1W0CA

Inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
276
Chain Sequence
b'VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDVGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
molecule tags Oxidoreductase
source organism Leishmania major
publication title Inhibition of Leishmania Major Pteridine Reductase by 2,4,6-Triaminoquinazoline: Structure of the Nadph Ternary Complex
pubmed doi rcsb
total genus 98
structure length 276
sequence length 283
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w0cA00
1AXEA 1I32A 5CDSA 1O5IA 3NTOA 2OL4A 4PZCA 3FR8A 5DOVA 2VYND 1ENZA 4DIBA 5JC1A 3JTMA 3S2GA 4BNMA 3RKUA 5IDYA 2ZTVA 1RM4A 3OQ6A 3ZWBA 2PH5A 5I7SA 3QQPA 4O59O 4NZ9A 2H1SA 4PN3A 5B4VA 3DZBA 4BO5A 2WMDA 3ETDA 4BNYA 3R3JA 5L7YA 3QP9A 1QP8A 3PQDA 3U3XA 1GADO 2DUWA 2IZ0A 4WLUA 4D3DA 5T57A 4PG6A 1A7AA 2QW8A 1YH3A 4FW8A 3SEFA 4A73A 2PNFA 3GAFA 4MVJD 3RC2A 3PFWO 3L6OO 3P7MA 1IPFA 1UDCA 3H9JA 1R4NB 1GR0A 1S6YA 1NPTO 2QHXA 3EDMA 4EJ0A 1K3TA 1UDAA 1F8FA 4F6CA 3ABIA 3AI2A 2YW9A 3BTSA 1BG6A 1OMOA 1XEAA 1ZK4A 2EV9A 3GN1A 3QW2A 4CMHA 3P19A 2Q1UA 3E9NA 3HNPA 3M1LA 2GN6A 3PP8A 3GRPA 3TZQA 4LN1A 3MTJA 3ROMA 1DIBA 4ZA2A 1QRRA 4UUMA 1EE9A 2PLAA 3F4LA 1P1KA 3E48A 3KO8A 3ZH2A 1EBFA 3QVXA 3UOGA 4BHTA 4NFSA 3HDYA 4D79A 4CQMB 5DNAA 2UAGA 5G0VA 3AUSA 4E13A 4R69A 4BKRA 1HKUA 3CEAA 4Q3AA 2XPCA 1U1IA 4NJMA 1E5LA 5L4SA 4MO2A 3OJOA 4H16A 2C2XA 2EEZA 1Z6ZA 2PKQP 2I3AA 3ASVA 3IQDB 3O38A 4GGOA 4YAGA 1R4MB 5TLSA 3IDSA 2BELA 2W2KA 4A2CA 3WGHA 2YUTA 2I5PO 3JD0A 2OHXA 5L53A 4MVJF 2P4HX 3JQ8A 3FSRA 3PDJA 1HSOA 1PGNA 2BMAA 3GGPA 3MTGA 3B1KA 5IJZA 1ZSYA 1M76A 1Q7BA 4IDFA 2EGHA 1KEWA 5CDUA 1YWGO 1ZO8A 5JY1A 4AJNA 1H9AA 3JCZA 4EEZA 1YS4A 4XB2A 3UICA 3H3JA 4D3FA 3DBRA 4EW6A 5BQFA 5LDHA 3H65A 4PRLA 3GEDA 3TL2A 4E5KA 1HDCA 2Q4BA 4H3VA 5U9CA 3MEQA 1UXKA 4GGPA 4CLXA 4L73A 4DMLA 3N58A 4CLOA 4OKNA 3JQ6A 5L45A 3WX0A 5CFZA 4GLOA 4ND3A 1XR3A 3DMTA 3C7DB 4YVFA 5HS4A 2YDXA 5JMPA 1BSVA 1LEHA 9LDTA 3M1AA 3G3EA 2OZPA 1ZVMA 1DIRA 4XWYA 1EZ4A 3DAPA 4UVGA 5T8KA 1PGPA 3U4HA 4GAEA 1EEHA 3OP4A 2R00A 1LDEA 2Y67A 3NV9A 1J6UA 2C2YA 4YJHA 3W4KA 2A4KA 1D1TA 3OA2A 1WNTA 1EUZA 4J2HA 4FDAA 4IPTA 4HBGA 4PVDA 1ZK3A 3VVBA 1T1RA 4J2OA 4URFA 2C29D 3CTMA 2P2SA 1U2DA 1TI7A 1CYDA 1AN9A 2CD9A 4A5OA 5JS6A 2EJVA 1P74A 2PGLA 3S2IA 1R15A 3VH4A 1V8BA 4J90A 1MLDA 1DRUA 3AWDA 4OXNA 4BNFA 4D0RA 5JCXA 1YXMA 3HSKA 3INRA 4R51A 4YQZA 3G49A 3CXRA 3F4BA 3WTCA 2O7QA 3ITKA 3DBLB 3ROKA 5I8WA 1PJCA 1HE4A 4E0BA 1N9GB 3ONFA 2NSDA 2IRWA 3TL3A 2PD3A 1CIVA 2BGMA 1SBYA 2C59A 4ILKA 1Z75A 3O4RA 1CETA 4DC1A 5A4DA 1ZNQO 1H6AA 4JBGA 2Q4EA 1NPYA 2FR1A 2I6TA 2X5JO 3DEYX 3I9JA 2JD2A 3KYCA 3ROPA 3VZRA 3TF5A 3HB5X 1HYHA 2PY6A 1YBAA 4B8ZA 1DHTA 2Y0CA 2VZ0A 4GMFA 3DMTC 4PGFA 5ILGA 4XRGA 4PG4A 3INTA 5F5NA 3V5NA 2G76A 4M87A 1IL0A 2ZB3A 1SEVA 4Q3CA 4J1QA 4D46A 1T1SA 2EGGA 2CNBA 3VTZA 3ZWXA 4C4OA 2UYYA 3TRIA 3U4CA 1N8KA 4G65A 4NBTA 3NTQA 4DTIA 3VZSA 5DZSA 2Y1FA 1R16A 3D64A 2V6GA 3EMKA 4GX0A 4H15A 1YGYA 1EVJA 4Y6RA 5JE8A 4BV9A 3AU8A 5I9NA 5BNIA 4NHEA 2QZ9A 2Q3EA 2EXXA 3GNSA 2WYWA 3C1TA 3DBHB 4XQEA 4XR9A 3PHIA 5BNTA 4RJTA 2CVOA 1SEPA 2H6EA 4Y8VA 1RM3A 1OBFO 2E37A 2FSSA 1NWCA 1TXGA 5U1PA 3RUEA 5JO0A 2D3TA 4R4JA 3WFJA 1PL6A 4N5LA 2NM0A 3RASA 4BO6A 1V9LA 2Q2WA 1LLDA 3VC7A 5K6AA 1Q0HA 3OJ0A 2J8ZA 1VRWA 5C7IO 4R1UA 2Y68A 1QXSA 1O9BA 1EFLA 1ISFA 4N18A 3F9IA 4WCFB 4J7CA 3WGZA 2EP7A 3RUCA 3PGJA 2FRDA 2PZLA 5CDGA 4AJOA 4BGEA 4LSWA 3RFXA 1LJ8A 4R68A 3GFBA 3RCBA 5TJ9A 4PRKA 2WD7B 3JYNA 3FWNA 1RYEA 2JFFA 4JP3A 4MKXA 4NIMA 3DHEA 3ZDFA 1RM5A 3C7AA 2VRCD 2HKIA 4QEDA 5TC4A 5KJCA 1DFIA 4CMCA 2G17A 1ADBA 1U8FO 5G4LA 2CFCA 1UAGA 2X0JA 1MFZA 4LW8A 2Y1GA 2PD4A 1X15A 1E3SA 1E77A 3GN2A 4OMUA 4XX0A 1C0PA 4XJTA 1AUPA 2Q99A 2HU2A 1PZEA 1RJWA 2DU8A 2VWHA 1XIVA 1P1IA 2NACA 4MKZA 5JDIA 3RI3A 5JAZA 1C0LA 3WGOA 1I3LA 1ZKMA 4B4VA 2QYTA 2VN8A 1KIFA 3A06A 1D8AA 1DC3A 4HFNA 1MC4A 1GPJA 2WE7A 2A9FA 3DDNA 5THQA 3S2EA 2XXBA 1U3WA 5T8KC 4P8RA 4Y98A 2HMVA 2WYVA 3UHAA 4BUCA 1DC5A 1DB3A 1IUKA 1SAYA 4ALIA 1LA2A 1HL3A 2GYYA 5F3RA 3N74A 1IULA 3WYEA 1LQUA 3IL2A 4J1TA 1YBMA 3E8XA 2WSBA 3PYMA 4IS3A 1AHHA 2OGUA 3GG2A 2IZZA 3UGKA 1IHYA 1JVSA 1M2WA 1JLLA 3DONA 4R41A 3RWBA 3GAZA 2YHIB 4IMPA 1IYZA 4E5PA 2HRBA 4GX1A 2BF7A 3AM5A 4HUJA 4JCOA 3X2FA 3VKUA 1LBEA 1XSEA 4CM9A 4LMRA 4NR0A 5TQVA 3ZWAA 3A14A 4MVJH 1TLTA 2OO5A 2Q1SA 4KTTE 1NR1A 1IZ0A 4MOWA 1BHSA 4Q9NA 4CMJA 5IXSA 2ZJ1A 2CDBA 1GCUA 2DC1A 4GVLA 4MP8A 3WJAA 5KJEA 3GVHA 1UXIA 1BTOA 1HDOA 3ZCXA 4XGIA 5H82A 5JYDA 1KY4A 4TQGA 4XGNA 4BS9A 1AE1A 4TMFA 3MJEA 3Q2IA 5JFOA 3ONEA 3DO5A 3VHRA 5G4KA 5AXDA 2IDZA 2B37A 1XQ1A 2BKAA 5FYDA 3GOHA 1QV6A 2Y99A 3WB9A 5KTKA 4R5MA 3R3SA 1SB9A 4UVEA 1JN0A 3WJ7A 4YAKA 4WKGA 5GZ3A 3TZCA 3NRCA 4ALMA 2W8ZA 1HTBA 5KVSA 3V1TC 2O50A 1KS9A 1PS0A 4IXWA 3JQ7A 1Y6JA 5G0TA 1OI7A 3KEQA 2X86A 4CMKA 1ZXLA 2DFDA 2PD6A 4Y6SA 3TDKA 1EUDA 5C7LO 3NT4A 4BKUA 2O3TA 5EQDA 3VPHA 1PZGA 2G5CA 5EESA 5BSGA 4B4UA 1GYPA 2C5AA 2EKQA 4CM6A 4FFNA 1GDHA 2YQ4A 3GC6A 3PHLA 5DBFA 5G4KB 3VVCA 4AJPA 2Q45A 5KNLA 1NXQA 1K0UA 4CM7A 1HEUA 4QECA 