1W0CA

Inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
276
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDVGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE
publication title Inhibition of Leishmania Major Pteridine Reductase by 2,4,6-Triaminoquinazoline: Structure of the Nadph Ternary Complex
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
total genus 98
structure length 276
sequence length 283
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w0cA00
3WTCA 1LNQA 1O8CA 4AJOA 1YL7A 1TEHA 4RDIA 2J8ZA 3EYWA 2Y1OA 4FR5A 4E5MA 5COBA 1PJSA 1PJQA 2JD1A 4NJMB 5DCYA 3W4JA 1MLDA 1P31A 5A9RA 3FD8A 5GZ1A 1KS9A 3P7MA 3A4VA 1ISFA 4YEDA 1LQTA 4GSLA 4OH1A 1ISMA 4YVFA 1QLJA 3TRIA 4RJTA 5K0ZA 3M2TA 4M87A 1S7CA 3RU9A 5IDQA 4P4LA 4CUJA 3QRWA 3DTYA 1HE5A 3DMTC 4II3A 3GNQA 5ENVA 1I3LA 4D41A 1NVMB 2YW9A 2O7QA 1ENZA 4C7KA 1V6AA 2EW8A 4YRDA 4CM4A 1KIFA 4XYEA 2OUIA 3C1OA 3GUYA 1KEUA 4RPGA 1OAAA 4B7CA 2C29D 2PR2A 2XF8A 3LT1A 3SC4A 4XYLA 4YJHA 1IULA 3L6EA 5JW6A 1LI4A 5TLSA 2WYVA 4TQGA 5C7OO 4R16A 1HLPA 1Q2XA 4UVDA 2PNFA 2A94A 3TZHA 1NQ5A 2E37A 5AYVA 3JYLA 1P74A 1HLDA 4HBGA 1A4UA 3QJ5A 2XPCA 1Q7CA 3CE6A 5EMHA 1YOVB 4J3FA 3KUXA 3QVSA 1R0KA 4L0QA 4N18A 4JJGA 1KY5A 1G1AA 2AQ8A 1A9YA 3KLPX 5FFFA 5KCZA 1KYQA 3INGA 3NT5A 4ZQFA 3OIFA 4HFRA 3UVEA 4L8VA 3WYBA 1HYEA 1LRLA 1ONOA 4C4OA 2O4UX 2ZJ0A 2G0TA 4QT0A 3V1TC 3LC1O 3HUDA 1ZSVA 2Q2QA 2QZZA 2O4CA 1PJTA 4B3IA 1NX6A 1JW9B 2WD8A 4EBFA 1EEHA 5L3ZA 3KB6A 4CLOA 1FJHA 4CM7A 1U2DA 1ZKMA 1H9BA 4BNTA 4JK3A 1Y8QB 1YJ8A 1A71A 1JVBA 1ZH8A 4CMHA 4MVJM 3ORFA 4CM8A 2ZTMA 3AOEA 4OOFA 3QE3A 5THQA 2ZTVA 3W4IA 1NHWA 1E1LA 4IGFA 1YKFA 4OKIA 5DP1A 4KQWA 3OJLA 3R3SA 1GQYA 1GL3A 4UULA 3VTZA 3VPGA 2YHIA 1I8TA 4R1SA 5T6BA 3H9EO 3GG2A 4E4YA 1LSSA 2EGGA 2Y93A 2X8LA 3JQ9A 4FBGA 3I9MA 5A05A 4RLHA 5DBGA 1PJBA 5H81A 1C3VA 4BNWA 4BOYA 4I5EA 4CM5A 1E1NA 2P4QA 3H9GA 4W7HA 3K92A 1IL0A 4UVIA 4PRLA 3ZW8A 1VE9A 4MP3A 2VNAA 1PR9A 2EV9A 1E3SA 1Z74A 2Q99A 4H3VA 4ILKA 1J5PA 3AY3A 2G76A 4U0JA 1QSGA 3B1JA 4J49A 3ANMA 2G5CA 1A72A 3OA2A 3DBRB 1GY8A 4S1VA 1VM6A 5TJHA 2F00A 1N1GA 4D3SA 3BYZA 4TZKA 1NP3A 1WW8A 1Q7GA 2Q1SA 2JD0A 4EI2A 4IJKA 1YVEI 3GLQA 3WGGA 3HWRA 4ONEA 4II2A 4E6PA 4XR9A 5U4QA 1N9GB 5IDYA 5DP2A 3UHAA 3ZGYA 1MGOA 1PR3A 4XZ3A 1HDCA 4NFSA 5DBIA 1VKNA 3UCFA 4OYRA 4ALLA 3PQFA 3EZYA 1XIVA 1KEPA 3JQFA 4WCFC 3JSAA 4RF4A 2HJRA 2NLOA 4BMSA 2O3SA 3DDNA 4MKRA 3ASVA 1PJCA 1EBUA 3WBBA 1QG6A 1VSVA 1MG5A 2YV3A 4YPOA 4E2XA 1ZIDA 2W2KA 3F9IA 5DN9A 1K0UA 4L9RA 3TOXA 4BL5A 1EUZA 3NTOA 2ZIZA 1SOVA 2IXAA 4B3HA 1DHRA 5T67A 3KYCA 3AM3A 4UVGA 2WMDA 1HKUA 1Q0LA 4IDGA 1PEDA 1QR6A 4AJLA 1RYDA 1KVQA 4CUKA 5TIIA 4PLYA 4XJTA 5F1KA 4R4JA 2HO5A 3ADOA 4FFOA 4B4OA 2BMAA 3TN7A 4BNLA 2NTJA 3GC6A 2DUWA 5L51A 3DXFA 2BH9A 3WDSA 1CQIA 5AQ1A 3K8ZA 1ZNQO 4KWIA 3WGOA 4YT2A 3ZV3A 3ZU3A 4FC7A 5AXCA 3QWBA 1AXGA 4ITUA 3UGKA 1CDOA 3JYQA 3MJ4A 1UP4A 5A06A 3BTVA 2J5RA 2H5LA 1BGVA 2LDXA 3L4BC 4PG8A 4KTTE 4NMHA 4CJXA 4BNHA 4IDAA 3GA0A 4NI5A 2X7HA 2NACA 1LSUA 1KVTA 2JD2A 3M1LA 4U6QA 1OC2A 4J9UE 2YFQA 3T4XA 1EMDA 1TT5A 4N5LA 3N74A 1T2FA 3RWBA 2Q49A 4CMIA 1O5IA 1DAPA 2PD4A 3DAGA 4FFRA 3OFSA 3B70A 4IDEA 3H9UA 1E3JA 4DBVO 4IGEA 3EMKA 3QY9A 3GF4A 1C1DA 3GFBA 4YJGB 3VKUA 4FQ8A 1L7DA 1YBAA 1JWAB 3WGIA 5DCWA 5B1YA 3P5SA 2VTEA 4PG7A 3RJ9A 3RKRA 1BDBA 2D5CA 3H3FA 2GYYA 3BMNA 1EDOA 2BD0A 3L07A 4TWRA 3ENKA 3VDQA 1YB4A 4NDNE 3KYDA 5IDXA 4CV2A 1CJCA 3ZWWA 5TS3A 4LMRA 1RJWA 5JE8A 2VZ9A 3TNLA 4NK5A 2P68A 2BELA 1P44A 2CF6A 1ISGA 4J16A 4RCVA 3FPCA 1PIWA 1L7EA 4CMAA 1GAEO 2Y05A 3JQAB 4BV9A 2VT2A 3V5NA 1V3VA 1DBVO 4GPD1 3O4RA 1U3WA 1D4FA 1LSOA 1Y9AA 3DMTA 1WPQA 2WSBA 4NK4A 5I9MA 1LTHR 2O23A 4FB5A 5IXYA 4J90A 2HU2A 2Q1TA 1NXQA 4CL8A 1LQUA 3HQ4O 3LYLA 3ROPA 1MX3A 4BNZA 4DQUA 2GNAA 4DYVA 3I23A 4BNJA 1A7KA 5BNFA 4Z0PA 1Q7BA 4LRTB 1H0KA 3ENNA 4JXKA 3F3SA 3OSUA 2VRCA 4WNCA 3R1IA 3UN1A 3NKLA 4EEZA 1IPFA 5EERA 1DIGA 4GX2A 2OL4A 1PGQA 4ZICA 1DAOA 4PZCA 4ZRMA 2Y99A 3E82A 4R68A 1U7HA 4UEKA 4L4XA 3K31A 4K6CA 1MC5A 1X7GA 2X0NA 5IZCA 1BG6A 2JCXA 5ITVA 1WDKA 2H63A 3GT0A 2QYTA 3PK0A 2R6JA 4JN6B 1LDEA 2DFVA 3D3WA 1JKJA 2FPIA 2RIRA 1DFGA 5HBRA 4PLWA 4TSKA 1E92A 2VQ3A 3C7DB 4U5QA 4UUOA 4UUMA 2XOXA 3C3XA 2X1HA 1VPDA 2I99A 1Y8RB 2HMVA 2Y68A 2NVWA 1KVSA 3HADA 3LT4A 2PZJA 1NYTA 1GCUA 3GMDA 2I5PO 4H7PA 4RL6A 3G79A 1XQ1A 4DYDA 4RPHA 4CMBA 3WYEA 4FN4A 5JC1A 4PCVA 4NU5A 1I2BA 2CDBA 2DM6A 1R0SA 1IB6A 2J3KA 3PWZA 1DC6A 2WJPA 1H93A 3VPHA 2W2LA 7MDHA 1LX6A 2X9GA 4O0LA 1GADO 1ZXBA 3I1JA 3KLMX 3H65A 2DTXA 1AXEA 2GGSA 1E7YA 3GZ4A 1GV0A 2ZYAA 4RQUA 3G0OA 4OO3A 3RASA 4QSMA 4J6FA 4KP7A 1MV8A 1D7OA 1XG5A 2CY0A 4CMEA 3ITKA 1DIHA 4XB1A 3BAZA 5EJ2A 2PH5A 3UCXA 3FR7A 1IHXA 3RUFA 1FDVA 4E5NA 2PD3A 4N5MA 2GCGA 5CDYA 1N1EA 3DZJA 4KDEA 4Z9FA 4QO8A 1DHTA 1WP4A 1OFGA 3ZV6A 3Q11A 4RVUA 2PY6A 1NM5A 4NJMA 2W90A 4FD3A 3FSRA 5KKAA 3TZKA 4J1QA 4IM7A 1XKQA 4Z3KA 3VDRA 2PA3A 3U4HA 1HEUA 3MJEA 3FTNA 4BVAA 3C8MA 2EIHA 3PJGA 2EP7A 1E7RA 4CLXA 1BTOA 4NQZA 2HRBA 2AG5A 4B8ZA 2VHYA 3F47A 3IJPA 2EXXA 1RKXA 1MC4A 3DEYX 3Q3CA 1O6ZA 1YRLA 3WIDA 