1W0CA

Inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
276
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDVGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Leishmania Major Pteridine Reductase by 2,4,6-Triaminoquinazoline: Structure of the Nadph Ternary Complex
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 98
structure length 276
sequence length 283
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w0cA00
1T24A 4MOWA 3DL2A 3GFBA 3MOIA 1FF9A 1FK8A 4Z3KA 2UAGA 1PIWA 5TGDA 4YT2A 1DFGA 3MJVA 1XWFA 3QE3A 1HLDA 2CVQA 1ONNA 4RLSA 4XJSA 1DLJA 4M87A 1I3MA 2P2SA 1E0DA 3BTOA 4MDHA 4AJNA 3JYLA 1ENZA 2Y1OA 4RPKA 3BMNB 1EK6A 2P5YA 3I6IA 1CQIA 3ZW8A 3GQVA 1MP0A 1K6JA 4HKTA 3QVXA 4CV2A 3M2PA 2E6UX 4DVJA 2R00C 2WTBA 2YV3A 1D4FA 4YXFA 2PTGA 4CL8A 2DPGA 4E2ZA 3JQGB 4RLHA 5DDIP 3PHJA 3T4EA 3ZU4A 5K9ZA 4BGUA 1KS9A 4D0RA 1WP4A 4WCFB 3BMNA 1NP3A 3OICA 2CDCA 1QYCA 1T25A 4R01A 3FR7A 2YHUA 2YHIA 3WLFA 5JW6A 1VJTA 3E18A 3H8VA 4E5NA 2IXBA 2EW2A 4RDHA 5JDCC 1OOEA 2JD0A 1ZVMA 1ENOA 4CV3A 1RM0A 5ER9A 3S8MA 3GK3A 1P44A 1DLIA 2BGLA 4G5HA 4NQZA 4ALNA 3GVIA 1V9LA 4ZRNA 3ZH2A 1RYDA 4ND3A 4B4WA 2FN7A 3OJFA 4D46A 5EINA 1JQBA 3ZNPA 3PWKA 4YYZA 3GFGA 3INGA 4U6SA 4DLLA 2F00A 1EE9A 3VPSA 4A73A 4IDFA 4NU5A 4FOOA 4WOJA 4CM3A 1DXYA 1VSUA 2GUGA 4XIYA 4IJKA 3G0OA 4K9DA 1HYHA 1EE2A 3WGIA 2PLAA 4FR5A 1KEVA 3LDHA 1QV7A 4O0LA 3H5AA 1FDTA 3R3SA 4LCJA 4ZQGA 3GGGA 1KIFA 2FY8A 2W8ZA 4XQCA 2ZJ1A 4PGFA 4B4OA 1Q0QA 2NU7A 1A71A 3TF5A 1ENYA 3VPHA 5CPFA 4BNMA 3RASA 1R0KA 3FF4A 3OA2A 4IDBA 3KB6A 4LMRA 4FJ0A 4BNYA 4MP6A 3EY4A 3VPXA 5BSGA 4MKXA 4OJNA 4LN1A 5IAAA 4CMGA 3AI2A 4JGBA 1Z82A 1GUYA 1PJ3A 4F3YA 2HQ1A 3OECA 5HS4A 3DBRB 1Z6ZA 5EN4A 4GVLA 4ROSA 2FPPA 3DZFA 3VZQA 3IDSA 1NQAO 1T2AA 4LW8A 4IXTA 4OL9A 3CMCO 1QMGA 2UV8A 3KEQA 1YBAA 3K96A 1GZ4A 1MFPA 4L4XA 4Q3NA 4ZRMA 3PRJA 3PPIA 3ZW9A 1RJWA 2G76A 2ZIZA 3INRA 3O8QB 1NVMB 1I10A 4WCFA 1KOLA 4BO0A 4CL3A 2YFHA 4N5LA 4ZQHA 1LA2A 4QO8A 5CAEA 1H93A 1I3LA 1KBZA 2NVBA 3WBBA 