4GSKA 1XA0A 3ZNQA 4XQGA 4E4YA 2P68A 4CLOB 4JBHA 3FNHA 3JSAA 4YJGB 1NR7A 4PLHA 3D1LA 4K9DA 4EI2A 3D4OA 3D0OA 3OJFA 1GUZA 4E32A 4PLZA 1I36A 4N54A 3HDHA 5AXBA 1KVTA 2VUTA 3M6IA 1ENYA 4KDEA 3RVDA 4GX5A 4J7XA 3FCOA 4FR5A 1Z7EA 1UP7A 3JQ8B 3UW3A 4PG5A 3WDSA 2AQKA 5K0ZA 2X58A 4CMIB 2CVZA 2NVUA 3K31A 3PRJA 5CEFA 2BFPA 3ZHXA 3WWZA 1UJMA 3TZ6A 3E82A 3DZKA 4WPGA 2VTEA 4E2YA 4FSHA 4RF4A 3WBBA 4QQRA 4M55A 4W7IA 3KYDB 3PQEA 4TKLA 1ISHA 1F14A 1DLIA 3B70A 4OOEA 4YACA 4TRMA 4RVDA 1KOLA 3GRKA 5CEJA 1H6BA 4YT2A 3I9OA 4GPD1 1X7DA 1P0FA 1WDKA 5COAA 3H3FA 1J49A 1BVRA 3LF1A 3OM9A 4WLNA 1GZ6A 3PPIA 2OORA 5DF1A 4TSKA 1Y7TA 4NPCA 3IAHA 2CZCA 4B3IA 4PLFA 1U3UA 3ZGYA 5CPBA 2W2LD 4A10A 5H81A 4CJXA 1HE2A 1ZFNA 1NFFA 4PLYA 5CP8A 1KETA 3WLFA 1NYTA 1HYGA 4U6QA 1GD1O 5KVVA 3FD8A 4AJLA 4RQTA 4TVBA 4D43A 3WGTA 1SCUA 4JXKA 4XIJA 3Q3CA 2D1YA 4FQ8A 3MOGA 2NU6A 4RZIA 1JWAB 3FWZA 3GDOA 5L51A 1JA9A 2VOJA 4DIFA 3TPCA 3Q2KA 5HRUA 3FNFA 4CLEA 1I0ZA 4YRAA 1ZK0A 3RJ9A 9LDBA 3K73O 5IN5A 1P1RA 1DFHA 3BTVA 3DC2A 4U0KA 5EPOA 3KSZO 4O0LA 3DOJA 3IOYA 3RC7A 3PI7A 2DFVA 2JFGA 2AW5A 2CDAA 3AI1A 4Z6KA 3CH6A 3B1JA 3DOOA 1I2ZA 4EDFA 4LVUA 2X5OA 5A3JA 4BOYA 5TF4A 3WGYA 4WCFA 1GV1A 3O8QB 1Y8QB 2HMSA 3HDQA 3OIGA 3HZZA 4I5EA 5HWSA 1PQWA 2Z5LA 5HTOA 3HQ4O 2WTBA 4BNWA 2HJRA 4I08A 1B7GO 3JQGA 4AJ1A 4HFRA 1B3RA 4DBZA 2NVWA 1F17A 1QYVA 3DHNA 4RF5A 5JCJA 1D1SA 4ND4A 3AY3A 3KM0A 4GH5A 4U8GA 4WLOA 5A5EA 2Q1TA 5EMHA 5AOVA 5A05A 1HE3A 2JCVA 2B0JA 4OAQA 4YT5A 1C3VA 2VRCA 4EYEA 2EW2A 3ZU4A 3QIVA 1KEUA 4OSPA 3S55A 1PJ2A 5F1PA 1NFQA 2B5VA 2W90A 4BNLA 4DBVO 1QKIA 3GMSA 5IFLA 3DBHA 3O8QA 1JW9B 2J3JA 3EAGA 1JAYA 1EBUA 5T64A 1PQPA 3ZWCA 5DCUA 5LCXA 4E2WA 3PJGA 2WD8A 3QWHA 1Y8RA 4JJGA 1SOWA 1LI4A 4F46A 3WGQA 3KZVA 4L8VA 4HXYA 4RCVA 1LRJA 1LX6A 4O6VA 1S7CA 2O4CA 3RFTA 3STHA 5G0WA 4PLGA 1QLJA 5ICMA 1P31A 5KKAA 4DLAA 4XD2A 1RYDA 1DBVO 2R00C 4J43A 3E03A 1A9ZA 1NAHA 2PK3A 1TA4A 3QLJA 4DLBA 4ZD6A 1ARZA 2D59A 3KLMX 2RAFA 2V6FA 2RH8A 3SX2A 3PHGA 1WP4A 4UEKA 4L74A 1I10A 3KYCB 3LT1A 4IM7A 4S3MA 1LDBA 3KYBA 3JQBC 4B7XA 3GQVA 1OOEA 4CLRA 4LGVA 4RO0A 4I9HA 4YEDA 3ZHBA 2O7SA 1KVQA 1LLQA 3HUDA 4WUVA 3U5TA 1NQ5A 1B16A 5BSHA 1TEHA 2VWQA 5A9SA 3ZN2A 4ALJA 3DQPA 2B4TO 3GVIA 2AA3A 1GV0A 2DQ4A 4E6PA 3ZWYA 4CM9D 4RGBA 4WLFA 2I3GA 2X23A 4J4HA 1P44A 5TJHA 4O63O 4J0EA 1EVZA 2DKNA 1Q2XA 2DTEA 5C37A 3GVCA 1PZHA 4DXHA 5I7FA 3E5MA 4FJ2A 1XWFA 2FZWA 3W8DA 4OKIA 2HRZA 1F8GA 2B4QA 2CF5A 2ZQZA 4L4SA 5JO9A 4M54A 4BB6A 1EVIA 4HV4A 4A7PA 4W82A 4X54A 2J3IA 1ISJA 3H5NA 4CV1A 1QV7A 3OETA 4RF2A 3QA9A 4A27A 5KJFA 2ZB7A 1QG6A 3DR3A 3AY6A 4GBJA 5BR7A 3W4IA 3AOGA 3UH1A 4QO8A 4ND1A 4ZQBA 2V65A 5I9LA 3IKTA 1IY8A 3BTUA 1WMAA 4GX2A 4IDCA 2I67A 3SVTA 3ZNNA 3JYQA 4TZKA 1C1XA 1I01A 3GLQA 2VYVA 1A27A 1DHRA 4BNUA 3G17A 4BO2A 4DQVA 3GFGA 1E92A 1I30A 4P4NA 1E3JA 2YV2A 4EUHA 3Q9UA 4QTZA 5B12A 2D8AA 1ZSNA 4PLTA 4Q3BA 4CPDA 3WYBA 1E7YA 3H8VA 5C7OO 2Z1NA 4BO8A 2RHRA 1LU9A 3ICPA 1LRKA 1DJNA 1PU2A 2POQX 5TIIA 1U5CA 5ITWA 3AUTA 1ISGA 1MP0A 4WOJA 3S1LA 4JP2A 3V1YA 5JDCC 1HE5A 4YJDA 1YQGA 3FPLA 2IYOA 2ZYGA 4W9NA 4BGUA 1V3VA 4PIVA 1U8XX 4C7KA 2HSDA 4CM3A 1YB4A 3WOHA 5A5FA 2YJZA 1F0YA 3ENKA 1B8VA 1PSDA 4BQPA 3EVTA 5B4TA 1GCOA 3PYXA 1AHIA 3L9WA 2DLDA 2GLXA 3FN4A 1N5DA 3IJRA 3AUAA 4AFNA 5ITVA 3LDHA 4KZPA 2I99A 2CSUA 2VWGA 3Q0EA 4RVUA 1V6AA 1YONA 5A04A 2RHCA 4EGFA 1O94A 4D41A 3JQGB 1PQUA 3C7CB 2J3KA 1BMDA 2ZIZA 3QVTA 3R0IA 5KVQA 3TN7A 1DDOA 4HFMA 3ON5A 3CMMA 4DUPA 2Q1WA 4I5DA 4LCJA 4NU6A 3WIDA 3ZI0A 4NNJA 3HADA 4BNHA 3VDRA 3OIFA 3W6ZA 2AE2A 1ZW1A 5CG2A 1DJQA 2NU7A 3NDIA 4ZRMA 3HJAA 4ESOA 1YBVA 2EIHA 2VHWA 4AJ2A 3S2FA 4Z9FA 1ISMA 3KHUA 3F1LA 3RAJA 3LYLA 1NM5A 2VQ3A 3L4BC 4KUHA 1V3UA 1R0SA 1TT5B 1JQBA 3D3WB 2NADA 3RBXA 2V6BA 3VZQA 3UXYA 1XG5A 5B4UA 2GSDA 4MIEA 1CF2O 4OJNA 1LSOA 3BMNA 1YDEA 4ZJUA 1GY8A 1Y8RB 2NTJA 4J16A 2X4GA 1I3KA 1I3MA 1VI2A 2RH4A 4RF3A 1SPXA 2NU8A 3G1UA 2NUAA 2NV6A 4IIUA 4ITUA 4J7UA 1GYQA 4L0QA 7MDHA 2OOSA 3EZYA 4XYMA 2NU9A 2GF2A 2AE1A 3I9MA 3IKVA 4YYZA 2VOEA 4FGSA 1WPQA 3K92A 4CM4A 4QUKA 4I8XA 5AYVA 3SXPA 1BXGA 2FPPA 2NLOA 4CM5A 4W99A 5K6AC 5EL0A 3AI3A 3NEPX 3NGLA 2C0CA 2PGJA 1LDMA 2BGLA 5G0SA 3BMOA 1PWZA 2W4QA 5HBRA 3HDJA 1Y8QA 1ONPA 4LMPA 3WQRA 1BXKA 2GN9A 3I52A 4J49A 3KETA 2CUKA 4OQYA 2GGSA 2Y93A 1HETA 3U09A 2P9GA 2DBRA 3EZLA 4IJKA 1GQYA 2XXJA 2FR0A 4KP7A 1H2BA 2O3QA 5IZ4A 2IXAA 4XR4A 4IQ8A 1DOHA 1VSUA 1FDTA 3WR5A 2P5UA 1OAAA 3U4IA 1I2CA 1PS9A 4XDZA 3LLSA 1KVRA 3DL2A 2WWRA 3FHLA 4ZRNA 2IE0A 1GZ4A 2VTDA 4HADA 4R01A 3BTOA 5FEUA 2UV8A 4JQCA 4ZQHA 4DVJA 3BYZA 3IJPA 5JYEA 3ASUA 1DFGA 4W4TA 4Z9XA 2PA3A 4KOAA 4IGFA 3K96A 4ZICA 4IDAA 3WGGA 3D3WA 3C1OA 4BNJA 2Y1DA 4I9NA 2QQ5A 2HJSA 3ORFA 2PGDA 1Y9AA 2DBQA 3PVZA 3RROA 1GEGA 4QX6A 3ZV4A 4WOKA 5CG1A 3EYWA 1DAPA 1HT0A 2B4RO 1GEEA 4XYBA 2E4AA 1YE3A 1JAXA 2DM6A 3C1AA 3GVXA 4KDFA 4N7RA 4UVDA 3SBOA 4ZVVA 5GZ1A 3QWAA 1N92A 3OSUA 1WMBA 3O03A 3ANLA 1H93A 2O23A 3LVFO 1P0CA 4D45A 2BI8A 2X8LA 4UVIA 5DULA 1NTOA 2C07A 2FMUA 3I9NA 1H0KA 2C82A 4DRYA 5A1TA 4MKRA 3GR6A 1O89A 4NFYA 4NDNE 2Y66A 4UULA 1UUFA 4AJHA 1U7HA 1ISIA 1G0NA 2HK9A 