3DOOA 3GRKA 4OSPA 3H8VA 3PZRA 1JU9A 4CMKA 4FJ1A 4GLLA 5EN4A 3WOHA 1ARZA 3MTGA 4ALKA 5CDGA 3KSZO 3HFGA 3CMCO 3RUAA 3VC7A 4CL3A 5AOVA 1XA0A 5LC1A 5JAMA 4M8SA 3MJVA 4UUPA 5ILGA 1PZFA 3VPSA 4NNJA 3H5RA 5TNXA 5U9CA 1U1IA 4TKMA 5BSGA 1IUKA 3E5MA 2ZB8A 2E49A 1CRWG 3GRPA 1QP8A 2HMTA 4AJ1A 4U7WA 4JP2A 2EP5A 4UAGA 3T4EA 2PKQP 5JY6A 1DC3A 1YL6A 1JLLA 5EIOA 5FEUA 4Z9YA 5I8WA 3U09A 2ZB4A 4CUZA 1OOEA 1F8GA 3RKUA 1GYRA 3AK4A 2D8AA 4ZVVA 3AI1A 1YOVA 3VVCA 3TF5A 4A10A 4GBJA 5A5EA 3ZWNA 4M49A 4AICA 3QWAA 3S1LA 1HE4A 1M6WA 2OO5A 3PDJA 3PLRA 3UXYA 1N92A 4BO2A 3Q9UA 1R12A 4MP8A 3NJ4A 4YJDA 1YO6A 4P38A 4BGEA 3OEYA 2VHXA 2FZWA 3E5RA 4OJNA 5LDHA 3IC5A 3O26A 3PYMA 4K6FA 3WBFA 3QSGA 3HDQA 4HXYA 4ID9A 3TJRA 5U1PA 1M75A 4I5FA 1QXSA 1E7MA 2Y1GA 3JQ9C 2BLLA 2NADA 1A5ZA 2B4TO 4WK6A 1I2ZA 4I9UA 3R0IA 2NQTA 3PXXA 3B6ZA 4TKLA 1B3RA 3GGOA 4YXFA 1HDXA 2OFPA 3WTBA 3JYOA 2NTVA 2O48X 1BMDA 2Y67A 2YZ7A 1T4BA 3BMCB 1ZK0A 4J1SA 4I9NA 4F45A 3H4VA 3ULKA 4MVJD 1TLTA 3HJAA 3GNSA 3MWDB 2NVUB 1E6WA 4XQCA 3CEAA 2ZCUA 3QV1A 3AU9A 2GRAA 3CPSA 3A14A 2P9EA 3RUEA 4F3YA 1IZ0A 4I08A 3RFTA 3JQ8B 1FDSA 4PFJA 2YV1A 5GMOA 1FDTA 3PJDA 4RF2A 3VZQA 1WVGA 1V0JA 4J7UA 4RVFA 5CEEA 1TA4A 4BO5A 3DAFA 4ALJA 4CQMB 4J2HA 1H6DA 3GFGA 2Q50A 4ZQHA 4HFJA 2YY7A 4ROSA 3DBRA 3JQFC 1GPDG 2G82A 4I8XA 4BS9A 2Y66A 5JY1A 3UF0A 4BNYA 5GY7A 3OH8A 1LDBA 5JYDA 2EERA 2QRJA 3QWIA 4RVGA 3RJ5A 2Z5LA 3WGHA 2CFCA 5ES3A 4H16A 3PHLA 3LC2O 4DRYA 1HE3A 1N9GA 1OMOA 1GPJA 4DQXA 4A7PA 3RC1A 4NPCA 2RAFA 4QFDA 4BMNA 4K26A 1B15A 3EAGA 4DIFA 4NH4A 4ZA2A 2I76A 2D3TA 1D3AA 2IZ1A 4R69A 1EZ4A 3VH2A 4WLEA 1H5QA 4IDFA 1NAIA 1G0NA 1FF9A 4OHUA 3F4LA 1W6UA 3I9NA 4AFNA 1PJLA 2LDBA 5TGDA 4BV8A 5HWSA 5TQVA 5BNTA 5EQDA 3NDJA 3ZWYA 1ADBA 2DBRA 1NQOA 3ZHBA 1K3TA 1DPGA 2E6UX 3ZU4A 5HA5A 3F1KA 3GOHA 3WMXA 3WWZA 2OP1A 1LEHA 1R4MB 1PZEA 5DULA 1MFPA 4HUJA 2E4AA 3K6JA 1DDOA 1PQPA 1A7AA 3I6IA 1LRJA 4UVHA 1U3TA 3VVBA 2YUTA 3CXRA 3GVPA 5KVSA 3VZPA 2YHUA 1U5AA 1LU9A 1KY4A 1Z7EA 2IDZA 4LN1A 4RF5A 4Q3EA 3I4CA 1ORRA 1BXZA 1QYCA 4N54A 1O0SA 2JAPA 2J3HA 1ZK2A 4J7XA 3Q1LA 3D5QA 5C7IO 1EVZA 2DQ4A 3AUTA 5F5NA 2EGHA 4AJIA 3AOGA 1D1TA 2YDXA 4I1IA 4FDAA 1H2BA 4TRJA 7ADHA 4IPTA 3JYPA 1R15A 5LCXA 2AW5A 4BO4A 3AM4A 4XYGA 2P9CA 4IUYA 1I2CA 3TL3A 5HTOA 4D46A 1YJQA 3HNPA 3W8FA 2PZMA 3QWHA 3CIFA 1J49A 3QVXA 3PFFA 3E8XA 2AA3A 3D3EA 1DOHA 2QW8A 3ZI0A 4BQPA 1H6AA 3P2OA 2UVDA 3C85A 2Q2VA 3F1LA 1ENYA 4YJGA 1WAMA 1I24A 1TVEA 4O63O 3V1UA 4CM3A 1BW9B 2VWHA 1R6DA 1X14A 2GZ2A 3W6UA 1ZMTA 2CDCA 3CZMA 3DOCA 1I0ZA 1ZMOA 1W8DA 3LQFA 3ROKA 1EDZA 1QV6A 3NT2A 3CSDA 3E18A 4W99A 1HYHA 2NV6A 1EUDA 3ONDA 1T26A 3D4NA 3OIGA 3QVOA 1DFHA 3DBHB 5JNLA 2ZQZA 3KXDA 3ZU2A 4IY1A 2R00A 1P1RA 4L74A 1WLYA 1EQ2A 2YDYA 1JVSA 4RGBA 3AFMA 4E2YA 4YA6A 3WLEA 3I4FA 4XD2A 5K6AA 3FNEA 2GERA 1UDCA 4FSHA 4BNIA 4DVJA 3WG9A 2DBZA 3FHLA 5F1PA 5IZCC 2C82A 4Z3DA 1SCUA 1B2LA 1Y7TA 4GSKA 1OBFO 3U49A 1HSOA 4PLZA 1GTMA 4RO0A 4R5MA 1JN0A 1HDZA 1V9LA 1C0LA 2A9FA 1JAYA 4PRKA 4EZBA 3UICA 2B5VA 2PKRA 2VYND 2W4QA 6LDHA 1I5RA 2B35A 1ZJZA 2GN9A 3CH6A 5F1OA 4OOEA 2HMSA 4XKJA 4BGIA 5C7LO 3IOYA 3I5MA 3KTDA 4S3MA 3A28A 3I9OA 1HETA 3UCEA 4H15A 4LSWA 5G4KB 4WGGA 1PQWA 2PFGA 4CQLB 3VZRA 3I52A 4WEQA 4MP6A 3RBVA 4BNXA 3C7CB 3PQEA 3BHJA 3GZNB 1XQ6A 3L0DA 2UDPA 5G0TA 3GUCA 1UJMA 2BFAA 3WS7A 5BNIA 5JYEA 2Y0EA 2IE0A 1HRDA 3KO8A 1CERA 1VI2A 3F5QA 1NWHA 1ISJA 3FR8A 4Z6KA 3E1KA 1Y8RA 4LVCA 3QP9A 5I7FA 1BSVA 4Q3BA 4R9SA 5JLAA 1U5CA 4CMEC 1MXFA 4O6VA 1J6UA 4OL9A 3FCOA 5JO0A 2OORA 4E2WA 1FDWA 3FWZA 4XJSA 1BXGB 4D3DA 1NWCA 4WLNA 5HS4A 4WLVA 4CLRB 3DO5A 4Y6RA 4ZGWA 3IJRA 3C1AA 2OXIA 2B37A 4IJWA 4IIUA 3UW3A 5G0VA 1VKOA 3AI2A 3KBOA 4J1TA 4ZQBA 4FOOA 5JXWA 1DRWA 1AHIA 1EQUA 3KZVA 3RUDA 3FBGA 4BNGA 1YONA 4CODB 3ANLA 1KC3A 3ZW9A 2QYSA 1D8AA 3ZWBA 2FZEA 4MPDA 1ULUA 3GNTA 4HADA 4ND5A 2J5QA 4ZQEA 3RIHA 5AXDA 2UYYA 3GVIA 4KTVE 2QZ9A 3SJ7A 2EWMA 2D1YA 2B4QA 2VHVA 1EVJA 4YB8A 2DT5A 4OM8A 1GD1O 3INTA 3JTMA 3KHUA 4HWKA 3PHHA 4MVJE 5KJEA 3LVFO 3PEFA 2Z1NA 9LDTA 2UAGA 4JX8A 1ID1A 4NR0A 5EL0A 1T24A 5BR7A 3ZWVA 4FPXA 4J1NA 2O2SA 2X86A 5JCJD 1B26A 1CWUA 1UR5A 3INRA 1ZEJA 2I9PA 4L73A 2BI7A 2FY8A 1C1XB 4KQXA 4YWJA 3SLGA 1PJ3A 3LF2A 3ITDA 5KJCA 1E3WB 4KUGA 2WYUA 2NU8A 4K1LA 4XQGA 4B79A 1NPYA 2VUSA 1VJ1A 1DIBA 1O94A 3EHEA 3KV3O 4JJIA 1P1IA 2DU8A 3UH1A 1NFRA 4KZPA 2HMWA 3NJ8A 4I9HA 1T1SA 3GDFA 4IDDA 2ZCVA 1U3VA 2DBVO 4EJ0A 4CMGA 3HN7A 4DWVA 3M2PA 4IINA 4RPKA 3GN1A 3FNGA 3WSWA 3A9WA 4D43A 4IBOA 1PGPA 5ICSA 3C1TA 2EJWA 2FPGA 1JA9A 2H6EA 3S2EA 4EUFA 4QQRA 2C2YA 2C2XA 4QEDA 1R66A 3GAFA 1A9ZA 3PHIA 4NU6A 3WQQA 1M76A 1WZEA 1F12A 1NR7A 1QKIA 3OIDA 3R6DA 4Y6SA 5IF3A 4TRRA 3WNVA 1H6CA 2HJSA 3BHIA 1N7GA 3RBXA 5BQFA 3AY6A 4W6ZA 2X4GA 2P91A 3RAJA 1P33A 2V6GA 4PG6A 4YT8A 1P9LA 4PVDA 4G5HA 2H9IA 1PWZA 4W9NA 1LA2A 4CM1A 2FSVA 2BRUA 5EPOA 4Z9XA 1Q0QA 1I10A 2HMUA 4MVJG 4DPMA 4U6SA 4MVJF 4AJ4A 2WM3A 4LW8A 3UUWA 1JKFA 4O1MA 4UREA 3N7UA 3GEGA 3Q6IA 4A73A 4DUPA 1GYPA 3PGXA 5FWNA 4IXTA 4BB5A 1Q1NA 1Z6ZA 3GG9A 1MP0A 4WLFA 2B83A 4E5YA 1EBFA 3VAZA 3BTSA 4YR9A 3NEPX 1X13A 4BO3A 2E82A 2I3AA 2NSDA 