1H6AA 1IB6A 4CM4A 2Q1TA 3RJ9A 3BMCA 4PG5A 5CEJA 3OM9A 4LGVA 1QV6A 2JAHA 3GZNB 4WEOA 5IZ4A 1V35A 2D4AA 3UUWA 1WDLA 2O48X 1YQXA 4ALIA 2O2SA 1E6UA 3PK0A 3K31A 4CMIA 3FCOA 4ZQFA 3BTSA 3WGZA 1DPGA 1N1GA 3MWEB 2I66A 1HDOA 4W6ZA 3GF4A 1YONA 3I9JA 4IIVA 4J7CA 3NEPX 5EPOA 3E9QA 1ZUD1 3NT2A 4BO4A 3UHAA 4OIMA 5DULA 1QYDA 1P45A 3RI3A 1HZZA 3WS7A 5ILGA 4D44A 1MUUA 2VYND 4IS2A 2D3TA 1MG5A 2X9NA 4AJOA 1KVTA 5I9NA 5BNTA 4GH5A 4P38A 4BNTA 3GDFA 1NM5A 3I9LA 3QWIA 3ETDA 4R1UA 3LVFO 3U9LA 3SC6A 1UZMA 1VM6A 4XWYA 3G49A 3KEOA 1UXIA 4IJVA 4JQCA 3LT1A 3ZGYA 1N5DA 1QSGA 4NK4A 2NTVA 3L4BC 1NR7A 2A4KA 3WR5A 1PGJA 3QWFA 5GY7A 1ISJA 3IUPA 1R16A 2QX7A 5IN4A 2VYVA 4UAGA 2OP0A 1E7QA 3BHIA 2PGJA 1T1SA 1ZKMA 1ID1A 4E33A 1NFQA 4AG3A 1UDCA 3LC7O 2X6TA 5L7WA 3OHSX 4PLFA 1Y5RA 3ADPA 4PG4A 1K3TA 3JSAA 4WNIA 1HL3A 2IYOA 3GGOA 1XU7A 4UVEA 2UYYA 3HWRA 3W8EA 4F45A 1M2WA 5JC8A 2D5AA 4CMJA 2VRCD 4KUHA 3S2IA 4AJJA 1UZLA 2DU8A 3DHYA 3BA1A 1X7GA 3B1KA 3OF2A 2XXJA 1TI7A 4E5PA 4YJGA 3U62A 3U49A 4TKLA 4LSWA 1J49A 4EJ0A 1E3WA 2ZQYA 4BO6A 5L53A 4IMRA 3B1JA 3HJAA 3HDQA 3U4IA 5G4KB 4AJKA 3LC1O 4YPOA 2CF5A 4PVDA 1P1FA 3IS3A 2OFPA 2OBYA 4GX0A 4N18A 1JKJA 1E1MA 3WMWA 1F17A 2V6FA 3JQ8A 4WOKA 2VZ0A 2EGGA 2CD9A 1X13A 4FPXA 4W4TA 1FDSA 1AHIA 1ZK3A 3IUSA 2GPTA 4JNKA 5IZCA 1HLPA 3NJ4A 1E3SA 1BSVA 2Q1SA 4NK5A 3W4IA 4E30A 1N1EA 3PXXA 4MJLA 1UXJA 2NTJA 3L9WA 4BIIA 5CEEA 3FHLA 1I3KA 4NMHA 1LLUA 3QWAA 4WKGA 4IZIA 1WLYA 4I5FA 1AHHA 5EMHA 3V8BA 3NV9A 3G3EA 3BYZA 4MKZA 3NKLA 1DRWA 3UICA 4PLTA 1MV8A 3F4BA 2H5LA 3C7DB 4FFRA 4Q3BA 1ORRA 4CLXA 4ZN6A 1Y8QB 4CM4B 1U2DA 5B37A 2Q49A 1NAHA 1C1DA 1LC0A 3GEDA 1NHGA 1ZSNA 3KZVA 2HJSA 2OXIA 1N2SA 1PGQA 1HSZA 3F4LA 2BF7A 2QIOA 3RBZA 4ONEA 3WMXA 4BO2A 2X22A 3BMOA 1P1RA 3IIEA 3JD4A 1WPQA 5EQDA 1EQUA 1AN9A 1CDOA 3HFGA 2VHWA 4HFNA 3PQFA 2AQKA 3ZU3A 1QXSA 3Q2KA 1E3JA 4AJ2A 3OH8A 3PYLA 5B4UA 2GN9A 1ONPA 4QQRA 1LC3A 5F5NA 1GUFA 2VT3A 4RGBA 1JKIA 1ZK0A 3CE6A 3E5RA 4DREA 1C0PA 4MIYA 4Z0PA 1XDWA 3Q0EA 1Q2XA 3WDSA 3NRCA 2DM6A 