2J5QA 1E1LA 5GZ6A 3WGIA 1XLTA 3RJ5A 3OFSA 4BKQA 2V6MA 3BHMA 2E82A 2EKLA 1U4OA 2IEBA 1RPNA 3JQCA 3K9QO 1ZXBA 3WTBA 4INAA 5BSEA 3MJSA 4J9VA 3ZHYA 2X6TA 1R4NA 3DZJA 4K1LA 5B1YA 2OXIA 4XEHA 4GQAA 4KWIA 2VHXA 4YWJA 3V8BA 3H9QA 3TJRA 1A5ZA 1LDGA 1KVSA 4H7PA 1XCBA 4M8SA 3UFXA 3NT5A 3IC5A 3ANMA 4JROA 2DPHA 1KEVA 1FDSA 5BSFA 4C7JA 1F12A 1U2GA 3L4SO 1HSZA 2PTGA 1UAYA 5T6BA 3Q11A 4QFCA 1E3IA 2GNAA 2H5LA 4DGSA 1Y81A 2PKQO 4KQWA 3WG9A 1T2CA 3PYLA 4K28A 1QYXA 1SO8A 1ZK1A 3KEOA 3FNEA 3HFSA 2NNLD 3E9QA 1VL6A 1M6HA 1K6XA 4TWRA 4CV2A 2Q2QA 1XU7A 1QR6A 2GO1A 1EDZA 1JWBB 4I9UA 2ZCVA 4Q3NA 4NBVA 5L95A 4B4WA 4BMSA 1U28A 3O9ZA 4Y9DA 3GA0A 5LDGA 4Z3DA 1WZIA 4IDBA 1LSSA 3QHAA 3F5SA 3PEFA 1H2HA 3L77A 1U5AA 5ADHA 2D5CA 1Q0QA 4RVFA 4JLWA 4TROA 4YJHB 3X2EA 3VOSA 2WJPA 3OJLA 2ZB4A 2DTDA 1T2EA 5IDXA 3BZUA 4E30A 1Y5MA 3PIDA 3ENNA 3WS7A 2VZ8A 4MINA 2OMEA 4WLVA 3JQAA 4B79A 4M49A 3OA0A 2CF6A 2P9EA 2Y1EA 4NBUA 4CL3A 1Z82A 3JQBA 1A9YA 2GN8A 2O3JA 3PWSA 3NKLA 4FD3A 1C14A 4CMEA 2J5RA 4E5YA 1DEHA 3JQAD 3LT2A 1XHLA 3I3OA 1E3EA 4AJ4A 5DT9A 1NQOA 3K30A 5L7WA 3ZV6A 3VDQA 2GZ2A 4YCAA 3DFZA 5JCJD 4GMGA 5JDCA 3LQFA 1OC2A 4ALNA 2JCXA 2FN7A 2QYSA 4RVGA 1Y9EA 1I24A 4YB8A 1DRWA 4HNGA 3RC1A 2PWZA 1UXGA 4ALKA 4NJMB 4CM1A 4BMVA 3BHIA 4L4XA 4R9RA 1R0KA 2BFAA 3QVOA 3GPIA 5CDTA 1GU7A 5KJ1A 2TMGA 3UN1A 2JD1A 2I65A 2NTNA 3I6QA 1L7DA 4K6FA 8LDHA 1KC3A 1NHGA 2DT5A 2HMUA 2QRKA 2WM3A 2ZK7A 4XJSA 4DMMA 1E3WB 4OXYA 1YDWA 3PXXA 2O2SA 3RUFA 4XRRA 3V2UA 5DOZA 5JLAA 1XDWA 3T4EA 4EJ6A 3W6UA 2FPIA 4TRJA 4ZN6A 1D7OA 3OH8A 3OIDA 4DA9A 1PR9A 1UXHA 2GD1O 1KYQA 4E3ZA 5A06A 2BRUA 4IDEA 4JGBA 1BDBA 3EK2A 3GT0A 1KEPA 1HRDA 2G82A 2JD0A 4YQYA 5BNFA 1I8TA 2ZQYA 1E7SA 1NPDA 4D42A 4U6SA 5DP2A 1HDRA 1ONNA 2X1HA 1E1MA 1X14A 2OP1A 4CLRB 3DFUA 1PJQA 1MV8A 3QWBA 2AMFA 1E6UA 3M2TA 1DIAA 5JXWA 4QSMA 5A9RA 1VE9A 2UUPA 1PTJA 1Q7GA 5TT0A 3UCFA 3GUCA 5F5LA 4IQGA 4GVXA 1G0OA 2OBYA 4BQRA 1WXDA 3WIEA 3B20A 4PZEA 2ILTA 1E5QA 4P38A 2J6IA 1DIGA 3JD2A 4IDDA 2D4AA 4YBZA 3FBTA 4Z0TA 1MG0A 3CUKA 3Q6IA 1TT7A 1CWUA 3JYPA 5B37A 4O1MA 3RBZA 1CEQA 1YL6A 3GHYA 3K2EA 1X1EA 1V0JA 3AOEA 4JJIA 4L75A 1IE3A 4DL9A 2A94A 1YOVA 3LSYA 4N5NA 1DC4A 1JKJA 3I4FA 2Q50A 3NDRA 3L07A 4WNIA 2EG9A 2Z95A 2DBZA 3OJEA 2JCYA 5A3VA 3RC9A 4BO7A 3CPSA 4OQZA 4R3NA 2NTVA 1QYWA 1O95A 4FFPA 2DBVO 1EK5A 4YAIA 2YZ7A 2X9GA 4J9UE 3DZGA 5AXCA 4RPKA 2J5KA 3GVPA 1YQDA 1NQAO 2WEKA 3JYOA 1BW9A 1NP3A 4BNTA 3IMFA 1LQTA 1A72A 1E6EA 2F00A 1AGNA 1GPDG 1J5PA 4FPXA 3O26A 1NWHA 1EVYA 2HMWA 3HN2A 1PX0A 5L4LA 5I7EA 1W4ZA 4N5MA 4A26A 4FN4A 4II2A 1DAOA 4CV3A 4GKBA 1YOVB 4J3FA 2XAAA 1ZMTA 4YA6A 3RSHA 4B7CA 1K6IA 3RUIA 1UZMA 3LK7A 4BGIA 4DIOA 2IXBA 4NBRA 2HLPA 3G79A 1B26A 3RKRA 3JQ9C 1P45A 1VM6A 3OQBA 1HF3A 3U4DA 1IB6A 4OH1A 4ONEA 4OOFA 1EMDA 4I1IA 1B8PA 3DTYA 3B6ZA 2JAHA 3FPCA 3GK3A 1EQUA 3DMYA 4RORA 1CRWG 3I83A 4F45A 3KUXA 5IN4A 1WVGA 4ZGWA 1N1EA 4XDYA 4CMEC 3E9MA 3E18A 1YL7A 1Z45A 1X7HA 2ZKLA 4JX8A 2YQ5A 3OMLA 7ADHA 3GY0A 1AXGA 2D5AA 3U49A 1W0CA 4PFJA 2O3UA 2BGKA 2HDHA 1LSJA 1XGKA 2O48X 1SB8A 3KSDO 3MJCA 1VJTA 2GZ3A 1IHXA 1MC5A 3DBLA 2W98A 3IP1A 3WSWA 1R4MA 4RZHA 1B15A 4JIGA 1D3AA 4FOSA 4RPLA 3S8MA 4FFMA 5ILOA 2NWQA 4J6FA 4XZ3A 4W9NC 3FI9A 2HCTA 3ZU3A 4WNCA 3JQFA 5JBIA 4GWKA 3GDGA 5TX7A 1T4BA 2ZYDA 1I2BA 1ORRA 4PZDA 1O0SA 5F1KA 4BNXA 5DCYA 1PGOA 1H9BA 2GASA 1NBOA 5EIOA 5G0UA 4CQMA 2PR2A 3JQFC 1DIHA 4WE3A 1YQXA 4YT4A 2C5EA 4OIMA 1YO6A 3TZHA 3D7LA 2VT3A 4NH4A 4W7HA 4MJLA 5G2OA 4OM8A 3PTZA 4ZHSA 4HP8A 4XKJA 3NX4A 1R12A 2B69A 2D0IA 3GMDA 3H2ZA 4NFHA 2WYUA 3N7UA 1UR5A 3I1JA 4FC6A 2CY0A 2E48A 4UEOA 3DB2A 4RL6A 1T2AA 4AJIA 4E2XA 3AFMA 2BHLA 1M6WA 1HDYA 2VHZA 1LUAA 4J0FA 3GNQA 3T7CA 5JC8A 1JKFA 3FTNA 2J3HA 4LRSB 3KSUA 8ADHA 1NVTA 3DBRB 3F5QA 4DQUA 2P5YA 4CR8A 3H2SA 4QT0A 1E7QA 2JHFA 2H63A 1XU9A 1YRLA 2CMDA 3JD1A 4G2NA 2FZEA 4YJGA 3ZW9A 2AXQA 4R1NA 4WCDA 3L4BA 3H6KA 3ITDA 4RVHA 5HM8A 1FJHA 4YPOA 3JQAB 1SNYA 1SZJG 4TRNA 2W2KB 2CDCA 1VJ1A 4E33A 3TNLA 1P3DA 2C20A 3HWRA 3JQ9A 5F21A 3IP3A 4IXTA 1Z73A 1KC1A 1CDOA 2VNSA 3AM3A 4UUPA 5EQFA 1UDBA 4JN6B 4RDIA 3QWIA 3SC6A 3RUHA 3MWDB 5TSDA 4E5MA 1X0XA 1CJCA 1NQTA 1QMGA 3GH3A 5CDYA 4A03A 1ADGA 5THKA 2DPGA 4Z3KA 3AY7A 1ENPA 3BMQB 4J4BA 1PJ3A 4CM8B 1T26A 3PJEA 1DLJA 3H4VA 5IDQA 3DBVO 1PJBA 1FDWA 4NJOA 3PLNA 5L3ZA 1MX3A 3AK4A 3SJUA 4HY3A 6LDHA 1LDYA 4BKPA 3OECA 1EK6A 1L7EA 5JAMA 4BO0A 2X5KO 2GERA 1GUYA 5C5IA 4NBWA 2G0TA 3UKOA 1VLLA 3OF2A 4WLEA 1VPDA 4CLDA 2EKPA 4TZTA 2X22A 5EJ2A 1WWKA 4BO4A 1PL8A 1XQ6A 3MCVA 1PJLA 4A0SA 4ZQGA 2CVQA 5EERA 1YJ8A 1WZEA 2DAPA 1DPGA 1L1FA 5KCZA 2P91A 3NAQA 3OEWA 4Z9YA 3E1KA 3AU9A 4BB5A 4CODB 5ENVA 4B3JA 5ES3A 3NTRA 4EEXA 3T4XA 4BO9A 4AJKA 1BDMA 1HZJA 1CQJA 2Y1OA 4Z0PA 5GMOA 5C3MA 3ANNA 4GSLA 3MWEB 3LF2A 4R3WA 4PLWA 5DBGA 3WQSB 5KKCA 3JQDA 3WNVA 1VSVA 2X0RA 2I76A 5A9TA 1VC2A 1E1KA 4G81A 4MPDA 4E21A 1LLCA 2VNAA 4D7AA 1QSGA 3OEYA 1KVUA 4XB1A 1B2LA 1WDLA 4ZQFA 3DWFA 4J1SA 4BO1A 1OC4A 4EUFA 4OL9A 4Z0HO 3V1UA 2B35A 1LDNA 3LLVA 4EUEA 5L40A 3LT0A 4GL4A 1LC0A 1K2WA 2FY8A 5IZCA 2XOXA 3WYCA 1HLPA 2NVBA 2ZTUA 3OBBA 3WXBA 3JD3A 1MXFA 3ZHZA 