1NBOA 3WX0A 4L76A 2PTGA 3LZ6A 4XDYA 2AQIA 3RC2A 4DXHA 1UP7A 5F3RA 5L95A 2GD1O 4ZN6A 1GZ6A 2CZCA 3BMCA 3ICPA 3L9XA 4BNNA 5JAZA 4PG4A 1XSEA 2VYVD 3U3XA 2NVUA 4DPKA 3U5TA 3RUIA 1E6EA 5CDSA 1U4OA 3NYWA 1NPDA 2FR1A 5ER6A 4YJFB 4A27A 3FI9A 3RFXA 2PGLA 3LDHA 1HWYA 1NTOA 1O95A 1E77A 1Z73A 4QO7A 3HDJA 3JQ8A 1R16A 3DOJA 1XGKA 3TFQA 3KYBA 5ER9A 2GZ1A 1YQXA 4NBRA 3VPXA 2NNLD 1NR1A 1O89A 5TSDA 4GI2A 4EJMA 2VRBA 1XWFA 2VOJA 1C0IA 2O3TA 3DHEA 4LMPA 3ZWCA 4EJ6A 4YT4A 1H94A 4GVLA 4IDBA 4BKQA 4XGIA 3MOGA 2FMUA 4DLBA 3OBBA 4AJPA 2JHGA 3Q2KA 4BMVA 3W4KA 1GUZA 3GQVA 2O3JA 1U9JA 3H9QA 1NNUA 5TJ9A 2DKNA 4XDZA 1CQJA 3GN2A 4Y8VA 4JIGA 5T8KA 3PWKA 4EITA 3WMWA 3CTMA 4YAEA 1LDMA 4CLHA 4BKOA 1LBEA 1T2DA 2QRLA 4GQAA 1RM5A 2QIOA 3W6ZA 2V65A 2ZTLA 4WUVA 3D4PA 2F1KA 3RBZA 5JCXA 1XCBA 1ML3A 2RH8A 5T57A 3B1FA 1YH3A 2AMFA 4G65A 1GR0A 1K89A 1AE1A 2CDAA 2TMGA 1SB8A 4MIEA 1DC4A 3QQPA 4XWYA 2DTDA 4YRBA 1KVRA 4Y6PA 3ON5A 4DGSA 3GDOA 3VPFA 4GGOA 4BO8A 3STHA 1UXHA 4E5KA 2BF7A 1SO8A 1Y5RA 1DC5A 2WYWA 1HZJA 1P77A 1YL5A 3CINA 1B7GO 3QIVA 3PIIA 4AJNA 1PS9A 1UAGA 1DLJA 1FMCA 2EHDA 2GN8A 4CR8A 2VN8A 3JD2A 4BGVA 2VCYA 4YAGA 4BGUA 3SX2A 4QXMA 1R4MA 4DMMA 3JD3A 5JAIA 4NIMA 2X22A 4NG5A 1E1KA 3R3JA 4B4UA 1YWGO 3RU7A 3PRJA 3PVZA 4CLEA 4HP8A 3TZCA 4HX5A 2HAEA 3ASUA 4W4TA 3WLFA 4ZD6A 3GVXA 1ZFNA 2ZB3A 1FK8A 3OA0A 4R9RA 4QFCA 4XCVA 2C59A 1ADFA 3B1KA 3S2FA 2B0JA 1XELA 1WDMA 3ZNPA 2PLAA 4HNHA 3JQBA 4K28A 4BNFA 4AJJA 4I5DA 3AUSA 4MIYA 2JCVA 2VWGA 3GHHA 3RC7A 2X0JA 3D4OA 1ZBQA 1K6IA 4WKGA 3D0OA 1HYGA 3OJEA 2OGUA 4J7CA 1HE2A 4YBZA 4LSMA 3VKVA 1YB1A 3F5SA 4WEOA 1QRRA 2P4HX 3ICCA 3Q2IA 2UUOA 2R00C 1VJTA 2NUAA 2X23A 3GVHA 3SEFA 4WLUA 3IQDB 1BW9A 4A26A 5CEJA 1GU7A 3DBLB 2IEDA 1UZLA 2GLXA 1WNTA 3MCVA 5DZSA 5JDCC 3DC2A 2CUKA 3DZIA 3ZZNA 3ZWAA 5K6AC 2OBNA 1J0XO 1Y6JA 2HSDA 1E3IA 1UUFA 3PJEA 5BSHA 3T7CA 4PG5A 3NX4A 4BO6A 4TROA 3TDKA 1A27A 3U4IA 4FJ2A 4DC0A 1A4IA 4D0RA 3DBHA 1BWSA 1XU9A 3UKOA 3FBTA 1KOLA 1K2WA 2QRKA 4QUKA 4CR6A 1RM0A 3IP1A 4HY3A 1D1SA 2X5KO 3IKVA 4GLOA 2Z1MA 4GL4A 4JBGA 3WSVA 4GKVA 4C7JA 1J4AA 3OMLA 4TZTA 3KEQA 4OGWA 1QYVA 5IN5A 5C3MA 2VUUA 1W73A 1HDRA 1YE3A 2I66A 1QMGA 2VWPA 1U4SA 2BFPA 1DO8A 1U7TA 3PI7A 3DONA 2EJVA 1YQGA 3SBOA 2B4RO 1FDUA 4XRRA 1U8XX 4IJUA 4N7RA 4WECA 1E5QA 4EW6A 4RORA 5I9NA 2AEFA 2O3RA 3OJOA 3ROMA 1XHLA 5DBFA 4RV9A 5G4KA 4CQLA 1UXKA 2XXJA 5A3JA 1R0LA 1P0FA 4JLWA 3BMOB 4PZEA 3FWNA 1Z7BA 2B5WA 5JPIA 3GZNA 2FR8A 3L4SO 1X1TA 3ST7A 2VZ8A 4B4WA 1DFIA 3MEQA 2NU6A 3DL2A 4R3NA 4CLDA 1U28A 3IMFA 3HB5X 1Y8QA 4U8GA 1IYZA 5GZ3A 3TZ6A 4IJVA 4FFLA 3JQCA 1H2HA 4JROA 2QQ5A 4DC1A 3PJFA 1ISHA 2IRWA 2ZQYA 3GH3A 4R41A 4U0KA 1HDYA 3O03A 1HL3A 2C07A 4ZU3A 2JHFA 1LDNA 1PS0A 1SBYA 2WE8A 2OMEA 1GQ2A 1CEQA 3LU1A 3MJTA 3FNFA 4Q39A 4CLRA 1EE2A 5FF9A 1VL8A 3OQ1A 3TFOA 3PWSA 1FXSA 2HKIA 4NFHA 4WNIA 4DA9A 2D59A 1X0XA 3D1LA 1AN9A 3G1TA 3PPIA 5JC8A 1T2EA 1KBZA 1ZEMA 1B8UA 4NBVA 3H2SA 1ULSA 4XEHA 4QX6A 4XYMA 1E3EA 4BB6A 1CETA 3QHAA 3JQ7B 3WQRA 3ZN2A 4ZJUA 2C0CA 1GUYA 4GWKA 3F6YA 3EY4A 3NGLA 1TT7A 4MDHA 4BNMA 4PN3A 2IODA 5B4VA 1G0OA 4X54A 5MDHA 3O9ZA 2OZPA 3GDGA 1LDYA 2HCTA 2EF1A 3EDMA 5H83A 3ZDFA 1Y81A 3RC9A 2JAHA 2J3JA 1M2WA 3H2ZA 3G49A 3GK3A 2YJZA 1ZSYA 4JP3A 5CAEA 2NVBA 1I32A 1B3BA 1C1XA 4FIZA 4CMCA 3CKYA 4Z0HO 3H6KA 1KVUA 2HLPA 2Q4EA 4IZIA 3KVOA 1YB5A 4Q9NA 5DOZA 4PLPA 5A3VA 3WICA 2DPGA 1G6KA 1B8VA 3RFVA 4YTEA 1C14A 1EVYA 2PKQO 3WIEA 3WWYA 3QVTA 4XA8A 2IEBA 1F17A 3VH4A 2WE7A 2X58A 1YGYA 3E6AA 3KOUA 3PIDA 4URFA 1I30A 2PWZA 2GPTA 3JCZA 1ZUD1 4ZRNA 2IYPA 4E3ZA 2XAAA 4W9NC 3UOGA 1T2CA 1KC1A 2VOEA 1GDHA 2Y1FA 4CM6A 4TRNA 5HM8A 5K9ZA 5IG2A 4XIJA 4DTIA 5A4DA 5DOVA 3BMQB 3JQ6A 4BO7A 4JGBA 2C20A 1E7WA 5BT9A 1OI7A 3GY0A 1NQTA 1T4DA 5CPFA 4D7AA 1O9BA 5CEFA 3SC6A 1X15A 4IXWA 4BO0A 1RM3A 1ONNA 3QVWA 3JQGB 4Z0TA 4B7UA 4P4GA 2GUGA 4MIOA 4UEJA 3ADPA 5IN4A 4JQCA 3F46A 4OAQA 1SC6A 2NU9A 2O50A 4IDCA 4GAEA 4YQYA 5CFZA 2JFFA 1MA0A 5IXSA 1WXDA 1VC2A 2P2SA 3EGOA 5A9SB 4BKPA 1EVIA 2BKAA 2BFMA 3U62A 3IL2A 1F0YA 2NQ8A 4RVDA 1GV1A 3SXPA 1I3KA 2VRCD 1DRUA 1TB4A 2NU7A 2B36A 4FGWA 5CHEA 1Y1PA 3ETEA 1ENOA 3LK7A 3IKTA 3NGXA 1U2GA 3LC7O 2ZK7A 1DJNA 4HKTA 5AXBA 5JAQA 4Q3AA 1VRWA 1ADGA 4B3JA 4HFMA 4KOAA 4R1UA 3AWDA 2Q4BA 2AE1A 4E5PA 3VTFA 2P5UA 3TOZA 2PGJA 3EW7A 4ZQGA 1YXMA 1B14A 2X6TA 3BZUA 4PLHA 3T7EA 4E32A 1PS8A 2GZ3A 3WNQA 3DAPA 3EUWA 3NTQA 1ZXLA 5DF1A 4JCOA 3PFWO 5B37A 3MZ0A 5KOIA 4J4HA 3NV9A 3LT0A 1ZZEA 1GCOA 1Z45A 5I9LA 3KM0A 4CV1A 4CR7A 1XYGA 4RF3A 4W82A 4OKNA 4YJFA 3MTJA 4WJZA 1VL0A 5KJ1A 3JQAA 4MO2A 4Q3DA 5IFLA 5T8KC 5KVCA 2X9VA 4HV4A 5KKCA 2W2LD 1WWKA 4PLCA 1QYWA 1HF3A 3OM9A 5JDCA 4GWGA 1IZ9A 5L7YA 3V1YA 3OICA 4EDFA 5L4LA 2HK9A 4LCJA 4IMRA 5A9TA 2CMDA 4MOWA 1E7SA 8ADHA 3RUHA 2DPHA 3IUSA 3O8QB 3WGTA 1NFFA 2WDZA 1BHSA 1MB4A 3PYLA 4WCFB 3OQBA 4YAIA 4IQGA 3G3EA 2PK3A 3WGZA 4D79A 4RQTA 4WPGA 4XX0A 1LRKA 3E9QA 3OJFA 3RVDA 1ISIA 5LDGA 1BXKA 1U3UA 2BI8A 3HB4X 4IMPA 3PHGA 1X7HA 3E48A 4IZHA 1CF2O 4YACA 1UZNA 2O3UA 2QHXA 3RI3A 4E33A 5EQFA 3VH1A 4ESOA 1RM4A 4M55A 4B8WA 1AHHA 2DUUA 5COQA 3KSDO 3ZH2A 3U4CA 1I3MA 3HSKA 