1DRVA 1PS0A 1ARZA 2X5OA 3VAZA 2GZ2A 3FPCA 4PLWA 4PZDA 1PU2A 4D3FA 3DBLA 3OEYA 2ZCUA 2JFGA 2EEZA 3QIVA 2NU8A 4ZHSA 1CJCA 4TSKA 4CM9A 1CIVA 2DQ4A 2JL1A 2YV2A 4FGWA 1YJQA 4A5OA 1NVGA 2DC1A 3G17A 4XGIA 1IULA 1C3VA 2D5CA 4G2NA 2WD7B 1MC4A 1UH5A 4Y6SA 5ER6A 4FC7A 4CPDA 2NWQA 4B7XA 3H9EO 3GRPA 1GV1A 3AI1A 2O3SA 3BIOA 2YQ4A 5F1OA 3INTA 3VOSA 2X9VA 3AJRA 1Z45A 4PVCA 3O03A 3DOOA 4YCAA 4GSKA 1X0VA 4GQAA 4IDDA 4RF3A 4GLOA 5C7IO 5A1TA 3EZLA 4P8RA 4JBGA 3C24A 1QG6A 3U0BA 5L3ZA 4CR6A 3TFQA 5ENVA 4LSMA 3OMLA 2EWMA 2YUTA 1DOHA 1M76A 2RH8A 4K26A 3K5PA 1W73A 3GEMA 5U4QA 3ZWAA 3AM4A 4W9NA 4GPD1 4EUEA 4ALLA 1Y8RB 3C1OA 5CG1A 2Q4EA 2P5UA 4JJGA 3GMSA 2FR0A 3ETGA 4TROA 4ITUA 2HKIA 1F14A 1E1NA 2NQTA 4XDYA 4L73A 4JCOA 2VCYA 4ID9A 4NBWA 4QSMA 1SBYA 1CYDA 2R00A 2I99A 3N74A 5I7SA 4WLNA 4MPDA 4BGIA 5I7EA 2EHDA 3KRTA 3OBBA 4RCVA 2C20A 5AXDA 1PJQA 5CDTA 3JD3A 1GYQA 2NV6A 2VYNA 2V6GA 3C7CB 3F3SA 3GG2A 3E82A 1A72A 4NBRA 4IQ0A 2GASA 3GMDA 3RBVA 1HE2A 1I8TA 4FFOA 4WCDA 4BNFA 4YJHA 1EVJA 2JJYA 1EVIA 3DFUA 4IQGA 4Y9DA 4UEOA 4OHUA 3WBFA 3ONDA 3MZ0A 5DP2A 5A9RA 3CUKA 4J0FA 1B7GO 1LNQA 1I2ZA 1GPDG 4AVYA 4BMVA 2JCXA 4OO3A 3I9OA 4W7HA 4AJEA 1KETA 4ZVVA 5IDXA 4O63O 3OJOA 3ZU5A 1PQPA 3HE3A 2DFDA 2ZJ0A 2Z5LA 1E77A 3SBOA 3SJUA 3ZWXA 1ZEJA 3EUWA 4CUJA 2O7SA 1DIHA 3C8MA 2P9EA 3OFSA 2ZK7A 3GRKA 1IPFA 4HFMA 1LDBA 5LC1A 4BV9A 1HDRA 4CQMA 4RQTA 4DIBA 2FRDA 2B4RO 1HWYA 1QLJA 2C29D 3DMTC 2W2KB 2ZB7A 4EW6A 2D59A 1DJQA 2VT2A 1EVYA 3WFJA 4XKJA 4RDIA 4YTEA 3QSGA 2DBZA 1DIAA 5I7VA 2GF2A 3PJDA 3GC6A 3WFIA 3GZNA 3PTZA 4EZBA 3VPFA 2BFPA 1R6DA 1Y5MA 3MWDB 4IGFA 3W8DA 2XF8A 1RKXA 5KVSA 2VTDA 3GGPA 4K1LA 1IE3A 3IOYA 3AUTA 5EIOA 2R6JA 2I65A 3GVXA 4XR4A 5TIIA 1IL0A 2AQIA 4I5GA 2UUPA 4WLUA 1D1SA 3T7EA 1A7AA 2QZ9A 4DQUA 3M2TA 1U7TA 2YQ5A 2J3JA 4YAKA 5COAA 4MVJA 3JQEA 4FQ8A 4BNXA 3JQAA 2E4AA 3IQDB 4RVSA 2NSDA 3MJCA 1GPJA 1LSSA 3QWBA 1BDBA 4I1IA 2IZ0A 5COBA 3WWYA 4NJOA 1HKUA 2NU9A 3ROKA 3UKOA 4UUNA 4GMFA 2PD3A 3EVTA 2CFCA 2HUNA 2Q3EA 3BZUA 3Q9NA 5G0SA 