1C1DA 1Y5RA 1B0AA 1G1AA 2B36A 4JK3A 3UCEA 2AQHA 4UVHA 1ZBQA 4XYEA 3KTDA 1A7KA 3BIOA 3NUGA 1GQQA 3ICCA 3U62A 1DO8A 4UEJA 4HFJA 4CUZA 3UF0A 4RPGA 4QXMA 2HAEA 4CMBA 4WK6A 1FF9A 1UZLA 1ID1A 1R66A 1ADCA 2SCUA 4W6ZA 4K6CA 4MP6A 4Q3DA 4FFLA 4P22A 3I23A 4BNNA 1GUFA 1Q0LA 1XKQA 3PWZA 3LC1O 2FWMX 2O4UX 3QVWA 4UUOA 4CM4B 1NFRA 5MDHA 5F1OA 5JW6A 4LK3A 3SLKA 4DLLA 2GPTA 1YVEI 2NVUB 3FTPA 1YB5A 2R6JA 1LTHR 1T24A 2QX7A 4ROSA 1ZZEA 1H6CA 2WDZA 3GGGA 1GYRA 3VAZA 1LNQA 3BMNB 1PIWA 2QRLA 3BA1A 3WQQA 4WASA 1UH5A 2I66A 2GZ1A 4DPLA 1D4FA 4M89A 3PJFA 1PJTA 4R54A 3MJ4A 2E49A 2UUOA 4IS2A 2AEFA 4D3SA 3WICA 1M67A 3PHHA 4PLVA 1SMKA 5CEEA 5CAEA 5FI5A 1U3TA 1X0VA 1BGVA 2R2GA 4TVOA 3FF4A 2EP5A 4IDGA 4CQLA 3QE3A 4FC7A 1ULUA 4WECA 5ER9A 3A4VA 1Q7CA 4I5GA 2O3RA 2YV3A 3G1TA 1HZZA 1N2SA 4NK4A 1B8UA 3SLGA 3F47A 5AQ1A 3EC7A 4EBFA 4DPKA 2GCGA 1GQ2A 3PZBA 1P1JA 2D2IA 2BI7A 1PGQA 4XA8A 1P1FA 4RDHA 1T4DA 1EFKA 3MZ0A 3NDJA 4IBOA 1E3WA 1GFSA 1I33A 1X1TA 5DDIP 4MP3A 1P33A 1PR3A 1E6WA 2VWPA 4FB5A 1BVUA 3P2YA 2RCYA 1H6DA 4PLCA 4B7UA 1C0KA 1PL7A 3AOEC 1U3VA 2P4QA 2AG5A 3KVOA 2Q2VA 4RLSA 5GY7A 4ND5A 3RU9A 2BFOA 1FMCA 3ZNOA 3ZV3A 1QYDA 1GAEO 2LDBA 4IZHA 1T2DA 1UZNA 4HWKA 1O6ZA 2G1UA 2ZATA 2Q46A 4QFDA 3ONDA 4CQMD 4ND2A 5CPFA 1JU9A 4RV9A 2FPGA 3GGOA 3LT4A 1GZ3A 3F6YA 3I9LA 4LSMA 2ZTMA 1HWYA 1W6UA 3NJ8A 4YAJA 5JNLA 2JHGA 2X9VA 1N7GA 2RIRA 1W8DA 4DC0A 3RIHA 1LSUA 2EF1A 3DZHA 5IF3A 2W2LA 3P5SA 3LU1A 3I9KA 2JFHA 5BT9A 3IIEA 2VHVA 2UDPA 2YDYA 3FRJA 3WWYA 5A03A 4B8WA 2NQTA 3H9GA 1IPEA 4MVJG 2EW8A 1ADFA 3D5TA 4XCVA 4DWVA 1FDUA 1MG5A 1X13A 2X0NA 3TFQA 3TOZA 3HHPA 3Q1LA 3HE3A 5IDWA 2OP0A 4YJFB 2AEJA 5IZCC 1M66A 3TWOA 2E6UX 4FBGA 3PJDA 3TSCA 2EWMA 4BNZA 2UVDA 1ZJYA 3A9WA 3ZWOA 3PZRA 1NNUA 1P1HA 2EHDA 3WNQA 2V7PA 1H5QA 1X7GA 5IG2A 2P9CA 3ETGA 4E31A 2GR9A 2Y0DA 4Y67A 4YAEA 2WE8A 3UAGA 2ZTLA 1WLYA 4YDRA 3SJ7A 4GKVA 4WEOA 3IS3A 2OBNA 2HUNA 3HN7A 4U0JA 4YTEA 2EJWA 3DOCA 3GDFA 4CUJA 1SC6A 2LDXA 5A9SB 4FJ0A 3ULKA 4FGWA 3ETEA 5JMWA 4WCFC 3C8MA 3L9XA 4LRTB 2A92A 1I3NA 3I6IA 1N7HA 1E0DA 5HA5A 1IOLA 3F1KA 3PLRA 1VKNA 3R6DA 5FFFA 4GLLA 3MJTA 1ZUD1 3ADPA 4EZBA 2Q49A 4WEQA 3ST7A 2ET6A 4MVJP 4FCCA 4R1SA 3TQHA 4Q39A 4D0SA 4XYGA 3TZKA 3RUAA 3VTFA 3H5AA 4NG5A 1F06A 3RUDA 1BWSA 1R37A 4UAGA 2HO5A 4FFOA 3ZU2A 3PQFA 3M2PA 3AM4A 3KLPX 1M75A 3WFIA 4D44A 3NT2A 4XIYA 1O8CA 4BIIA 5EINA 5IXYA 3GEMA 1VL8A 4BNGA 4ZU3A 2FOIA 2VT2A 4KQXA 3ZWWA 3QVSA 2YHUA 4KMSA 1E7MA 3VH2A 2Z1MA 5TGDA 3VH3A 5J23A 2I9PA 4M86A 3RBVA 4E5NA 1EUCA 1ONOA 3EVNA 2Y05A 4R16A 4YXFA 3BMCA 1R0LA 3VPXA 5TT1A 2QG4A 4PVCA 4FJ1A 4CL8A 3RQSA 2AHRA 1B14A 4NMHA 1V3TA 4BKOA 2OFPA 1MUUA 3JYLA 4BV8A 2AG8A 1H94A 3GNTA 4OXKA 3AJRA 5FWNA 2VRBA 1G6KA 4EJMA 1A4IA 1HLDA 1ZSVA 1U9JA 2X9NA 3BMCB 1KERA 5I8ZA 4MVJM 4KWHA 1EDOA 2HK8A 5MGBA 3G0OA 3IUPA 4NK5A 2QIOA 1TVEA 4RPHA 4BO3A 4CMIA 2X0IA 3BXXA 5DN9A 3UUWA 1DXYA 4FFRA 4AL4A 4O5OA 3MOIA 3LC7O 1LXCA 3HFGA 2BH9A 4OHUA 3C24A 3AFNA 5EN4A 1K6JA 4L4RA 3T7EA 2VCYA 2QRJA 1NX6A 1WAMA 3DHYA 1W73A 2A35A 4CR7A 4GWGA 1VL0A 2PFGA 3DZIA 3PFFA 5JAIA 2HQ1A 1K89A 4ZQEA 5KVCA 4Q3EA 3AW9A 5TNXA 4QO7A 1ZCJA 4BMNA 3L6DA 3U0BA 1HYEA 4KUEA 4ID9A 1WDMA 2VUSA 4HX5A 4MIOA 5HS6A 3WBFA 4AJJA 5A02A 3GUYA 3GEGA 2C7GA 3DZFA 3LC2O 1QYCA 1P77A 2O3SA 5ER6A 3NGXA 4BNIA 4YRDA 3BAZA 3COSA 3DTTA 4IJVA 4MIYA 6ADHA 3TFOA 2AQ8A 1UP4A 2Y0EA 3CSDA 5KJ6A 1Z74A 2IZ1A 1HXHA 4YRBA 1YB1A 1MXHA 1VJ0A 1PGJA 1A4UA 5T5QA 5I9MA 4DQXA 4HNHA 1OFGA 2Y1CA 3H5RA 4CM8A 1E1NA 2JL1A 1DC6A 1NVMB 1ENOA 2VYVD 4BGVA 1YKFA 3VZPA 4B3HA 4PLPA 3ROQA 3ZWVA 3KRTA 5L9AA 1BXGB 3D4NA 4XQ9A 4K26A 2PZKA 4LVCA 2IODA 3GF4A 4FS3A 3L0DA 2BFMA 4YJFA 3CINA 4JBIA 4R9SA 4Y6PA 2DVMA 5COBA 2GRAA 1MGOA 1WW8A 4RQUA 2JAPA 3ZNPA 4MVJA 1NASA 4KUGA 4XYLA 2YY7A 1LLUA 5IAAA 3VKVA 1ML3A 4IJWA 4NI5A 2QZZA 3ZWPA 5L7TA 4IY1A 4XGKA 4E12A 2YV1A 3U9LA 4PG8A 5I7VA 5H83A 4OYRA 1ULSA 3ZZNA 1C1XB 5KIAA 3SC4A 1XYGA 1Y1PA 3ZW8A 3TOXA 4UREA 1BXZA 1TT5A 4CV0A 2JJYA 5ICSA 4CLHA 1FK8A 1MFPA 3GZNB 4IINA 1ZIDA 3GZ4A 1Z7BA 4JNKA 4OGWA 3DAFA 5L4NA 3WSVA 1U7TA 4FIZA 2RBEA 3H9EO 3W1VA 3PWKA 2H9IA 1GL3A 4HKTA 3JD4A 1NVGA 4OSOA 4DYVA 2AQIA 2ZCUA 1T2FA 1YJQA 1BRMA 3R1IA 4DREA 5DP1A 1SOVA 2BD0A 4R5HA 2X7HA 3H7AA 2PH3A 3ZWMA 1JKIA 2FR8A 3E6AA 2TMDA 1ZJZA 1PJSA 2HK7A 2ZJ0A 4MVJE 3VH1A 2FP4A 3KV3O 3NYWA 3UCXA 4NQZA 2BLLA 1PS8A 3FBGA 3KBOA 3PGXA 4KTVE 5FF9A 3W4JA 5JDIC 4AG3A 5JAQA 3VPSA 4XQCA 4RLHA 3F3SA 4DPMA 3ZU5A 3KYDA 3E5RA 4WJZA 4RPJA 3RD5A 3JQ7B 3W8FA 3C3XA 4IMRA 5DBIA 3VPFA 1TB4A 1HDXA 4I5FA 1NHWA 3CMCO 1KY5A 3QV1A 3BMQA 1QLHA 1JTVA 2NQ8A 4J91A 3ZWNA 3RFVA 4II3A 1LC3A 2IYPA 2PV7A 1RWBA 4PCVA 3A28A 3K8ZA 1NAIA 4CQLB 1UXJA 3C85A 5JY6A 4IJUA 1K5HA 2IEDA 4LCEA 1EQ2A 1YL5A 1GTMA 1A71A 1PEDA 3I4CA 4BNVA 1PWXA 3HG7A 2WD7A 3KB6A 3W8EA 1XELA 3FNGA 5KOIA 1DRVA 1PJ4A 3QSGA 3HB4X 2ZB8A 1HDZA 3H9UA 2B83A 3FR7A 2GN4A 3LZ6A 3QJ5A 4U7WA 3EY4A 2HMTA 2O2YA 1CERA 1QORA 4WGGA 4J1NA 2VZ9A 5TRTA 1T25A 1J4AA 3BHJA 4MDHA 1MA0A 2YHIA 3INGA 3CKYA 3IUSA 4ALLA 3K6JA 1E7WA 3CIFA 3DAGA 3ADOA 4NU5A 3QWFA 5T67A 3K2BA 3CE6A 4BVAA 5U4QA 1I5RA 1KBZA 1N1GA 1OZAA 