5DT9A 1I36A 3S2GA 4CV3A 4DMLA 1P1JA 5G4LA 5HRUA 1MUUA 2PZLA 2DFDA 5KIAA 3HN2A 4WE3A 2V6MA 2I65A 4CM9A 1NASA 2Q1WA 2POQX 5H82A 5KTKA 5MGBA 4FOSA 1KEWA 4J0FA 3AUUA 1IOLA 3OEWA 4MKXA 1SOWA 4L75A 4ND2A 3G17A 3WYCA 1UH5A 3JQBC 3GEMA 3JQEA 3EVNA 4WCDA 5JDIA 4A5OA 5B12A 1QV7A 2VHZA 1V8BA 1ZK3A 2IXBA 3LT2A 4EEXA 2CD9A 1X1EA 4GX5A 4ZHSA 5L9AA 1BVUA 4YAKA 1DJQA 2WEKA 2YFHA 3BIOA 8LDHA 1T1RA 2OBYA 4J4BA 4N5NA 3VH3A 4GVXA 1UP6A 4AJKA 4ND4A 3ZV5A 4WOKA 2WWRA 1R4NB 4MVJI 1PX0A 3I3OA 2Y1DA 1PWXA 2AEJA 4FGSA 2Y0DA 2ZYGA 1EK6A 2OOSA 3DWFA 5CG2A 3NDIA 1EUCA 2X5OA 1RWBA 1YDEA 3DB2A 1HDOA 1MXHA 3I9KA 4A2CA 5BSFA 2Q1UA 2RHCA 1UDAA 4ND3A 2Q46A 4OXNA 3S2IA 2FPPA 3ZWOA 2FOIA 3ANNA 3PQDA 1VLLA 3DMYA 3QW2A 5L40A 4EYEA 3LF1A 2OP0A 3EK2A 4FFNA 3TQHA 3NUGA 2NM0A 2VTDA 4RLSA 4YDRA 3V8BA 2VZ0A 4KUEA 1Z75A 4IIVA 2FP4A 3GGGA 3DBLA 1E7QA 2C54A 4F6LA 3A06A 5ITWA 4YRAA 4LK3A 5ENDA 5JMPA 2EKQA 3DR3A 3HHPA 4MVJH 4Y9DA 2HUNA 4FCCA 2GF2A 3PTZA 2VUTA 1LDGA 4KMSA 2R2GA 1LLDA 1V35A 4JJFA 3WGYA 4NBWA 2VT3A 5TRTA 1SNYA 3AM5A 2WD7B 4TRMA 4LVUA 1UZMA 2J3IA 4NHEA 4RVSA 1NHGA 2UV8A 1XLTA 3MJSA 4TMFA 1UXIA 3EC7A 5FI3A 1LC3A 3Q9NA 4RDHA 4EUEA 2JL1A 3QWFA 1WZIA 2AE2A 5KJ6A 5G0WA 2HK7A 5CP8A 1BRMA 1PJ4A 3FF4A 2UUPA 4MVJA 4L4SA 4O5OA 4PLTA 2G17A 1SEVA 2QG4A 4AVYA 3WQSB 4WASA 4YCAA 4E13A 3L6DA 4BNUA 3DHYA 1AUPA 4MKZA 1TXGA 1ZCJA 4YQZA 1ZSNA 3GHYA 3ZWPA 5ADHA 2O3QA 3IAHA 4OSOA 3CUKA 4D44A 1YS4A 3ZNOA 3RQSA 1SB9A 1U8FO 3IDSA 1M66A 1I33A 4UUNA 1LLQA 4G81A 3DZKA 3L9WA 1DIAA 4XYBA 3Q0EA 1H9AA 1N2SA 1DLIA 2X0RA 2HK8A 3A1NA 3BMOA 5DNAA 3OJ0A 3JD0A 2VHWA 3G1UA 3BXXA 3E03A 5I7SA 1HTBA 2GASA 4IQ0A 4CV0A 4R1NA 3LLSA 1QLHA 2CVOA 4KUHA 5L53A 2GDZA 5B4TA 1JKIA 3V2GA 4XQ9A 3GMSA 3OECA 3K30A 4JBIA 2DAPA 4CMJA 5G0UA 2BFOA 2BHLA 3NRCA 3SJUA 5HS6A 3U0BA 3ZCXA 3I6QA 1UAYA 1HXHA 1H6BA 4BO1A 5I7VA 4I5GA 1KERA 4R54A 3ONFA 4XQEA 4DQVA 3JD1A 5A03A 3PGJA 4FFMA 2DBQA 4XIYA 3VHRA 2D0IA 1ZK4A 1W0CA 2C7VA 3X2FA 4GH5A 4P22A 2O7SA 5I8ZA 3SVTA 1S6YA 2AG8A 1ADCA 3WJAA 3KETA 4ND1A 3JQ7A 3AJRA 4BUCA 6ADHA 1B16A 3AY7A 5CPBA 3BA1A 4CQMA 4CM4B 5ILOA 3RCBA 2FN7A 3FRJA 5TT1A 4NZ9A 5JS6A 5JMWA 1HZZA 2D4AA 4IS3A 4AL4A 3V2UA 4NBUA 3KEOA 3M6IA 4RVHA 2PGDA 4YJHB 4Y98A 1P1KA 5L7TA 4AJHA 2C5AA 3IUPA 4J91A 2ZKLA 1NVTA 3I9LA 4PLFA 4OXKA 4NJOA 4R1TA 1MG0A 2FRDA 3WB9A 4M1QA 1VL6A 1P0CA 4G2NA 1IY8A 4PZDA 5C37A 4R01A 4EUHA 4MJLA 3KSUA 4E2ZA 3WR5A 9LDBA 3HDHA 1LUAA 1ENPA 4MINA 2YQ4A 5KNLA 4FW8A 3HFSA 1DB3A 1X0VA 2W8ZA 1ZW1A 4UVEA 4J43A 4DLLA 2G1UA 2AXQA 1IPEA 3LSYA 4GMFA 1W4ZA 1DRVA 1LLCA 4HFNA 1XEAA 3AFNA 4GKBA 4KDFA 5EINA 5L45A 1DEHA 2JFHA 5COAA 2EW2A 5FYDA 3B20A 5JO9A 3DZBA 4UEOA 3ZHYA 5CG1A 4Q3NA 1PL6A 3FTPA 3UFXA 1P3DA 4FJ0A 2PH3A 3E9MA 5EESA 5AVOA 1JQBA 4E30A 2CF5A 1EFKA 1IE3A 5G0SA 3TSCA 3GAZA 1K5HA 1WMBA 1YDWA 2X9NA 1M6HA 3ABIA 4LRSB 4QECA 4BHTA 1SZJG 3FN4A 1CYDA 4CLOB 4R3WA 3ONEA 3DBVO 5L4SA 1T2AA 3BMQA 2OHXA 4IS2A 3JQAD 2DTEA 4CM8B 3LLVA 1HSZA 3VZSA 2CNBA 1F8FA 3I9JA 5F5LA 3WJ7A 5JFOA 2C5EA 3IP3A 3AU8A 1N7HA 4A0SA 5KVQA 3JQGA 3TL2A 1M67A 3ZU5A 1MFZA 2YV2A 2YHIB 1UDBA 2YYYA 3L77A 5KJFA 1KETA 1F06A 4Q3CA 2VNSA 3PLNA 1P1FA 3H7AA 1PGOA 3W8EA 4DLAA 4PVCA 3K96A 4DIBA 1QYDA 2J5KA 1CIVA 4GX1A 5A9SA 3TPCA 1JAXA 4XR4A 3ZNQA 1DIRA 3AUAA 1UXGA 4TVBA 2V6FA 2C7GA 2ZTUA 3C7AA 1EK5A 5G2OA 2IYOA 4OXYA 4BNVA 4F46A 4DREA 2Y1EA 4HNGA 2PV7A 4BKUA 1QORA 4B7XA 4RPLA 3TZQA 4GGPA 4LGVA 2VYNA 4AJEA 1BVRA 1E5LA 5TX7A 1E3LA 1GZ3A 1Q0HA 2HRZA 4XRGA 3ETGA 4D42A 1PTJA 4PIVA 4J0EA 1PU2A 3HE3A 1PL8A 2DVMA 3M1AA 1QYXA 1KEVA 1GYQA 3HG7A 2HQ1A 4R5HA 3UAGA 4J4TA 3S8MA 5L4NA 3BTUA 1GZ4A 2FR0A 5IZ4A 5THKA 4K9DA 4ALMA 1X7DA 2AQKA 4CM9D 2Y0CA 3VOSA 2JFGA 5TT0A 3WFIA 4E21A 3DZGA 1SAYA 4NFYA 5I7EA 1RYEA 1OZAA 5DDIP 1K6JA 4RZHA 4WOJA 1XDWA 3X2EA 3U9LA 2I3GA 4OQYA 3K5PA 4TVOA 4DBZA 2I67A 3FNHA 1B0AA 1JTVA 1P45A 3ZWMA 2W2KB 5C5IA 2Q2WA 1Y9EA 1ZK1A 2TMDA 4KWHA 3SLKA 3GR6A 1E0DA 3K2EA 2JJYA 1OC4A 1GEGA 5IDWA 2CVZA 4Y67A 2A35A 1GFSA 1NQAO 1EE9A 3KYCB 1ZVMA 1GQQA 2NWQA 3D64A 4DL9A 3JYNA 2ZYDA 3ZHXA 5CDTA 3O8QA 3DFZA 3GVCA 3JQDA 1VSUA 5FI5A 1PSDA 4WCFA 1SPXA 2H1SA 1YBVA 1HDGO 4OQZA 3H5AA 1LJ8A 4JNKA 3H3JA 2FWMX 2Q45A 3HZZA 4B4VA 2ET6A 4J2OA 3D7LA 1SEPA 1RPNA 2B69A 3RSHA 2IZ0A 3C24A 4FFPA 4XB2A 1ZO8A 2EKLA 1LC0A 4DIOA 2E48A 2D2IA 2PD6A 3NAQA 3JD4A 4RPJA 1IHYA 3NTRA 2AQHA 1ZJYA 2BGLA 5A02A 1SMKA 2A4KA 2A92A 2ZB7A 3DFUA 5JDIC 4AG3A 3AOEC 2DC1A 3DHNA 3BHMA 1T25A 1Z82A 3CZRA 1C0KA 2EEZA 3AI3A 5AXAA 2O2YA 4CPDA 5JSFA 1TI7A 5JCJA 2GN6A 3O38A 2CSUA 5B4UA 2JCYA 2GR9A 3N58A 3HDYA 1BDMA 4D3FA 1NPTO 2YQ5A 2P9GA 5A5FA 4M89A 5DCUA 4DPLA 5A1TA 1TT5B 1YBMA 1PGJA 1BXGA 2Q3EA 4FS3A 4CMIB 3V2HA 2I6TA 2ILTA 4NBTA 4BKRA 1AGNA 5J23A 4AJ2A 5KVVA 4P4NA 4XGNA 1C1DB 3RD5A 1YQDA 1E1MA 1PJ2A 1E6UA 2Y1CA 2RCYA 4QTZA 4YAJA 3NT4A 3EVTA 2GSDA 3L4BA 3QLJA 1L1FA 3RROA 2FHSA 3GPIA 3BMNB 5A04A 2ZATA 1WDLA 2W98A 1LSJA 2BGMA 3KYDB 1R4NA 1PZGA 4PLVA 4E0BA 3PP8A 2DLDA 1JWBB 4LCEA 3PDUA 4OIMA 4RZIA 4BO9A 4BQRA 1PL7A 4ALIA 2V7PA 1NAHA 1XU7A 1DSSG 2BGKA 1B8PA 2WTBA 1P1HA 2HDHA 4YT5A 4D45A 3JV7A 3D5TA 4W7IA 1GEEA 