5DGXA 1X8JA 3O0DA 3N74A 5A3RA 2I71A 3I1JA 4HBGA 1FXUA 2H6EA 4YWHA 3WV4A 4EY5A 5JIBA 1T9BA 1IY0A