3MJVA 2OUIA 4TKMA 4AVYA 2PZJA 3D3EA 1U4SA 4GI2A 4J4TA 2VHYA 4TRRA 3AUUA 1J0XO 3D5QA 2GDZA 4YR9A 3GPDG 2JKVA 1E3LA 3WMWA 3OQ1A 4B4OA 1VKOA 2ZYAA 2GUGA 3V2HA 3WLEA 1FDVA 4L76A 3OICA 4BL5A 2FSVA 3GG9A 1P9LA 5FI3A 3JV7A 4M1QA 2C54A 1FXSA 5DCWA 4IZIA 4LISA 5LC1A 3CZRA 4JJFA 3KOUA 4DYDA 1B3BA 3CZMA 4E2ZA 2XF8A 5COQA 1CQIA 5JSFA 2B5WA 5TS3A 1JDJA 3GZNA 4P4GA 2YYYA 3Q9NA 3D4PA 2DTXA 4PG7A 4U5QA 4F3YA 4IQ0A 2DUUA 4MVJI 1UP6A 1ZK2A 4BNKA 4CR6A 2PKRA 1ZEJA 2VUUA 3DXFA 3F46A 2YFHA 4L9RA 4EITA 3RU7A 3EW7A 3KXDA 3A1NA 3JQEA 1R6DA 4P4LA 3PIIA 1MB4A 1HDGO 4IGEA 5CHEA 1RKXA 3ZV5A 1N9GA 4RVSA 5ENDA 3UVEA 4AJEA 1EE2A 3B1FA 1ZMOA 3QY9A 3EHEA 4CMAA 1V35A 5AXAA 4IIVA 2AEMA 4OO3A 1JVBA 1RM0A 3OHSX 3PHJA 3V2GA 1PZFA 3GHHA 3QRWA 2PZMA 5K9ZA 3BMOB 3L6EA 1ZH8A 4FOOA 1C0IA 4AICA 4CMGA 4S1VA 4UUNA 3EUWA 1BW9B 2C7VA 1IZ9A 4G5HA 4CUKA 3VPGA 3EGOA 3K5PA 5JPIA 1C1DB 3P2OA 2FHSA 1E7RA 3PDUA 5KWEA 2VYNA 2YFQA 1LRLA 3WMXA 2EERA 4IUYA 2F1KA 1ZEMA 3I5MA 3NJ4A 4R1TA 3PK0A 4YT8A 1Q1NA 5AVOA 1DSSG 4F6LA
chains in the Genus database with same CATH superfamily
1AXEA 3NTOA 4PZCA 1XQYA 2JGKA 3FR8A 1Y4SA 2VYND 1FTSA 4D8VA 3GEHA 5HNKA 1CJBA 1RM4A 2N46A 2AI1A 3NIDB 3OQ6A 4MQ4A 4OGLA 1CNFA 4B75A 4O59O 4PN3A 1EP3B 4LWQA 4IIJB 5AICA 3AB8A 4TV8F 2W43A 3U56A 5EKSA 4OPMA 4OHCA 4R1LA 2WMDA 4MQBA 1UBCA 3QP9A 1CQWA 1ZUNA 2ZRCA 1ISPA 1PK9A 2ZJ7A 3PQDA 3UPTA 2YYZA 1OTHA 3CJQA 2DUWA 3HZOA 2XADA 4Q03A 2QJWA 5BYJA 4C0KA 5HIJA 3NVMB 4AO6A 1G20B 2QW8A 4G4GA 3QLTA 4UDOA 5BN4A 1BS2A 2M32A 4KSCA 3CGWA 1C4OA 3P9CA 2O07A 4A73A 4G24A 2C4TA 2DWUA 4JITA 4MVJD 2WT4A 4G5YA 1Q16A 4MPJA 5JH7A 4H59A 1TRKA 3KOWA 1FQWA 4K9RA 3AEUA 5TEWA 1NPTO 1SXIA 4A5SA 3I53A 1Z4OA 2DWQA 5KNDD 1PG2A 1GKUB 2ZWMA 1F8FA 3JWJA 1YA6A 2CFOA 2GK6A 3BTSA 5CITA 5K2MA 3P19A 4BE7B 5CVTA 2V8OA 5C8YB 1FQKA 3PNBA 1P7PA 1FRVA 2BGUA 5FEMA 1AKTA 3WLNA 5J5VA 3U17A 1EK0A 3FSGD 2XQGA 4MYDA 2OCXA 3C8ZA 2Z5VA 5FBVB 3N8IA 3EIXA 4DSOA 4UUMA 3T3NA 2B94A 2PLAA 3A0RB 1OX4A 1PDOA 1P2GA 1PV2A 4QLOA 4YFVA 1Y6QA 1EBFA 3PNQA 3W2EA 2YJGA 5FL7A 4QXOA 4UMFA 3BDIA 3WYFA 4CQMB 5DNAA 2B9EA 4XFKA 5G0VA 3AUSA 1FDIA 3ZHQA 2VNHA 4OGFA 4ZKEA 3TQFA 1BNCA 4BKRA 3GZTB 5DTMA 1P7ZA 2ERYA 2QTTA 2PKCA 1FU8A 1NBME 3DZ8A 5ADWA 4RVOA 4Q3AA 2XPCA 1KEKA 4PZZA 3AI7A 5FO0A 3LLUA 4D3YA 1E5LA 1KI2A 1SM4A 1T0UA 3GT3A 4PS1A 1KJ8A 3HKBA 2C2XA 3ZDBA 3QI2A 5C18A 3CZ4A 4DDMA 1R4MB 3CUSA 3IDSA 3W06A 1XMVA 4A2CA 4BJHB 3WGHA 4H4CA 3JD0A 1GSIA 2IOHA 5L53A 5J58A 1E89A 2P4HX 1IATA 2O6HA 3FSRA 3JQ8A 5FBKA 5E6UA 4EPWA 1JJBA 1NZDA 1G21B 3GGPA 2VL7A 1ZRNA 3B1KA 1ZSYA 5G53C 3V4SA 4BTLA 5IJZA 3MERA 4KO1S 3BICA 5K8TA 3VNQA 2E5LB 3TAUA 4H4EA 4XB2A 2IS1A 3KFXA 5EUBA 1DEKA 3ROGA 3L0YA 1RIFA 2H3HA 4HRYA 3H65A 2Z6QA 5U9CA 4H3VA 2HA3A 1JIUA 2ZS8A 2HYIC 1UODA 4O0MA 4W5JA 7GPBA 3PV0A 4XUGB 3MLBA 1RW4A 2GNOA 3N58A 4DMLA 4L6IA 2GTHA 3IAFA 1RC8A 1GPWB 4OKNA 2AWNA 3TNYA 3UK1A 5CFPA 2R8YA 5L45A 1YHYA 5CFZA 4K03A 1XR3A 2DKOA 2R65A 2V7GA 4KAAA 2YDXA 2XMZA 3R3HA 4MROA 4YVFA 1EFCA 2DKFA 2OBBA 1SQ0A 4CL0A 1CSEE 3BIWA 4MK4A 3D8BA 1IB0A 2OZPA 1KR2A 4XWYA 2B8JA 5AHWA 4E11A 4RJJA 1U2SA 3DAPA 4GAEA 3FUUA 1GOTA 1LDEA 4X9XA 4MCAA 1DQZA 1Z0FA 3JATA 1PDWA 4P3OA 3UAWA 4FHEA 5EWLA 3F3MA 4FDAA 4FZ3A 1BWPA 2QZSA 5HW0A 3EXHA 4EHHA 2FWAA 4V3CA 2IU3A 2C4UA 1CEXA 4WINA 3GXBA 4TN5A 1PFQA 4FE3A 3EA5A 2YN0A 1U2DA 1E59A 4L4ZA 2BJVA 1C7IA 2HXYA 2EJVA 1U0FA 1WMDA 1JSCA 4MRSA 3S2YA 2POCA 3D6HA 5DU2A 2CXRA 3X1XA 4J90A 3H8SA 4D3ZA 3AWDA 1QOQB 3KB2A 4OXNA 2XX3A 1FNMA 1YXMA 2JH3A 5D85A 3CXRA 5EWMA 4S04A 2A3NA 3UMVA 1FFBA 3ITKA 3DBLB 2G1KA 3N76A 3MFYA 3QYAA 1PLKA 4GS5A 4X84A 5DLQC 2IU0A 3T99A 3WB1A 5J2UF 2IRWA 3N39C 4RZXA 3AQIA 1CIVA 3DP9A 3K09C 4ZDKA 5IC5A 3PX2A 2CV1A 4B32A 4JYBA 3V6MA 4X94A 4HBZA 5C3UA 1QUFA 5KVAA 4IFBA 4Q1CA 1NPYA 3NBQA 4LE1A 3NBKA 2I6TA 3VZRA 3OD5A 3EQ6A 3ROPA 1JA1A 2GPWA 3KYJB 2CXOA 2PY6A 2NO9A 3FOBA 2TECE 2VZ0A 2H4XA 1DUIA 3CZ5A 2GNPA 3LP6A 4GMFA 1P72A 3INTA 1TX4B 4KNWA 3A1VA 4M87A 3S28A 2INGX 4DQKA 5IT9A 3VJLA 1WMSA 4AM8A 3ZE6A 2RBKA 1T1SA 4JYAB 3F4KA 4C4OA 1UANA 4NZYA 4YBRA 1YCHA 1N6KA 3TRIA 1C1YA 4V0ME 4EY4A 4G65A 4NBTA 3V4ZA 2VBCA 5F21A 2A0KA 2HV9A 1EK1A 1JR3A 2EFYA 1C3JA 2ZR9A 1R16A 1Z34A 4IJQA 5DH9A 1YGYA 3Q8LA 4Y6RA 1SCAA 3I8SA 4B2PA 4BV9A 5BNIA 4NHEA 4XDGA 3FOWA 4BBJA 2QZ9A 3B2QA 1SWVA 3E22B 3GZJA 4K0RA 3GNSA 3EVDA 2WYWA 3K4PA 3C1TA 3DBHB 3R0ZA 1UOEA 4XR9A 3UMRA 4JJ7A 4RJTA 1Y98A 4UXJA 1XJ5A 2H6EA 2C84A 4Y8VA 4A2PA 3W05A 2D1RA 1NWCA 5BNWA 2WHPA 4RH1A 4D97A 4GZLA 5FL7D 1XTSA 1TXGA 1UEIA 1BU8A 1YQUA 2H7CA 3CUWA 4R4JA 3E61A 4B84A 3R0QA 1PL6A 4N5LA 2NM0A 4IR7A 1AZLA 4N40A 4MYSA 3RASA 1V9LA 2J9YB 2ADOA 5CK4A 5I4BA 2FYTA 2NUBA 4Y2JA 3ZX4A 3UGJA 2NG1A 4GOXA 1A9TA 3ZQKA 1YSCA 2J8ZA 3MFQA 2VP6A 2Q3DA 1K06A 2PU5A 2Z6UA 1QFMA 2Y68A 2MSWA 3HWWA 2PKWA 4N0EA 1EFLA 1K7CA 4QOEA 3VKFA 4M7WA 2RGYA 3K6RA 1FL9A 3HVIA 2F43A 4AG6A 1WCXA 3LDAA 2BONA 3PXDA 2AMVA 2RGUA 3WRYA 2PZLA 3DVQX 3KAJA 3FOCA 3L43A 4AJOA 3A2LA 4BGEA 5JPDA 3OTHA 3RFXA 4OSEA 4LGYA 4X24A 1TA0A 3TPZA 2WHQA 5IFKA 4R68A 3RCBA 2ORED 4MO9A 1ZA1A 2R4UA 1EM8B 3CA8A 3EZ6A 