4O59O 5IJZA 3MJCA 3P2YA 4MVJP 2Z95A 3W8DA 1EFLA 3DZFA 2AHRA 3EZLA 1DXYA 2QX7A 3WFJA 3AW9A 3H5NA 3ZWXA 3DQPA 1E3WA 2GN4A 2SCUA 4EGFA 5TF4A 4JBHA 3BTOA 1R37A 1I3NA 3MWEB 4PGFA 3K2BA 3U4DA 1Y5MA 4F6CA 3DTTA 3ZHZA 4LISA 1LLUA 1C0PA 2GO1A 3OF2A 4OMUA 1LXCA 4E12A 1UXJA 3PZBA 3OETA 4L4RA 1HT0A 2RH4A 2RBEA 3FPLA 3OP4A 2FSSA 4FC6A 3IIEA 5JBIA 3OQ6A 1V3UA 3H9JA 3ROQA 5L7WA 4M86A 1V3TA 2J6IA 4IQ8A 2RHRA 5F21A 1VJ0A 4R51A 3RUCA 3COSA 2IZZA 3GPDG 2AEMA 3S55A 4J9VA 2WD7A 4A03A 3CMMA 2X5JO 3ZNNA 3PYXA 2EG9A 4INAA 1NVGA 1I01A 2P5YA 3E9NA 3D3WB 3IS3A 3KRTA 5TC4A 3F4BA 5CDUA 2JKVA 5T5QA 1K6XA 3GGPA 3OHSX 1PGNA 1PQUA 2VWQA 2VYVA 4P8RA 5BSEA 3NDRA 4ALNA 1JDJA 4WLOA 3K73O 3WXBA 2XXBA 3L6OO 4D0SA 3WGQA 3MOIA 1N8KA 2NTNA 3GEDA 3PHJA 3ETDA 3K9QO 4CQMD 3W1VA 3TWOA 1F14A 5ICMA 1GUFA 4GX0A 1N5DA 1ONPA 1XR3A 2V6BA 4M54A 4BIIA 2PZKA 2CVQA 1WMAA 3DZHA 3I83A 5T64A 2X0IA 3P19A 3ZV4A 4PLGA 5KWEA 4XGKA 5GZ6A 2ZJ1A 4GMGA 4E31A 5IAAA 2EKPA 1NFQA 4BNKA 2D5AA 3QA9A 1PZHA 4YYZA
chains in the Genus database with same CATH superfamily
1TKRA 1F0NA 1N5OX 2MWMA 1N6PA 1LNQA 3A31A 1O8CA 3BRWA 4RDIA 1TEHA 5IYZB 1S8AA 1W1WA 2Y1OA 3EWIA 1T5OA 1ZA1A 1PJQA 3T4PA 1KP3A 5JMTA 4NJMB 3EXHA 3TLYA 5DCYA 2R6DA 1A4XA 3GUHA 4PC1A 3SHQA 1TU4A 4ERXA 1P31A 1UFOA 1I3OA 2C3YA 3FD8A 5A9RA 1XBTA 3HCWA 1TEZA 2JS7A 3AJAA 5TGTA 1PN3A 4NSNA 2EKBA 2Q4OA 2YMPA 3QGMA 2F48A 3OIUA 1LZKA 2NO0A 4JI3B 1NLYA 4ZEWA 4DVGA 3TRIA 4OAOA 4RJTA 5K0ZA 1L5KA 1OYOA 4M87A 2XEDA 5WRFA 3ONVA 1NBWB 5KBYA 4QXQA 5C5DA 4QRDA 3EPHA 2J6CA 2J9XB 4FILA 1TQDA 4PICA 2FRDC 1FPQA 2PLNA 1G18A 3HVIA 3LQ1A 1SOUA 3OOJA 3Q0TA 5ENVA 2CT8A 1QQBA 2EZ9A 3IOBA 5AKYA 3PGA1 1JJAA 5HILA 3IDAA 4KQMA 4YRDA 4LC0A 4LF6B 4UTXA 2UXCB 3N0TA 4XYEA 5FJJA 2WQ7A 2I78A 2ZBPA 1QAQA 4C4ZA 1OAAA 1OWNA 4LZLA 4PZ9A 3CNEA 3CX6A 1M7HA 3O90A 4PO3X 1ND6A 2CJWB 2WIAA 4LY3A 3SC4A 1N2CA 3KBBA 5JSZA 5J3JA 2QR3A 1JP7A 4MW2A 5I7HA 2JZCA 2WYVA 3NANA 4TQGA 2F8TA 1R18A 1RU3A 5C7OO 2OGTA 2PANA 3D7KA 2P78A 3S0JA 1Q2XA 1G41A 5KQPA 1O6FA 2A94A 1L0BA 1ECJA 1JHMA 3TZHA 4GM4A 1W30A 4M9ZA 5EA2A 1X3LA 2G0NA 1A4UA 2XPCA 1Q7CA 3CE6A 5EUQB 4O2BB 4HDNB 1NXVA 2FWIA 3QPCA 3FY4A 4D26A 3QPVA 4EQ6B 1KY5A 4RL4A 5AHKA 2CFSA 4F5EA 2FFJA 2C04A 3KLPX 5A4KA 1FTWA 2XD9A 3INGA 4ZQFA 4BX2A 2HSEA 3OIFA 4DILA 1IM5A 4K9MA 5JXJA 3E4DA 3IXMA 1HYEA 1LRLA 4C4OA 3E3OA 2PYZA 3KPWA 4ZT2A 2DECA 4QT0A 3HZRA 1QB8A 2R7MA 2Q2QA 3NOXA 2XNCA 3KJHA 4GLFA 5AJHA 3SLRA 4EHJA 1I5OA 2QN3A 4F12A 5I4IA 3BXGA 4ZQCB 3ZY5A 1T5HX 3KB6A 4I1UA 1FJHA 1P4JA 4CM7A 4I50F 1ZKMA 1T2NA 4PINA 4TSFA 2XWBF 1YJ8A 4DBLE 1A71A 1ZH8A 5HG0A 4W5WA 1NX9A 1NKSA 1JJBA 2C95A 2VJBA 4JELA 4CMHA 4BQFA 1KI2A 3H8SA 3NBKA 4OOFA 2Q5FA 5EGSA 1S7GA 2ZTVA 1V4VA 4KGZA 5DM0A 3W4IA 5CT9A 2WD9A 5JBQA 1TYCA 4IGFA 2PGAA 4KMRA 4YIHA 4BWYA 2FB9A 4I55F 4KXNA 3S40A 4GI5A 4OVKA 2G80A 2YVLA 4JXZA 4UULA 4D74A 1I8TA 5T6BA 3H9EO 3GG2A 4N3GA 2FE1A 3VJMA 1Q84A 2Y93A 1VTKA 3KSAC 5AJTA 3WYGA 3CZCA 3RRFA 3RIXA 3NHPA 1EXDA 4JI0B 2NV2B 1C3VA 3EGXA 3GDWA 2IHJA 3VR6D 2P4QA 3VZDA 3FVTA 1Q3KA 4W7HA 1AN0A 1F9EA 2VPPA 1IL0A 2WINI 4HF7A 3ZW8A 5KYNA 1VE9A 4MP3A 1R1DA 2IBTA 4IUCS 2WHXA 1H2FA 3GRFA 3LDGA 1E3SA 1Z0IA 2H11A 1BE1A 1MB3A 1Z74A 4O4HF 3GLFA 3PEEA 1GXSA 1E9CA 4QD3A 1RYFA 1VE1A 2IHVA 5D3ZA 3TLZA 1Z6PA 1QSGA 2JLWA 1U65A 4J49A 3ANMA 3I30X 5FUYA 4LF5B 1A72A 3OA2A 3DBRB 3FTDA 4N0EA 4IWNA 2AYZA 2SKCA 1VM6A 4W5JA 2GD0A 1U0OC 4S1OA 4GKAA 2IT1A 2AR7A 3M3DA 4RA6B 1AOXA 4D3SA 3J80A 2B21A 2G5GX 3BYZA 4TZKA 1QTNA 4NCJA 5AI8A 5DBHX 1Q7GA 5AM4A 3ZK9A 1DQRA 1BD3A 1X6VA 4RY2A 1LY1A 4C7MA 1YUBA 5FI0B 5KINB 2Y8EA 4ZYUA 1LW7A 5EVJA 3ZGYA 3THRA 1D2AA 2EW1A 1G20B 4OCZA 1HDCA 3OSZA 4Y18A 3VXKA 4K6HA 4WKPA 3HP4A 1VBNA 3DXYA 3H2KA 4KI7A 5CX1B 3R76A 2UYCA 3JQFA 3JSAA 5KHAA 4RF4A 3OLZA 4OLAA 5TEWA 4CBVA 3H86A 4TV8F 2O2DA 3DDNA 3ASVA 4TWZA 5BR1A 2XNHA 5KHOC 3L92A 1VSVA 1AA6A 2AOXA 4NAUA 5BURA 3F9IA 4LWZA 2CXOA 1K08A 4E5VA 3TOXA 3NVMB 4BL5A 3M9XA 4ZT7A 4M9RA 1FYFA 3NTOA 4OBWA 2C4NA 1SOVA 2PT6A 1RYBA 2IXAA 4O2AF 4R1LA 4B44A 1N3LA 1B76A 3UT5A 5T67A 2Q7OE 4LRUA 1PYOA 2PUTA 2F2TA 4UVGA 1WMDA 4PSKA 2OO5C 4MQEB 4U3JB 5HJEA 1EXWA 1R9NA 1QR6A 1YZUA 1GNRA 1ZD2P 2ZRMA 1QYIA 3K5IA 3NBAA 3R44A 4IJ6A 4AJLA 1DJMA 2VH2A 4M1ZA 4A0GA 1KVQA 5B5SA 4ASUA 4KC0A 2OENG 5F1KA 2HL6A 2J48A 4RQAA 3VHXA 4JLOA 4R4JA 3VU9A 2VTBA 1UPTA 1ZIOA 2V5UA 3DWIA 3KJIA 4TX1A 1D2MA 3LA6A 4DDKA 2NSYA 1C81A 1Q7RA 1SVOA 3FMFA 3GV0A 2JBHA 1ORWA 2X4LA 2K4MA 3QPAA 4OPMA 3TN7A 4B4OA 4IVPA 5L51A 3C6QA 3L0IB 3DXFA 2ZWOA 2BH9A 4QFBA 3WDSA 1P4HA 1W47A 1BGWA 1XP8A 4OYLA 4YCDA 4KWIA 1QPZA 2NMVA 4YT2A 3W5VA 1RQLA 1XYVA 4IGAA 3U4QB 5CLHA 3VVLA 4Y9SA 5DIFA 5EQTA 1H69A 1OZFA 3QWBA 1PE0A 4KKVA 3UGKA 3ZQJA 4CE6A 3N28A 3JYQA 1RXCA 1PV4A 2CL5A 1M0WA 3M6WA 5FO1A 1BGVA 1GSAA 3FH0A 3L4BC 4YAOA 3Q15C 2PFSA 4C20A 3FPJA 3PTLA 4KQHA 4LNHA 2X7HA 1KEZA 3ADBA 3EEIA 2JD2A 4U6QA 5HKKD 1JQKA 1G5FA 2Q3FA 3PEYA 1TT5A 2QI9C 4LPKA 4F60A 4WKNA 3TIXB 4CMIA 1N7JA 3G23A 1O5IA 1W48A 4P32A 4YRGA 3DAGA 3PFHA 2AMYA 3OFSA 4RAOA 4YRSA 1TL7C 4MWTA 1W88A 1E3JA 3QY9A 2H4ZA 3GF4A 3EA4A 3H1BA 