5TJ9A 5IC4A 3JYNA 2GCOA 1C7RA 1DCMA 3H5OA 3L46A 4PBTA 4ZHQF 1F7UA 3WKCA 2Z8ZA 3K16A 4MKXA 4NIMA 4TTSA 3KE9A 2EG5A 1RM5A 1UFQA 1XMOB 3CF2A 4DJ5X 3BT7A 1KK0A 3UOWA 1F6DA 4M0MA 1DFIA 3ANSA 1A2KC 3ZX5A 5DGXA 1ADBA 5CB4A 2RB4A 4QRIA 4K9LA 4EYOA 5G4LA 1PVDA 4DEYA 1OASA 3LPLA 4I66A 2XE8A 1MFZA 3MILA 5DT2A 1V6CA 4BN4A 2QRPA 4OEHA 5CXQA 2EL7A 3GIWA 4XX0A 3F8WA 2O59A 4BB0A 4L3WA 1Q12A 2HU8A 5LNK1 1ADJA 2Q99A 1XTRA 2DHDA 1GARA 2HCRA 3PFHA 2IU4A 1FUYB 2DU8A 3HI6A 3G59A 2NACA 3BJRA 3ZBUA 5JDIA 3RI3A 3UHFA 5AVTA 2A6PA 4RFSA 4ZO4A 3B1ZA 2QYTA 2YY6A 4PNEA 4DRXA 4QASA 3SQMA 5CBKA 2KQUA 1KIFA 3P2KA 3LUHA 1HM5A 1CRLA 1BFKA 2LXNA 4Q93A 1P5RA 1MT0A 1ZGHA 5THQA 1C3LA 2G80A 5BO5A 2XXBA 3S2EA 2C7RA 2ZYVX 1IG0A 1U3WA 1WCYA 5ADUS 4H0CA 1JQDA 3PC4A 4B3FX 1JEOA 5LXTF 4BUCA 3EA0A 2Y3IA 4JC5A 1IM5A 1YUBA 1JFFB 1Z15A 2YL2A 4IEEA 1KE2A 3U1BA 1IUKA 3E9RA 2G4LA 1Q2UA 3VC1A 7REQB 3TTYA 1HL3A 2GYYA 4ACAA 2H9AA 2OCKA 2GPSA 2RGCA 1GZVA 1YBMA 1RBQA 3ZDAA 4QOIA 1IRXA 3E8XA 1IJKA 1MBZA 4B3SB 3ED1A 1R8XA 4HN4B 2H8KA 2QRVB 1ZYUA 1U99A 2VSNA 3IELA 3GG2A 3UGKA 1LBTA 1IHYA 2R8BA 3U3OA 3GAZA 2YHIB 3H5LA 1IYZA 2ECPA 3HB9A 4MGEA 4QJIA 1RAIA 5AKIA 4ZAGA 3GLGA 1GM5A 1GZ7A 3ZHUA 2ZSFA 2ZM5A 3S68A 1RI4A 1C7EA 3QMWA 4HUJA 1AV6A 1GSOA 3X2FA 2DLCX 3H99A 4LJ5A 2N0SA 3TVDA 3USCS 4BCDA 3LKZA 4V3BA 5CXSA 1KTVA 2XBUA 4LMRA 4TVKA 2J33A 5TQVA 3T3EA 4EMTA 2J45A 1FQJA 3UFXB 2VAXA 2OO5A 4KTTE 2YWCA 4B76A 2ZETA 2YYAA 5LN1A 1P9OA 1ODFA 4CMJA 5IXSA 3SWWA 4MP8A 5ISMA 2D06A 3SYRA 4GM1A 1KZ6A 3REFA 3T7AA 1HDIA 2PJRA 4ENWA 5DI3A 1FE8A 4IQFA 3QUQA 3HKDA 3ZCXA 3V3KA 1W29A 1KY4A 3WKEA 4ML3A 2MDTA 4XGNA 1L3BA 2VQSA 4BS9A 4A0QA 3MJEA 1CVRA 3Q2IA 5JFOA 3ONEA 1EVQA 2D0DA 3U3MA 3VHRA 5G4KA 4OG2A 5JJ5A 2QNIA 4JYPA 3SIXA 3GJXC 1RXCA 1VFPA 3LCUA 2Y99A 3OG9A 4DCTA 2PUTA 3NM6B 1U11A 4IRXA 4R5MA 2G70A 5CH3A 3R3SA 4UVEA 5ED4A 1JQLB 2VF2A 3V8PA 1JR2A 3TQTA 1Q1GA 2Y71A 4YAKA 2ZXUA 2ERCA 2PSJA 4HHEA 4WKGA 2OFOA 4FXOA 3PHBE 4BVLA 1CT9A 5BWBA 4FYPA 4KU4A 3LTEA 1VJCA 3NRCA 2RI1A 3R3VA 4ALMA 5KYWA 1HTBA 3I8OA 5KVSA 1B1AA 3VR4H 4E1AA 3PKJA 3JQ7A 1BJKA 4RCZA 2PX0A 3BXOA 2IBSA 1YKSA 2ZI6A 3P9IA 1XVIA 1EUDA 1GIAA 4JFRA 2O3TA 1F3LA 2F8LA 1ZNZA 3LXXA 5EE0A 3T9DA 3WY9A 5EQDA 2ECQA 3VPHA 2QAIA 4WZBE 4QE3A 5EESA 4OHKA 4MVCA 4B7AA 1PD1A 4ADSG 1GYPA 3HNOA 2IX3A 1P2VA 3M1IA 9ABPA 1Z6PA 1NLZA 2IUUA 3X2SA 5JUWA 3IT2A 1JWLA 1Q15A 4KLRA 4EQ6A 1FY2A 4LZLA 4MGYR 1VLJA 4D96A 2WUGA 3NORA 4I2NA 5HUQA 1PFUA 1OJLA 1CEEA 3PL1A 1UK8A 4JBHA 3JRWA 2FN4A 1JIQA 4PLHA 3D1LA 4ZV4A 3TE7A 5IUNC 1U2EA 4MUGA 1G66A 2HGSA 4TL9A 1ZMRA 4KWEA 5CT8A 1I36A 1QIMA 2QN9A 4N54A 5E3IA 5AXBA 1VIDA 4O4JA 1F8XA 1KVTA 2YVQA 3IE1A 2QG6A 1O2DA 1ENYA 3AV0B 3IOCA 4EA9A 4J7XA 1DINA 2I3DA 4G0XA 1MENA 5JXGA 2GCEA 1JZTA 3FCOA 1PK7A 1Z7EA 1UP7A 5IJ9A 4X3CA 1QTNA 4FFBB 2E5FA 4U9HS 2CVZA 3PRJA 3K31A 4UM9D 3SZOA 5CEFA 3FTFA 4BC0A 1EIWA 3ZHXA 1P7YA 4TL7A 4WPGA 1KDPA 1RQ2A 5EJGA 4EW2A 1KZGB 1QZUA 1YZFA 3MXOA 4HEA6 1O8BA 2XLBA 5FA6A 3KYDB 3ZD7A 1R8YA 1U5BA 1QB8A 3QE0A 1F6WA 4KXMA 4CF7A 2BP7A 1GZ5A 4BKMA 1LPSA 3WNZA 3S7TA 3HO1A 2YOGA 3QMVA 3SNKA 5CEJA 3DD5A 2BMFA 1PP4A 1IQRA 2I1WA 1OBCA 4WKBA 5JMOA 3NAMA 3FFAA 1XWIA 3DCJA 4HYYA 4UPVA 1RRPA 1W85A 4NY1A 1D04A 2WU1A 1OFVA 4E7OA 3SFZA 1WDKA 5HJ7A 4G84A 3G9ZA 3WL6A 1E8MA 3I45A 1PJRA 4BLWA 5DF1A 3EGXA 2NW6A 3AFGA 3D4LA 3JRXA 5CK5A 1M2VA 4BLUA 3HO8A 5BSVA 3ZGYA 1GL9B 1LS1A 4H6XA 1OXBB 4PF1A 4DJAA 4L6AA 3U3RA 4LFBB 1KETA 4DB2A 1NYTA 3C98A 1SCDA 2KW5A 2ZSAA 2VP0A 1CRQA 1YRQA 2FMKA 1MD9A 3CWQA 4LCBA 1CY2A 3PS9A 1I1QB 2B7LA 2GWHA 5DM4A 1UBLS 2A5JA 2P40A 4JXKA 4XIJA 5LQMA 1SHTX 2PUBA 3GJRA 4OLFA 1FSGA 3W3AA 1BZYA 2BEKA 3R5SA 4WBNF 2HJ9A 2BZ1A 4XQ0A 1NLYA 3FTCA 1JA9A 4NLLA 4WXYB 4R1MA 4DSZA 4N9WA 4YRTA 1ZN9A 1LH0A 2QSYA 3G0BA 1FP4A 2CFRA 3FNFA 4S1TA 3SBDA 4C5BA 4OI4A 1KYVA 3LGXA 4CEJB 2CNDA 2DFTA 3CTPA 1ZK0A 3AGPA 1IY9A 2FFHA 5A3SA 4MW2A 1EXMA 2ZJ5A 4L5BA 5JCOC 3DC2A 3BTVA 1XKXA 8ABPA 4EEKA 3KSZO 3ADBA 4ER6A 4RA9B 1T0BA 2WU8A 4TT3D 5BYBA 5EZ6B 3VC2A 1W5FA 3LV8A 2AW5A 1Y7IA 4GMDA 2CDAA 2H1HA 3SJCA 5FWDA 3N8DA 1MHTA 1J8DA 4EDFA 5EUCA 3FAKA 2G1AA 4YECA 4BQQA 4BOYA 4B7ZA 3WGYA 1OJ7A 1GV1A 1TUBA 1ST3A 3P5BA 5HWSA 2BSQA 1IHPA 3IAS6 2WP0A 3FHJA 5LVAA 2DFLA 2CHQA 2UYGA 2WTBA 1P0PA 3B6MA 5J63A 4F0JA 3R9XB 4NXNB 1V11B 1W36B 2O0KA 4DY6A 5A7FA 2NVWA 3DHNA 1DTWA 4FINA 4PR3A 5JCJA 4ND4A 5LZ8A 5EMJA 3KM0A 2NX2A 1N2ZA 4U8GA 4JI6B 3TKAA 1IZ7A 2Q1TA 5EMHA 3CEMA 4GQIA 4QOHA 3Q9LA 4WKPA 1LNSA 2JCVA 3FY4A 3RODA 4OAQA 2DJIA 4FMDB 4NABA 1XF9A 3IA7A 2YWGA 4YT5A 1DJMA 4IF4A 2BTQB 4EYEA 3RC8A 3MWLA 4OSPA 4OY3A 1PJ2A 1WB5A 4C0JA 4IGAA 4QGGA 4DBVO 2QD2A 1BGWA 3QZUA 2FUNB 3CEJA 3GMSA 4ED9A 5IFLA 4XB6B 1UKZA 3U4AA 1JW9B 1VOTA 1Y5IA 5AI0A 5K3EA 3QY0A 4MWGA 2EJTA 1U2QA 3ACBA 3PJGA 1I7PA 1O87A 1RI3A 3MLEA 1Y3IA 4YMVA 1LI4A 3B3QA 1YS6A 1OIXA 3KZVA 4XM0A 1IDOA 3D43A 4RCVA 3K0HA 2GK7A 1ZR4A 4TKUB 4O6VA 4YCSA 1ODIA 1WM1A 2Z8YA 1OLXA 4NBNA 3HBNA 3Q8WA 5FR2A 2IPMA 4UU7A 3FKSD 5ESXA 1CR0A 4PLGA 5G0WA 3STHA 4C05A 1KQFA 2IYNA 4DLAA 3W6PA 4XD2A 4OBWA 3E03A 4MWCA 1ZHOA 3KPJA 2PK3A 1ECCA 1RS0A 2BHNA 1GDDA 1OLSB 2Z2JA 3LCCA 4ZD6A 3CU5A 1I80A 4GOOD 1MW9X 1VE3A 2IZ6A 1ORHA 2RH8A 4AI6A 3M5WA 2WQ7A 4PHTA 3PE6A 1ND6A 1K9SA 1QU2A 3A9TA 1CDDA 4IM7A 2JVJA 1LZKA 2IF0A 4S3MA 1LDBA 3KYBA 2F17A 5NLLA 4QU8A 4G36A 4PZ9A 3GQVA 3H0KA 4KYTA 3G7SA 3IV7A 1US8B 1KVQA 2GPBA 4FYMA 1ZESA 3I92A 2I4IA 1DOZA 4ZO7A 1E99A 1E9BA 4D80A 1KXZA 2CV2A 4ALJA 2A3RA 5GIOE 2ENUA 3JPYA 5CJPA 2DQ4A 4E6PA 3ZWYA 1BQ4A 1FYXA 4LWZA 4WLFA 1U7OA 1N5RA 1ONSA 3OCCA 1BCSA 1WO8A 5DNYB 4HWTA 2J48A 4J0EA 5KUTA 1J7KA 3DEAA 4DVGA 2PNJA 3T0GA 3PE4A 4QPNA 3UC9A 5I7FA 5K8VA 4G0MA 1OH6A 3BEOA 5HPYB 3KZXA 4OKIA 1OPRA 4DLYA 3L1JA 4R8KA 3IDQA 1VLHA 2B4QA 4IV8A 2XKBA 4L4SA 3SE0A 4K86A 1EFVA 4B6RA 2Y4OA 3RARA 1WULS 2GBCA 3TOSA 4A7PA 4W82A 3FPHA 5IUKC 5KKNB 1QV7A 4RF2A 4K9OA 4TT8A 1DU4A 4EFDA 1XRQA 3ZJTA 4PZUA 4XUCA 3D59A 4XD7A 1NX9A 5LIRA 2G6TA 3FB1A 2HDWA 2CD7A 2EDAA 2P30A 3AOGA 4KX3A 4KNVA 1CJKC 3AERA 1Z4JA 1OAOA 3CRRA 4J03A 3RAPR 5CNKA 2C8VA 1ZINA 3UHOA 5AW0A 3FIUA 3CWCA 4IDCA 2I67A 3QYPA 1N2EA 3PFNA 4MV5A 3TQSA 2IOFK 4F85A 3A3NA 1I01A 1L6RA 2OCBA 3IBGA 1A27A 3NIFB 5AI6A 2HMAA 4BO2A 4DQVA 1XNGA 5DK6A 1CB0A 2RG7A 5E8JA 1I30A 1UKAA 5HKLA 1Z6XA 1E3JA 2XTNA 3AHHA 5TMDA 1S4MA 2R5NA 3VM6A 4EUHA 5B12A 2QQEA 4RZUA 4UBJA 4PLTA 1ZSNA 3P4UA 3WYBA 4YWHA 2Z1NA 5BMVB 1MIOA 2HYDA 4WXRA 1J8YF 1E2LA 2L69A 3ICPA 1LRKA 1K86A 1RAEA 2ZRDA 3ND5A 4EH1A 1GXSA 1T9GR 3GPLA 3TECE 4GUDA 2HR1A 4CE6A 1Z63A 2YZKA 2ZSUA 1MP0A 3I72A 2HT1A 3O94A 5FQOA 4BP8A 7YASA 3EQ8A 3S1LA 4F38A 4JP2A 1VA5A 2WFLB 1OZFA 4UZSA 2H2WA 4A23A 1YQGA 2XOEA 2IYOA 3E7PA 4IRUB 3RVNA 5A4IS 1V3VA 5AJZA 1ODTC 3LG2A 3WP1B 4V1CI 1IK6A 1MO5A 3HYSA 1U3GA 3KVVA 4KK4A 4H3SA 4M9ZA 1Z5NA 3N2IA 4HS4A 2A30A 1CIPA 5A5FA 4GPTA 2HX1A 1F0YA 3ENKA 4OK6A 3IE0A 2NSLA 2C5BA 2CXXA 1QS0A 4AULA 1C0EA 4FGUA 4ZCRA 4GNKA 3L9WA 2DLDA 1CJSA 2ZI5A 1OT3A 3O1IC 3X0DA 1WUJS 2NYAA 3Q7SA 4EW1A 5ITVA 5EEGA 5LD2B 1II0A 4LZAA 2DHCA 2OD7A 1OF1A 3H6HA 1KY3A 4RVUA 3SHVA 1REQB 1JGTA 5AKGA 3OIVA 1O94A 1PV1A 3QYFA 3SF8B 1ZGZA 1PQUA 2GHRA 2J3KA 2GEFA 3CLSD 3R0IA 4X71A 2ZBFA 4RJKA 1T1EA 3ESBA 3T5BA 1IH8A 1HFWA 1PD0A 2OHJA 3GDHA 3FLMA 1XZAA 4NU6A 3T61A 1A8SA 3FDZA 4LQLA 2WG0A 3W6ZA 1V8OA 2WF5A 1DZ3A 2H52A 3AYZB 1DWQA 2F8SA 4EKIA 3NHYA 1XE3A 2JF0A 3JX9A 3NDIA 4FNAA 5B3JA 5CG2A 3K6SB 1O0CA 1WETA 4X65B 4PM4A 3RWMB 2C1ZA 1GZDA 1YBVA 2QV7A 4AT1A 1J24A 1SUEA 3PD1A 4MQFB 1RMTA 3H2IA 3S2FA 4V1CA 1RXSA 4EPYA 4I1SA 1ISMA 1RI2A 3KHUA 5L6MB 2C4VA 3ABZA 4E1BA 3EXFB 2VQ3A 1ML4A 1ZUHA 4JVMA 5TQ0A 3RIGA 4DMRA 1Z38A 2CJFA 1SUSA 9GPBA 3EPHA 3EEQA 1LBIA 2VR1A 4NNOA 5H9VA 3Q88A 1DVRA 4GBGA 1FPMA 1QFXA 4GKAA 2JH9A 1ZD3A 3LUDA 5HQ3A 1EXVA 5G3ZA 4RHYA 5M29A 4FMDF 1YVPA 4ZOQI 1Z16A 1LGYA 3GRAA 1OCEA 3BORA 1LSOA 1JHZA 1S0UA 2GFIA 3BMNA 5DLPA 3RS7A 5C1PA 3EFEA 1QHHB 1RVDA 4Q82A 2XRYA 3BBLA 2V9PA 4J16A 4Y2SA 3SYLA 2Y6VA 4HQNA 1IWPB 4RF3A 4NE2A 2RH4A 4JL8A 4B3RB 4RIIA 1SPXA 1ZU4A 2NU8A 3G1UA 4R8MA 2I0FA 2NUAA 3UWOA 5BSWA 4QG3A 2OILA 1SA0B 2GEVA 4KXLA 4PYIA 3NNSA 2NU9A 3KZKA 3FVRA 2EKDA 3JZMA 3IKVA 2CL5A 3N70A 4FYHA 1WZUA 4S05A 3EDQA 3K92A 4UNIA 5BUZA 4QUKA 4TTVA 5AYVA 4K3UA 2FPPA 2OC4A 2BEWA 2NLOA 1JB1A 5AVXA 1YB7A 4FE7A 5EL0A 4BJ1A 4Q9JA 2JGRA 1U63A 4KQGA 2JFYA 2BGLA 1JSXA 2O2EA 3A2MA 3M5DA 4EBBA 3CH7A 2Q28A 2W4QA 3FCYA 3N2YA 4LXXA 2WU0A 3CIOA 5HBRA 3ZPXA 4NP6A 4EKGA 3MGKA 4DF3A 2VJPA 2V7TA 3IT1A 1XZQA 1PEYA 4LMPA 1E60A 3QU5A 4J49A 1X3SA 6ABPA 4OQYA 4Q7MB 3RHTA 3L8GA 1I13A 5C8DA 4Q02A 1OREA 4AZ0A 3DC7A 4L7QA 3SICE 2XGJA 1H2BA 4C4YA 3BQMB 3R6GA 3HY3A 2KSQA 4UM8B 1MQ9A 3RVBA 3WR5A 3OKCA 3AHFA 1NN0A 1PS9A 4MQEB 2FFJA 2BI4A 4XDZA 4ZZIA 3P9ZA 3LLSA 4KN6A 3DL2A 3FHLA 5E6RA 2O54A 3TIGA 3IV6A 1JJVA 1GZ4A 1N0IA 4HEHA 5ALFA 3G8CA 1U0JA 2GLUA 1WW3A 3AFIA 5KDLA 5BYKA 3NWBA 2QDXA 1ESCA 5HFJA 2YXLA 2R6ZA 2FX2A 4TSRA 5P8WA 1N2BA 2IA5A 1RYFA 4IMIB 2J59A 2I7DA 3SNHA 3WFZA 1HL7A 2QTHA 4IGFA 3SXUA 4ZICA 5AK5A 4HTFB 2HV8A 4IDAA 4AYTA 5D3MA 1BO6A 2HLNA 4I9NA 2BZ0A 1SUPA 3BSFA 3Q7QA 4HLUA 1TCVA 2PUGA 1XBTA 2C98A 1PE0A 1GA4A 2I80A 3GGDA 3RROA 3AIOA 1SU4A 1RHRA 3DD1A 3HLKA 2IPNA 1ULBA 4NMWA 3QX7A 4TPKA 3COJA 3LS2A 3V2IA 5LYJA 1B8NA 3ZZMA 5BN5B 4C7XA 1R27A 3EFBA 3IQXA 2IYQA 5K3FA 1SD5A 4D82A 2GBLA 2PWAA 5GINE 1XNHA 5D00A 4KDFA 4DDTA 4QWMA 5EFOA 5IVKA 2XMSA 2HXSA 1F9EA 4G5GA 5MN6A 3NIWA 3BD9A 3R24A 3AX6A 3QWAA 1N92A 1RJ9A 2XUJA 4MW7A 4CCWA 4QBGB 4RUKA 1NOIA 1H69A 4RSHA 3DE7X 4AJ9A 2WFAA 3LVFO 3MGBA 3T9CA 3UMJA 1F4VA 1E69A 4B33A 1QH1A 4UVIA 5AOCA 1O5TA 1KNQA 3NQ41 2WINI 4MHOA 4R9VA 1O89A 4EX6A 3GD7A 4UULA 4EF6A 1U7HA 2Z8XA 2O05A 1ISIA 3G2HA 5JSZB 4BASA 2FPLA 3F2IA 1QIKA 3D2LA 2VDWA 3GJ3A 2PA0A 3QX9A 4IG9A 4YMUA 1I7QB 1SKYB 1XLTA 3QW4B 3TE6A 4BFLA 4LBWA 2EKLA 3K9QO 3F5MA 4S1OA 4U3JA 5CUQA 1PFVA 4G9BA 4TUYA 4L9SA 1O54A 1LPAB 4YMGA 1KI4A 1U0NA 3UA3A 2EEPA 5KREA 1S01A 2QUJA 1G9SA 3DZJA 2LV8A 4K1LA 5E6SB 5LA6A 4U7PB 3WO0A 5B1YA 3LY9A 3RHSA 1RNLA 2WWHA 4KWIA 5K51A 4YWJA 3CVVA 4OU5A 4ARZB 4P5EA 4KAFA 1LDGA 1AT1A 1ZCZA 1THZA 5E2BA 4F06A 4ENPA 1XCBA 2OCLA 1U1FA 3T5GA 1QRUA 3D1VA 3L06A 4EI7A 5J47A 3EVAA 5KQMA 1LBSA 1KEVA 3Q12A 3HJTA 1FDSA 