4YJGB 3WIUA 1NW5A 1TUBA 1K8ZB 2VJMB 1XROA 4CTMA 3WGIA 3F71A 3KT3A 4A2WA 4RTLA 2H7XA 4KGXA 2A84A 2IOYA 3P5SA 2C2ZA 3UPTA 4L0MA 4TPKA 3LBFA 3SS9X 2Z6QA 3H19A 1YB4A 3VDQA 2DLCX 1IDOA 3QVKA 2QF7A 1ODFA 3FZQA 3KVNA 3DLHA 3CZ4A 1TQ6A 5JE8A 1QQ5A 1Q83A 3ZE2B 5JISA 1UM9A 1W0JD 3CTPA 3QENA 3QLEA 4QBGB 2H5IA 2ODPA 2YFKA 2BELA 2YC2C 3BXEA 2R0QC 3FPCA 3GLUA 4HMPA 1V26A 2Y05A 4KXVA 4CMAA 2F4NA 1Z6AA 2VT2A 5DYGA 3E4CA 1GL7A 4M46A 4RADA 3INYA 1L1EA 4OYYA 4UHJA 3O4RA 2FUG6 5FPYA 4BNDA 2VNJA 2K7FA 2O8BA 1V16A 5JYCA 1BH6A 2PN1A 2OUKA 4Q16A 2WSBA 4Y6QA 1GNQA 1LTHR 2O23A 1NVFA 2INGX 3RSGA 2NP6A 2HU2A 4HQKA 1M2OB 4LXIA 3QTBA 1KRWA 1NNSA 1RZ3A 1MX3A 4HDCA 2HH9A 3O7MA 1X8XA 4BNZA 1FFYA 1UOOA 1FU7A 1VLJA 2GNAA 1ES9A 1DOAA 2OK7A 3KUUA 3NXSA 3VNAA 2VNHA 4XD7A 3OTQA 5BNFA 5LYJB 4Z0PA 4DJFC 2IHYA 1JG3A 2R5NA 4LRTB 4XM1A 2EJTA 4IXMA 3K70B 2BP7B 1H0KA 1VHTA 3ENNA 2BI4A 2W0SA 1GGMA 3DL7A 2VUIB 2HQBA 4AYXA 3NKLA 4KNVA 3IUMA 4O4IB 1NGSA 1ACJA 4QYTA 3TOVA 3VNUA 4B34A 1DEKA 1A5BB 4RD6A 5HW0A 5I4KA 3AC0A 1JWLA 2Y99A 3E82A 2CZQA 4NARA 4BAGA 3FLEA 1MC5A 1XD9A 4Q3KA 3WLQA 1CY4A 2JCXA 3JRNA 4CKCA 3L43A 1ITZA 4LXHA 4QASA 4HVCA 1MQ8B 3L8CA 1Z4OA 3TMKA 3DHVA 4DM4A 1ZJ5A 1P1CA 3D4LA 1Q91A 2HNBA 2WWIA 1LDEA 1HK7A 2FSUA 2Q9UA 1GCAA 1HFWA 5HBRA 4UW9A 4PLWA 3CQ9A 1E92A 3ETCA 4UUMA 1W36D 3UW1A 4HNVA 3KAPA 1IN8A 2A0KA 1X9GA 4XWWA 2QW1A 4N12A 2HMVA 5T4EA 1L5VA 2XRFA 3D43A 1YB6A 1HPLA 2FSGA 2BMJA 4NAVA 5CDFA 3NTLA 1OZGA 3OCYA 3GJTA 4DIUA 1XQ1A 3L1UA 5I48A 2PZGA 1ZONA 3AETA 4CMBA 2VL7A 1KQGA 1EZZA 4H6XA 3C4QA 5IBRA 3M70A 1TW2A 1NW4A 3KCQA 2CDBA 3E1GA 4ZGBA 2C4UA 4NXMB 5FULA 2ID7A 1H93A 1PQ4A 3VPHA 4GD3Q 1JB1A 1Y5NA 1E2DA 4FOLA 3VBCA 3I1JA 3N0WA 1KGDA 3MTBA 3C39A 1XPRA 4LI0A 4N0PA 5IC5A 5K3DA 2QR5A 2O59A 2ZANA 4GICA 2FETA 3VYUB 1Q1EA 1T6NA 2AZ4A 4KP7A 4JEMA 2CLCX 2IYXA 1MV8A 5K3FA 1TIPA 3ODGA 2P0EA 3EARA 3Q9SA 1R8SA 1DIHA 3SEZA 2ZRFA 1THZA 4C3VA 5JH7F 5EJ2A 2O8FB 1TAGA 3BXFA 5EEHA 1IHXA 3TYXA 3T94A 3QBTA 4BV2A 2AFIA 3IKLA 4JMPA 3RUFA 1Y1KE 3NU1A 5CDYA 1GIAA 2GCGA 3Q5GA 3DZJA 4QO8A 3OQOA 1G63A 2V9ZA 1JIJA 3ZBPA 2FW1A 1ZMBA 2AH5A 3Q11A 1Z15A 2PY6A 1FOEB 4G5FA 4LXGA 3TZKA 4XVHA 4U7JA 2H4YA 1YS1X 2FCRA 1MORA 3NIWA 2HREA 1EFAA 4BVAA 4X8HA 2QTZA 1FUEA 2I6SA 3C8MA 4JWTA 1DTWB 4L3WA 4XPZA 3R2JA 5DM60 2ICAA 2IU6A 1E7RA 3BGSA 4MVWA 1UKEA 2HRBA 3QUTA 1HKHA 3ESDA 5F7ZA 4B8ZA 1L5MA 1VKRA 3MBKA 4Q01A 3F47A 3WLPA 2ZR8A 2YJTD 5B2ZA 2H48A 3Q98A 5LB2A 4ZCLA 3ZGZA 1RWWA 1EA7A 2ZYRA 1AHPA 3GRKA 1ZU5A 5MN4A 4FN5A 2GRJA 2JDID 1R8YA 2XGMA 3LM8A 5EN4A 1G2IA 4ZAGA 3S27A 2QJOA 4A6XA 4ALKA 1EX7A 3HFGA 5CDGA 4UBMA 5ICGA 2A0YA 3M81A 4G0ZA 4CL3A 3TLGA 3EQ7A 4G0UA 5KOJA 2AZDA 2VSNA 3DO6A 4PAGA 4PR3A 5JAMA 5G0UA 3R7NA 1K5GA 4P4SA 3N2GB 3OT1A 4NNJA 3SM9A 5B57C 2QJRA 3ZLJA 2R6AA 1EJ6A 1IUKA 3W5SA 2IQ5A 3PXUA 1JHZA 1V8DA 5HUJA 3AVVA 4UNSA 2EFHB 1IN6A 4UAGA 3T4EA 121PA 1GRRA 2HN9A 2NYUA 3CB2A 4IJQA 5EIOA 4H0FA 2X42A 1RWKA 4CGZA 1DQPA 1I1HA 2OFWA 2ZEJA 5DBEX 4Z9YA 5I8WA 1UJNA 3PNOA 4RJ2A 1OOEA 1F8GA 3LUBA 4JDPA 1C7QA 1GYRA 4LV5B 4F2WA 4IOLA 4KBYA 3WXMA 3P52A 1RHJA 2AOUA 1N36B 1Y6RA 3MTDA 3NW9A 2Y77A 3H11B 2WTXA 1NF2A 3OX2A 4MUXA 2Q0SA 5AKGA 1LF0A 4Z4CA 1VE3A 1ZM7A 4KIJA 3ZWNA 4BE7B 3TK1A 3QHPA 2OO5A 1XDBA 2G5TA 2GN2A 1VPTA 2IUYA 3PLRA 4S0XA 4RXTA 1R12A 2Q6TA 2VATA 2CLMB 3B6EA 3NJ4A 4P38A 4QAJA 5EIXA 3KB1A 4IOJA 4F06A 2WM9B 5KHLB 3MBOA 3ESRA 2QX9A 4OHRA 1P4GA 3DH0A 1J8DA 1QQAA 5AKEA 4K6FA 3OE5A 3GFVA 1YKSA 2OFXA 3BWMA 4HXYA 3W2FA 2I2XB 3OZVA 3QKTA 2FWAA 4AMVA 2FWBA 4M88A 2IYRA 2BLLA 2GRUA 3FYTA 2NADA 3AIMA 3PVCA 4L7QA 3LWNA 2XNSA 4LHXA 4LQCA 5G41A 4C1NA 4G23A 5CCEA 2YJGA 4KACA 4BPBA 5CXXA 1XUOA 2JAQA 1FYXA 4UPDA 4IEFB 3UNXA 4NJEB 4ENSA 2ZDGA 3U4MA 1FP2A 3Q5EA 5CT8A 4BFVA 4TYYA 1XP5A 5EEGA 4OHMA 4UAUA 1CS4C 4OGFA 1VYUA 1RJDA 2Y9PB 5FWYB 3Q7IA 2Y67A 2WV9A 2YZ7A 1P9WA 5C1IA 1EQAA 3HH8A 1TMOA 4R1QA 1L3BA 4A4DA 4F45A 2FSPA 3R6GA 1VPVA 3OURA 4MVJD 3OEHA 4F9FA 4X95A 4LJSA 4KJZA 5EJIA 2NVUB 1FNDA 3G7UA 1XU4A 2C5FA 4QLBA 1J7KA 1BHQ1 1PD0A 2BTQA 1DJOA 3F6BX 2VP6A 4JIMA 3A14A 3A4YA 4H35A 5JARA 3DCJA 2P9EA 3K94A 4TL9A 2FQWA 1QDUA 4FQ5A 3GJ4A 3P4YA 1MO4A 1FDSA 1PNTA 2FQXA 4PR0A 2ZQ5A 5IEBA 4BQEA 2EZ8A 1M72A 4IO0A 3KHTA 4RF2A 3OY2A 1WXXA 3UMFA 3IQIX 4QXOA 1E2UA 1KP9A 1XDSA 3DR5A 3D7MA 4J75A 4BE9A 5CEEA 3FNRA 3KNZA 3ZU6A 3IQEA 3B3GA 3GFGA 2Q50A 4YV7A 4ZQHA 1II9A 1DWUA 1XKLA 4LJAA 5CFRA 2QB5A 2PBRA 1QH1B 1G21E 3JAKA 4ROSA 5B1IA 1GPDG 3U31A 1YDMA 2Y66A 5KMGB 1H3NA 1NRJB 3UF0A 5GY7A 2REOA 3I9V1 5AFSA 4IIFA 2A5DA 2IA5A 2JLAA 2QRJA 2PX5A 2C7QA 2BTOA 4O08A 3VNRA 4MV3A 4TOIA 2ZSKA 4E51A 3WB1A 2R6GA 4N49A 1Y4ZA 4LPSA 2ZYVX 5EUBA 2HV9A 3KWJA 3RIMA 3GA5A 3KP1A 3B1WA 4LXTA 2BGNA 2O8DB 1HE3A 3H5IA 4FE4A 4NOKA 1R6XA 1TJ3A 3A3YA 5GJVC 4EYKA 3ID6C 4FFVA 3E2MA 4N0QA 3M5DA 4JFAA 3N07A 1WUYA 1N25A 4NPCA 1KDPA 3P0IA 2RAFA 3ZY2A 1NVKA 2O0KA 2PSDA 5JANA 3V4RA 1B15A 3BE5A 5E0KB 3N70A 3EOBI 2OGSA 3O0TA 2PUAA 1THGA 4Y0VA 3TCXB 3PWTA 4R69A 4UAJA 1LBIA 2ZRNA 3QOXA 3KKKA 2GSWA 3EXFB 4EM6A 1GGVA 1PZMA 4OHUA 1LVUA 1W6UA 2FFHA 3I9NA 4RVOA 2XTAA 4AFNA 