2P7IA 3MRSA 3UT5A 4JT8A 3VU1A 4CBVA 3VRHA 4C7JA 2QUZA 1U2GA 1I7SB 1HSZA 1UAYA 4MRVA 4NENA 3SI7A 4F12A 3OE1A 2V97A 1MAWA 2JK0A 3T7KA 1NYLA 1TM3E 2GBPA 4WZZA 3EZ9A 4KQWA 1KQOA 1T2CA 1VBMA 3R7SA 4AZWA 3UGQA 1PHRA 4MWEA 3PYLA 4KXNA 1QYXA 1Z17A 4URHA 1EKXA 3KWMA 1Q1QA 3SJZA 1XALA 3ZDXB 5G40A 1VL6A 2AF3C 3H1FA 4DARA 1T2VA 3DUWA 2OQ2A 2ZCVA 3HRIA 3IO3A 4B4WA 4BQOA 5KAMA 3E84A 2QSZA 1TKAA 4M9XA 4N3BA 3W7AA 1W4RA 2C77A 4ZFNA 4IFTA 4LPSA 3B48A 1JPVA 1Q6ZA 1V8ZA 1WZIA 4MI1A 1OPXA 2PVCA 3QHAA 3VNBA 3LTNC 4NYMR 4E08A 5DYTA 3ZCTA 4E4RA 4AMYA 1WUIS 4B48A 1R6VA 3DULA 5KTSA 4RVFA 3IEMA 3PXUA 1T3TA 4C0AC 3TMKA 4FYIA 3VOSA 2DTDA 3BFXA 3GBPA 1OTXA 1JMYA 4C20A 1Z83A 2VDKB 3BKXA 1ZVVA 2R1TA 4I6GA 4C29A 4Q21A 4B79A 1IC6A 1P6XA 1PI3A 2CF6A 4NBUA 1RADA 1Z82A 4H1VA 1K8YB 2JZOA 1OA0A 5GIPE 4AUKA 4NV0A 2X2EA 3R6LA 3ND7A 3Q3GE 2GA8A 4Q4AB 4CRWB 2J5RA 3W6OA 4EATA 4ZYXA 4I1PA 1K7XB 3NC0C 3OZWA 3SQDA 3L8DA 2DH5A 3I3OA 5TY0A 1DCFA 2IWHA 1A5AB 2C3YA 5DT9A 3ZV6A 3VDQA 1HGXA 5IKXA 1F5SA 2GZ2A 1YDMA 4EELA 2BFDA 3DFZA 3EWSA 3LHSA 4QG7A 4ZU6X 5JDCA 5EE3A 2OCIA 1OC2A 1MO4A 2NO7A 3ELUA 1AQIA 3F7MA 2WJ4A 1WTAA 1ESMA 4DY4A 4RVGA 1ZS9A 3WADA 4YB8A 3SMVA 4I4LA 3R0XA 4ZK6A 4JJAA 2I6UA 2JI7A 3CNHA 4KVGA 1Q77A 4L6CA 3GX1A 4HGNA 3ZYZA 2IH5A 1YOBA 2XDWA 4ALKA 2XIJA 4BMVA 1JT2A 3BHIA 1PZMA 3HMKA 2REXB 3OJWA 1GUAA 3FUVA 2VJMA 2XCLA 1M2OB 2YQZA 3ZXXA 2GO7A 4D6PA 2TMGA 2D13A 5KJ1A 3OTIA 3UAVA 2JD1A 2XUQA 4EHKA 2QTFA 1X9GA 1L7DA 2OEPA 4K6FA 4LYEA 2WZCA 4MYHA 4WZAA 3TLGB 3BRCA 3VSDA 3UENA 4DMMA 1E20A 1QIGA 1YDWA 3RUFA 3SHWA 4BAUA 1ZQ9A 3L41A 1FFCA 1H9CA 3STUA 4TRJA 4N41A 1I2AA 1SRRA 1D7OA 5AR1A 3STVA 3L40A 3L8EA 1SBCA 4A8PA 1O6GA 4DA9A 4EJ2A 3GELA 3BZBA 3FYUB 4ETMA 1KYQA 2BRUA 4IDEA 1ZW6A 4IXDA 3K94A 4KGVA 3OX4A 4EQZA 3USZA 4IJ5A 2K87A 4ZT2A 1JZQA 4QQNA 3KP1A 2O2CA 4H3KB 1I8TA 2C58A 4PR0A 1NPDA 4U6SA 3LUGA 2JJ2D 2X1HA 1X14A 1CRZA 5DTJA 2BKEA 5M34A 4QBKA 2KHZA 4KYUA 4UUAA 1S2GA 4NESA 1EWRA 2ZYIA 4CN8A 4FX2A 4QUIA 3DQZA 3M2TA 3SOZA 1P2BA 5JXWA 2J6CA 1DRJA 1PTJA 1FU7A 2AX3A 4LF9B 3I34X 2QTVB 5TGZA 4YY3B 3D02A 5AQEA 3AQ4A 4P58A 4PZEA 1ZNWA 1YVDA 1E5QA 1LNZA 3Q0IA 2J6IA 3QPUA 4P38A 4JOQA 3VOTA 4YV1A 5AP9A 1CK4A 4FEGA 4P84A 2D4AA 4K46A 4YBZA 4B81A 1MG0A 3QXXA 1Z62A 3CUKA 5K4AA 3M89A 5T4BA 1TT7A 3JYPA 3LMKA 3ERCA 3RBZA 1CEQA 4Y6QA 4B74A 1IUPA 1L7NA 1NUSA 1V37A 2YFYA 3K2EA 4U2KA 5KYXA 3SZRA 5CDFA 2MOKA 2BEVA 3FNBA 4JCCA 3VISA 1TO6A 1L7MA 3NDRA 2Q50A 4F86A 4EGAA 1JHPA 2Z95A 2DBZA 1NR5A 1WLSA 1A1SA 5LZ9A 2IITA 1GVNB 1XZFA 1LX7A 5ALPA 1R00A 3VKWA 4NC9A 2PM8A 4Y7CA 4HVAA 1EK5A 2FZKA 3QUAA 4YAIA 1JALA 3DT6A 4IGIA 1ABFA 2BFEA 2ID4A 3OBIA 4MRRA 2HPVA 4EJSB 3TTTA 3C15C 4LRWA 1I9GA 2UZ0A 2PLNA 5D86A 2ZXEA 1GPLA 4BNTA 3HACA 4MULA 4QPPA 2P9ZA 3ITNA 1NZJA 2AN9A 2F00A 1AGNA 2JIMA 3D4BA 3WYNA 4H4DA 2UUAB 1AY0A 2GYWA 3WP0A 1EVYA 1PX0A 3MT7A 5L4LA 3F73A 1W4ZA 1UEJA 3U81A 3BAFA 2AMLA 4A26A 1GAXA 1CUAA 4II2A 2II6A 5CH8A 1NVDA 3N8KA 3G1WA 2O2ZA 1YOVB 4BXOA 2XAAA 1K6IA 4BGIA 5EWJB 2IXBA 3BJZA 1PG0A 2HLPA 3JAKB 5IBPA 3RKRA 4Y1RB 2A7QA 1V3QE 4TTTS 5JAOA 3OQBA 2EJUA 1VPEA 2Q5OA 3J81k 2FCRA 3U40A 3OX2A 1IB6A 2VSYA 3PDCA 4OH1A 3RREA 5I4CA 1WHTA 5BVHB 1G7TA 3M5CA 3SQXA 1B8PA 2WB2A 3B6ZA 5K7SA 2JAHA 5ERGB 3GK3A 5CBPB 2B7BA 3B6JA 4HD8A 3HKDB 2A0FA 2IIBA 2X8JA 5ENZA 4F45A 3A6DA 4LDPA 5KHOC 2C92A 3ILXA 1CUVA 3K15A 4H7DA 1WVGA 4DRZA 1QVVA 1N1EA 4DA7A 3MD9A 1T36B 1XN1A 4IEIA 1A8HA 2AOTB 4US0R 4HDNA 4QVKA 3DZCA 2VDPB 3QBTA 2ZKLA 4R31A 4PCLA 1EVEA 1NJ1A 2ONZA 5CCEA 5H8WA 1P91A 2A0XA 4QEZA 3GY0A 4UEWA 1T3SA 2BDUA 2D5AA 3U49A 3IR5A 2FSFA 2ON6A 2V45A 3LBAA 1W0CA 3OMXA 5KNBH 3RYFA 1ECFA 2H85A 2O3UA 1F7VA 2FMTA 1XGKA 4D4GA 5DHPA 2XGOA 1WDWB 3LCMA 1EK2A 1IHXA 2FWBA 2R60A 3AKDA 4XLLA 2BE9A 5FNVF 721PA 5F9FA 5IJXA 1B15A 4FOSA 3HVUA 1B0PA 4EO9A 1X1CA 4XZ3A 4CIWA 5CT9A 1XPRA 5G1PA 1QE0A 1OX5A 2HCTA 1V1JA 3W3ZB 1KPGA 3A58B 4WNCA 3JQFA 5JBIA 2AX4A 2WYHA 3H9CA 3L8YA 1BROA 1NDHA 1I2BA 1M83A 1XZEA 1NJ2A 3C3JA 3QPDA 4XTRA 5F1KA 4F84A 1U8UA 4XASA 1VHWA 3DE4X 1PGOA 1NBOA 1V5WA 1WUTA 1XXHE 3JQFC 4QNMA 1YQXA 1M5UA 2HREA 4QUDA 5JVDB 4YCNA 4PHHA 4OIMA 3RYHB 4MJLA 1T0IA 5FV7A 2WPDA 1P1BA 5E9AA 4HP8A 3C3YA 4KN9S 1H1LB 3QBJA 4QBFA 3D6AA 4XKJA 3SR0A 5FKJA 4EY6A 3EDRA 1R12A 2B69A 2BKLA 2JJ2A 3O8LA 4X8OA 3LUBA 3ETJA 3N7UA 4EVIA 2E48A 4UEOA 3WL5A 4ZJZA 5KYWB 4RL6A 2VNJA 1W4BA 3AFMA 4FLEA 2X2OA 1DTSA 3GFSA 1QP7A 1S2LA 5CJJA 3IQEA 3X1DA 1HDYA 2QGZA 2VHZA 4BB9A 2KS6A 4MHTA 4ESHA 1U7DA 4DYVA 1LUAA 1V5IA 3DAHA 5LU8A 2ECOA 1JKFA 1GO2A 2RGAA 3CR7A 4LRSB 5FLKA 1NVTA 2NGRA 5JCOA 2P5YA 3ELBA 4UDXX 1XU9A 3ICVA 3WLLA 3JD1A 5CA1A 4RLFA 4P0QB 4MDYA 4MCIA 4DN6A 3IAM6 2AD1A 4HDMA 5LBIA 5KTYA 1XRJA 4GIBA 2GCIA 4G3XA 4DZRA 2HL6A 1SJ9A 4YPOA 3JQAB 1SNYA 4KXFB 2W2KB 3Q9SA 4KQ2A 3VUEA 5IHXA 2EBFX 1EU1A 2O06A 3CLUC 1BIFA 1DELA 1P3DA 1VA4A 2ANBA 1T3ZA 2C20A 3FZGA 3IP3A 4IXTA 2CHEA 4JQYA 4KXVA 1A2QA 1DNPA 1KC1A 1RWVA 1KNXA 2W4MA 4JP8A 2YINC 4O8ZA 4UUPA 5EQFA 3A6PC 1WPGA 3I8XA 3I76A 2JI6A 3QWIA 5B36A 2XA1A 3NVAA 1X1SA 1V48A 5I7AA 1CJCA 3LSTA 3J80A 1JHQA 3GH3A 3HDGA 3OJCA