3IUJA 1PJLA 2IZ6A 4I4CA 5K0SA 2YY6A 4BV8A 5TQVA 5BNTA 5EQDA 4DA0A 2CHVA 2DBRA 1NQOA 5AOCA 1Y7HA 3ZHBA 2B98A 1K3TA 3AHEA 4BFZA 3KDPA 3U61B 2PMEA 2FSVC 3GLHE 4Y1GA 4BP1A 1MRSA 1PZEA 3AHGA 1RBMA 1DG9A 1MEJA 3LPAA 3QOYA 4MKHA 1COZA 1MRZA 4UVHA 4X20B 2CWDA 4EI7A 1BDHA 1EFDN 3CXRA 3K9FC 3T54A 1I1NA 3LFTA 1E89A 4MDEA 3IEKA 4IGIA 2J7PA 3MQ4A 1JDZA 4D9CA 1KY4A 2KQUA 3FI0A 2G9NA 4NCBA 4HGNA 4RF5A 4G0NA 4EW2A 3WISA 1F2TB 2AC7A 1QYCA 3MXTA 1O0SA 4FFWA 4N54A 4XASA 4IILA 3IPRA 1A82A 4J7XA 3G2MA 1IZZA 2IXEA 1EVZA 1QZZA 2DQ4A 3AUTA 4FNAA 4QDUA 2EGHA 2PBZA 2ZTSA 4WZAE 5F5NA 3DMPA 2GN1A 3VR5A 4TRJA 1H2BA 3HBFA 4AWAA 5K8JB 1FP1D 1R15A 5LCXA 1IN7A 2JGRA 3PDIA 2DUJA 4MCHA 3VGJA 2CCKA 1QG0A 2OFFA 2O0HA 3HVJA 3X44A 4UNRA 3TL3A 4PPQA 5CA1A 4G0OA 3KPJA 2AF3C 3EPRA 3FHJA 4XUDA 2JGFA 1J49A 3PFFA 4S35A 4QIHA 1TO6A 3DE1X 3K0HA 4JJ6A 3OJXA 3CUVA 3ZI0A 1SU7A 1CQWA 3TQSA 2HD4A 2H17A 1D4OA 3BWVA 1WCIA 1JJ7A 1I24A 1FB5A 4ZOAA 4O63O 3V1UA 4DY4A 3O8DA 1BW9B 2VWHA 3MMZA 4MS3A 4P98A 3I76A 1FJGB 1ZMTA 2CDCA 1ZIPA 3FHOA 1NG9A 4Z53A 3LQFA 2RGCA 2ZU0C 3ROKA 3IODA 4NATA 3M5CA 4HTFA 3HY3A 4DOMA 5DK4A 2WWGA 3E7XA 3CSDA 4AWXA 3E18A 5BVGA 2X9QA 4MW1A 2DXIA 4JOBA 2OXRA 1T26A 1XFDA 5H7XA 1Z28A 3U13A 1DAHA 2HF8A 3VBEA 5A6SA 1W4RA 4YRRA 1ZI6A 1F0KA 5ILQA 3WKCA 2WFLB 1DFHA 1D0IA 2SECE 2ZGVA 3BWXA 3ZU2A 4JYAB 1C80A 1F6BA 1E8NA 3ME5A 4HUQB 4TTIA 2C84A 1Z8DA 3R7FA 5H0IA 3W5AA 1JVSA 2FNAA 3AFMA 4YA6A 2IYUA 3O0DA 5FXMA 3WLEA 4E07A 4XD2A 1AQJA 1M7GA 2Q6IA 3FNEA 1UDCA 2BR3A 4IVRA 4TYQA 5DN6A 5JVDA 2EG5A 5FWXA 1VLHA 2DBZA 1ZIYA 1DPFA 2FU5C 2FSIA 3RTBA 3EUFA 2C82A 2O7NA 1WE2A 2V97A 4N6OA 3GYBA 1JZSA 4FGLA 4WZ6A 3PE6A 3I28A 2J0UA 3TMAA 1GTMA 4AY5A 4HZUA 4H1TA 1JN0A 4R5MA 5FTJA 4MWBA 4RENA 1BVHA 2A9FA 4RLQA 2SKDA 3C5EA 2UZ1A 3UUGA 4X65B 3UICA 3ER9A 3LLMA 2WSLA 2XVYA 2GN9A 1KFBB 4XKJA 4YFYA 5IVPA 3MUOA 4E1BA 2KJQA 1E0AA 4I9FA 1Q44A 3A28A 4E1AA 3AB8A 3OAAD 4KIWA 5G4KB 1Q19A 2A1UA 4ZYWA 5EJ7A 4CQLB 4JYBA 3I52A 4TN1A 3RBVA 3BWCA 4CHTA 1SKMA 4A8PA 1YQTA 1T6ZA 2HHCA 3S44A 3VFDA 2GAJA 4QPNA 1UJMA 2BFAA 5KKNB 1QJCA 3THWA 5EWMB 2Y0EA 2ISSD 3LP5A 5I3ZA 4QLAA 4WBXC 3RHTA 3IUBA 1RS0A 5F73A 1HRDA 1IBCA 5FUXA 3LECA 4NKRA 3V7FA 2OESA 4G1FA 1AZTA 2PUGA 2FSFA 4LZAA 1VI2A 5CNIA 1NWHA 1PAUA 1XDGA 2CCJA 3FR8A 1AMUA 1NBHA 4B71A 3BSYA 4I2VA 2OG2A 1PI3A 2RB5A 1Y8RA 1NRIA 4EHHA 2PMBA 2QBYB 1Z68A 2PWBA 4L3VA 4Q3BA 1N2XA 1ECFA 1T1IA 3Q8KA 4CMEC 5KAPA 1RWQA 1J6UA 2W8BA 3RFFA 5ERGB 5K1ZA 4WZZA 4A3SA 4B6OA 1I6WA 3KR0A 4XJSA 5I7OA 4DT1A 2IDJA 3AEZA 2AEEA 5HS4A 2QZ4A 4CLRB 2Q6VA 3T8YA 1RLMA 5AOBA 2CHUA 2YIDA 2BEVA 4IJWA 4IIUA 1ANKA 2JIQA 2RHJA 4JL6A 1RI5A 4KAJA 4TUYB 1Q1QA 3HKBB 3ICVA 5F12A 5F64A 3A1SA 2I2WA 1QCDA 1WABA 2ENUA 2JVKA 2R66A 1JB9A 4FOOA 4HO1X 4PE5B 1RKBA 1DCTA 2NO7A 1DC8A 1BS9A 3RUDA 3T99A 4DIDA 2IY8A 1R2QA 3KYJB 3BSWA 3FDZA 4LYYA 2WZQA 4KPEC 2N1MA 3AL2A 2CNKA 3E5NA 4K6MA 4QDXA 1OJ7A 1YONA 2H59A 1XTSA 1CZUA 2YYAA 5C34B 3T9BA 3VUEA 3H99A 1XTQA 4PZUA 1KC3A 1YE5A 4OQXA 3ZW9A 4X8LA 2OEPA 4G1CA 3GNTA 4POOA 1JDPA 3GFTA 4ED9A 2QMQA 3T9EA 1QANA 3GVIA 5LQJA 1H8ED 2XMDA 5HQ3A 3A9VA 2RH5A 4OXXA 1T3HA 3B82A 4NULA 3AUXA 3HRKA 1G38A 1GD1O 5GONA 1RHQA 4MVJE 3CIOA 4MQFB 1MB2A 3PEFA 3OCJA 4I19A 3CR7A 1M3SA 4JX8A 3SQDA 5FH9A 2ZZKA 3DDSA 1RVV1 2VSFA 4FPXA 4J1NA 2O2SA 1KZ9A 2X86A 3DZ8A 3C8DA 3ZWVA 4F7WA 1POXA 3INRA 5CLGA 2HSGA 3EEFA 2FY8A 2H52A 1C1XB 3F2IA 3PKJA 4ZJPA 2CXSA 3BDAA 1NUTA 3N7TA 3DV0A 4WMLA 1L4NA 2PCLA 3RT7A 4X45A 2JW5A 4EX6A 4KUGA 2WYUA 4GU5A 1ZI9A 5JAOA 3OKFA 1ORDA 1NPYA 1VJ1A 2PUVA 1E3DA 1D4ZA 1MQSA 2BGIA 3EHEA 3KV3O 4GC9A 4HRYA 1P1IA 2CHEA 2JANA 1BCSA 1NFRA 4KZPA 1J5EB 2DRIA 3SWWA 2H1VA 3IE1A 4I9HA 4YGYA 1E59A 2ZCVA 1U3VA 4W5NA 1KQOA 1IFXA 3M8KA 4B73A 5CK4A 4LV6A 1IVYA 1CJKC 5REQB 2OVFA 2ZREA 3WHPA 4UU0A 3R7LA 2VTKA 4L6CA 5KWJA 5KO2A 3BT7A 1PGPA 5ICSA 3LL7A 5K0CA 2WJIA 3VPDA 1PYGA 2AG0A 3O6VA 1D6SA 1JA9A 1E8DA 2RC6A 1H42A 4J3JA 1TAUA 2C2XA 3LQRA 2HJWA 2JFWA 4KSBA 2PFKA 5F3WB 5D5PA 1S89A 4TKZA 3LHDA 5LBIA 4EYQA 4JENA 3IV6A 4BMYA 3FPBA 1NR7A 3R75A 3L7JA 4LKOA 2G9RA 2WJHA 2FI1A 4H7HA 1N6KA 4KAAA 1EWQA 1ZOOA 3BHIA 3W3AD 1S5PA 1SHKA 3QFRA 1RHMA 3H4MA 5BQFA 3RAJA 2O8CA 3FMPB 4IKOA 2LE0A 2Q29A 4HDKB 4L5AA 3RBAA 1D1PA 1UBCA 1TJYA 1JNXX 1X8JA 2OCPA 4BECA 2I2DA 5DTRA 4G5HA 3CKLA 2WHYA 1PWZA 1VL2A 1NUUA 3KQMA 3KKOA 3WGKA 1IJKA 5I01A 2FSVA 1DE0A 3AJDA 4DPMA 2JZOA 4D4IA 3WLNA 3J7TA 3JQQA 4Q05A 3K6KA 3LCRA 2HCBA 3NBFA 4MVJF 4HT3B 4PEVA 3G8CA 5FO0A 2I8AA 3RG8A 4KYVA 3UUWA 6YASA 4EPXA 5CNJA 1A2KC 2NU7B 5H5JA 5U4XA 3GRRA 1PT9A 1SQGA 1YS9A 5EQJB 4A73A 4DUPA 4C7VA 3A1UA 2H08A 4ZO8A 3RANA 4IXTA 3UHFA 4BB5A 5TGZA 5FWNA 2ZAGA 3IR7A 1EB8A 2XDWA 5HF8A 1F0PA 3BWDD 2PKYX 1EBFA 4LXUA 3SC3A 4FNOA 1YI8A 3HJRA 4BO3A 3F97A 3V4ZA 1H4VB 1DDIA 2NSDA 4FZ3A 1M34E 5BWCA 4RIEA 1ACLA 3QBJA 2PTGA 4IHJA 5CM8B 3LZ6A 2NVOA 4BFLA 1A8IA 1ISSA 3RC2A 4HX9A 5DT2A 1V7PC 2IVZA 3RRNA 4X61A 4NICA 3W5UA 1KDYA 4YC7A 1RRMA 2JGNA 2ZUWA 1ST3A 1XJQA 2VYVD 3OPQA 4OJKA 1L5QA 4C01A 4I3GA 5GQSA 3RUIA 3CONA 3ADDA 4IOMA 3DW3X 5DYIA 2XRMA 3I01M 5TQ0A 3DCNA 3QX9A 2WJVA 1KMNA 4A27A 1VA5A 1GTL1 4FSDA 2FN9A 2PO5A 1ZD3A 3HA2A 4FMCF 4UZEA 1KOFA 3Q12A 3WI7A 1R16A 3LCMA 1XGKA 3KFXA 4RFVA 3O4VA 5LLSA 5KC8A 5ER9A 5I47A 2NNLD 5IHPA 4FNGA 1O89A 4HDRA 3QVVA 4IRXA 4EJMA 1YRQA 3HVHA 4GZLA 1C0IA 1ECCA 3L0YA 3ZWCA 1EXMA 2ADOA 4DS3A 4EUKA 2MMCA 1C7IA 1SKBA 3DVAB 4ZZIA 3FYSA 2YKGA 3VGPA 1H9CA 4EKGA 3L7NA 2I4IA 2OHJA 2H2GA 2NYVA 2Q5QA 1PEYA 2VRWA 4Y2GA 3SHFA 3Q2KA 1GSIA 4I99A 4AJPA 4EFMA 1GUZA 3MT7A 2VXBA 1DKRA 1WHSB 4DADA 1M0EA 5F2EA 3RDPA 4CYMA 5H9VA 4Y8VA 1OFUX 1S2GA 4X8MA 3UH0A 3OI7A 2AZTA 3PWKA 4CDMA 3R3XA 1CY0A 1T9ZA 2KM1A 4F85A 1XLWA 4B75A 2V5VA 3CTMA 4FWTA 2OV1A 4XX0B 3EGDB 1UC5B 4QG3A 4C3ZA 5L3QA 2QTFA 4CLHA 3L8EA 3OPYA 3FSEA 2LW7A 5LOVB 1NVEA 4Y2HA 1E61A 2QIOA 1RHRA 3M7IA 2P77A 1RQ7A 2ZTLA 2AD1A 3V2IA 1QP7A 1XCBA 3G7NA 4OREX 1QC5A 1VYHA 3KU1A 5HKOA 5K6TA 3EEOA 3K1ZA 1DOZA 1GR0A 2JFYA 1Y1LA 4G65A 4BCDA 1K89A 4RK7A 2TMGA 2R47A 2F17A 3QQPA 3T5GA 2J6BA 3W04A 2IWHA 4HWPA 3GDOA 3L7CA 3KV1A 1JXOA 3BH6A 3IDOA 4H0NA 1QAMA 1UXHA 1EI9A 1SIUA 3DXXA 3I1IA 4HAVA 3VV3A 4V0NA 5EJ4A 5JJKA 1IEXA 4K88A 1YL5A 3CINA 2QZJA 2IYVA 2ZSJA 2OY0A 1YR8A 1U02A 4AJNA 1XZKA 1PS9A 1ZUHA 1DLJA 1FMCA 2EHDA 1VBMA 3H2BA 3L84A 2XIQA 4KLAA 3G59A 1NJ2A 5AMXA 3I1YA 4IAOA 3EUAA 2M1XA 2YBDA 1R4MA 4DMMA 3JD3A 5IJAA 1TEVA 3AVOA 5EUMA 1BNCA 1EHYA 5JQWA 5JNWA 1IEWA 2IZ5A 2X22A 2XZDA 4OQNA 5SICE 5C5CA 5TMPA 1R0RE 1P73A 3RVPA 3QKRA 1YWGO 1VKZA 2OECA 1II8A 2WWVD 1BQ3A 1ZNXA 5KI6A 2RHMA 4K87A 1JAIA 1TM2A 2KPOA 4L28A 4QQFA 2BFDA 2QD5A 3O1IC 4ZD6A 1NONA 1ZFNA 4C88A 1FK8A 2R6HA 3G8AA 1XEXB 3OA0A 4R9RA 4QFCA 4B09A 4BFXA 2WTEA 4PIMA 3R6TA 2B0JA 1XELA 1F9AA 2D74A 4TMTA 5FOVA 2VJLA 3NASA 2HA7A 3ZNPA 3WZLA 1AK9A 4EPTA 4B83A 2P7HA 4X64B 3IE0A 1ZUNA 3ROEA 4K28A 2OZKA 3OM1A 4AJJA 1Z4KA 3L5KA 3AUSA 5D8DA 2VP2A 5D51S 4Z4IA 2Q4DA 3GHHA 3ZGXA 2GBIA 3P9XA 1N3IA 4X3OA 2WAOA 1U1GA 1ATZA 4DQDA 2HT6A 5I4CA 3KXLA 4WKGA 2NZ8A 1HYGA 5JNSA 5JZMA 4J7CA 4ETNA 4EKYA 1YB1A 4KLNA 3F5SA 4TLMB 1RRCA 1QRRA 3EA5A 3ICCA 4PBRA 1O1YA 2UUOA 4TYWA 2UVPB 3P0RA 1DGQA 5ALQA 2R00C 3T7IA 4LHEA 3E1SA 5DWDA 4HNRA 4KH1A 1IK4A 1G9TA 3NG1A 4LTNA 4WLUA 4UJ5A 5EP1A 3WL5A 3U7FB 2DR0A 1FTNA 1GU7A 4YJ3B 1L7NA 4EB6B 2GLXA 1PW7A 2FEMA 4GMHA 1V6CA 4MQ4A 4P84A 3DZIA 2AX4A 4TSFD 3TI7A 2RKWA 5DSXA 3ZWAA 1NXSA 2PQMA 2ODWA 2VA9A 1Y6JA 3I04M 4NZPA 4P33A 1UUFA 3C1UA 3PJEA 4L51A 5EXDA 5BSHA 1USVA 5E4FA 4LVOA 3HCNA 3NX4A 1RPJA 4BO6A 4D98A 1I7PA 3ESCA 1QRAA 4DC0A 5MN6A 4RKRA 1A4IA 2GK3A 4YP0A 5T4BA 1IUNA 1KJQA 3AHHA 3SJBA 3BS4A 2QRKA 4RIGA 1QVZA 4LDQA 3K70C 5IYZF 1U7DA 3IDZA 1J56A 5IJ9A 2VHCA 2PRKA 3IKVA 3S2YA 5DHPA 4LY0A 3IX7A 4GLOA 2WY2D 4A6EA 2YIVX 3CJQA 3CNHA 1KY2A 3WSVA 2VDOB 2WB2A 4ZALA 1J4AA 4Z4EA 4QUAA 2WT9A 7REQA 4KGDA 1QYVA 5M2QA 5C3MA 1UOEA 2VUUA 5EE5B 3VJKA 1H2AS 1ZLYA 2CL0X 1HDRA 1QDLB 3U1BA 4LJYA 2W83A 2X1MA 3A8TA 1SUDA 4ESEA 1SCDA 1U7TA 3G9ZA 3OZCA 3PI7A 3DONA 5FLYA 2EJVA 2ZSIA 3VU8A 2Z2ZA 2C4HA 1GA4A 1M2GA 1R5BA 1YQGA 2WZDA 2F55A 1ZAYA 3HY6A 2EL9A 2PO7A 1E63A 2P5SA 2EJUA 1NVUQ 4IJUA 4N7RA 5IP5A 3SCZA 4A2QA 4EQ6A 4WZBE 1UCFA 5I9NA 2AEFA 1WU8A 1UK9A 3OO1A 3BG5A 3IAS1 4ENVA 4NFLA 3OQNA 2O8VA 5DBFA 3R0ZA 2YYSA 3CRVA 4YROA 3EVFA 1Z08A 4OHBA 3OOSA 3EEQA 4BFTA 3PX7A 1NXOA 3KPYA 2KLHA 3A2NA 4MV9A 3FWNA 2B5WA 3GZNA 3PXCX 2FR8A 1F60A 2CE7A 2GBCA 2NYAA 3WJ1A 1PR2A 2V7WA 3ST7A 3MEQA 1VLQA 1X70A 1M1YB 3NC0C 3DL2A 4S24A 3S29A 3SQLA 3SX0A 1HOTA 1NBMA 2JIDA 3RF7A 4ZOLB 3IMFA 3RTCA 4UQLA 3U44B 5JEEA 3RLIA 2F1IA 4JROA 1H2HA 3WYDA 3DJYA 3WIOA 5L8VA 2BSQA 3PJFA 3GLTA 3ZHRA 1ISHA 2QVGA 2EQAA 2ZQYA 3DYIA 3U3MA 4L27A 3USZA 1RD4A 1LD3A 1QF9A 1U2EA 3RRJA 3S2UA 4ZU3A 3OOYA 5IK2A 1LDNA 1PS0A 4FHZA 5DRYA 1TF2A 1L7MA 3R5TA 1QONA 4QWMA 1L5LA 4NWIA 1TMYA 3MJTA 2QJFA 1IXYA 4PYIA 3RF6A 1GRVA 2JFUA 1FXSA 3QF7A 2JGAA 1FSZA 3EJWA 4G01B 4HJXA 1GKKA 3NIFB 3LUGA 4G0PA 4R2WA 1CSEE 2J4DA 3GJYA 4IHQA 3TF5A 2F67A 3CLSD 3A9RA 1AN9A 4YUZA 1OX4B 2VSOA 2C03A 3OCWA 2J5BA 1HNNA 4M8LA 4ASUD 5KPJA 1E3EA 4JMLA 4X9XA 3JQ7B 2YMLA 4K6OA 3BIJA 4Z9AA 2YIMA 3ZN2A 4D92A 5ARBA 5ICCA 2XA1A 3A1VA 4DR1B 3DSRA 3W7AA 2Q21A 2VXOA 4GWKA 3LX8A 4IKEA 3H2YA 3DLAA 2MR6A 4M38A 1MX5A 4QGBA 3RUPA 4PN3A 2JJMA 3PJRA 2FEPA 4L5CA 5B4VA 4QFMA 4HK4A 2IOHA 1DQZA 2OZPA 2WP8J 2HCTA 1I6MA 1TU3A 1W0KD 2EF1A 3CR8A 3QUAA 4TWAA 1FFWA 4YALA 5H83A 1Y81A 3O8LA 2JAHA 4TLAA 3D7SA 2WSIA 2ZDHA 2KWIA 4CG3A 2J3JA 1CR4A 3H2ZA 4UUAA 1X77A 3GOQA 2FLWA 4YP9A 5K51A 4OMDA 1JBKA 2NPFA 3C70A 1UWLA 1UPFA 4I81A 5AKHA 2AT1A 2R25B 3EODA 4J0JA 4K40A 5SYNA 2FEWB 4AK9A 5A0VA 2V0GA 2RD2A 1QOZA 2C8LA 2ZUVA 4FIZA 3SR3A 4Z0HO 4AYWA 4H1VA 1C3OA 3SIWA 1KNQA 4X1IA 3KVOA 2W6MA 4FT2A 3CJTA 4PLPA 4AKTA 4DF3A 5CX1A 1VHLA 4YCCA 2WWTA 4F1WA 2YMQA 1QU3A 1EVYA 3ITNA 5E2IA 1U80A 1E3MA 2R8XA 5B6PA 4KU4A 2PUEA 1IXKA 1F17A 1F20A 1RI1A 2EQ5A 4RWZA 4Q4HB 3VH4A 2A78A 5K09A 4M7OA 2WU8A 2WG1A 1JYFA 3BSFA 3E6AA 3KOUA 4NL4H 2H1RA 4CT0A 4URFA 3BWBA 1NLZA 1C5KA 3BD6A 1GNSA 1ZGBA 3JCZA 3FIUA 4BC0A 3AERB 2IYPA 2XAAA 2ZVPX 4KWCA 2MTBA 5HM8A 2VOEA 2VF8A 2J3EA 3IP6A 5IG2A 1JKJB 2FPIB 5DOVA 2VF5X 4HEQA 4BIMA 2C20A 2WAAA 1TADA 4OQFA