1XR3A 4HV4A 4BQPA 4GGOA 4M89A 3D1LA 1VRWA 4QX6A 1C1DB 4A27A 2Q99A 4BO8A 2EERA 4G81A 3AUUA 1L7DA 3AY6A 3LLVA 5JSFA 4Q3AA 3DBHB 3L4BA 1IHYA 1JVBA 4A10A 2FZEA 5EL0A 4BNLA 2W2KA 1YXMA 3DXFA 3D64A 4OAQA 2ZYAA 2Y1DA 1OAAA 2OO5A 1E92A 1KY4A 1ZBQA 4HWKA 2IODA 1PJ4A 1T2FA 3ASUA 3GPDG 1ISMA 1PR9A 3AI3A 4J91A 3DZJA 2X7HA 3ITKA 3WQRA 3CZMA 1PZGA 4IDEA 4YAGA 2FSSA 4ND1A 2FR1A 5GZ1A 1C0LA 3RU7A 5A04A 1EEHA 3NTOA 3D0OA 1DIBA 2P4HX 4FFLA 1KC3A 2EF1A 3ENKA 3LZ6A 4BNWA 4W82A 1JLLA 3W4KA 2PZLA 1CEQA 3KTDA 3JQAB 4M49A 2ZQZA 2C2YA 3FN4A 4RPLA 3S2EA 3ZZNA 4BKOA 5BSHA 1M6WA 2VQ3A 3ETEA 1JN0A 1I36A 1PWZA 2AQHA 1EFKA 1UDAA 2PA3A 3JQ7B 1U8XX 1QP8A 1E5QA 5TNXA 1RPNA 5U1PA 4GAEA 1WAMA 2BELA 3DOJA 4B8WA 3PWSA 3I4FA 5JYDA 2QYTA 1PZFA 3ICPA 3KLPX 4BNHA 1PJ2A 4RF4A 3FNFA 2GR9A 4Q3EA 4GWKA 1Y9AA 3IMFA 2ZTVA 3FNEA 5FYDA 3PZBA 4J1QA 1HEUA 3KSZO 5JBIA 1K6IA 3HG7A 3I23A 4WCFC 1L7EA 4KMSA 4PLGA 1A4UA 1WXDA 2BMAA 5KIAA 3IP1A 2GLXA 3HNPA 4FCCA 4B3IA 2CZCA 2HO5A 3H2SA 3AOGA 3H6KA 4TVBA 8LDHA 3GZ4A 3E1KA 2PKQP 5ES3A 1CQJA 3ROPA 5JY1A 1ULUA 2BRUA 1YB4A 2DAPA 1HYEA 1R4NA 2EP5A 1YDWA 4GBJA 3DAPA 1GD1O 5FI5A 4PCVA 4Z3DA 3PFWO 4YWJA 3AFNA 1TT5A 3OJLA 1MX3A 4C7KA 5JFOA 1IYZA 1VC2A 2WM3A 2VNAA 4HUJA 3WWZA 5FFFA 4E32A 1K0UA 3OP4A 3WICA 3S55A 3MJSA 4IJUA 3IC5A 4J1TA 4C7JA 4YJHB 5T5QA 5C5IA 1Y8RA 3QVOA 2HSDA 4ALKA 4FFPA 4IY1A 1LRLA 1P9LA 4TQGA 3B20A 1FXSA 3ZWWA 5A03A 3R0IA 3WYCA 1PJCA 1A4IA 4P22A 5BQFA 4CLRA 1G0OA 2W2LD 5DCUA 4F6LA 2LDXA 3ZWPA 1O5IA 2VTEA 3LF2A 2JCYA 3EC7A 1LDYA 1EFLA 3SC4A 5ADHA 1WW8A 1PGNA 3LSYA 3CIFA 1RWBA 5FWNA 3F5QA 3RUIA 1LLQA 4WE3A 2EW8A 5LDHA 3C1AA 4L75A 4A03A 1GCUA 4UVHA 5BNIA 4QUKA 4BO5A 2AG8A 3KYCA 3FWZA 1VKNA 1XHLA 1PGPA 3WG9A 1FMCA 4KOAA 1W6UA 2DBVO 2X5JO 4M1QA 3FSRA 3U4CA 3STHA 2PD4A 3W6ZA 5TF4A 2OMEA 2VWPA 3PIIA 2IYPA 2X1HA 2NVUB 4L0QA 4XZ3A 2PZKA 4E13A 1VLLA 3U3XA 2Q50A 2UVDA 2XPCA 3JQDA 3H5RA 4GI2A 3QVSA 2PKRA 3ZWYA 2RBEA 1B14A 1H6DA 2J3KA 4OXNA 2V65A 3AUAA 5F21A 4RVDA 1T4BA 4KWHA 5KJ6A 3LC2O 4QT0A 2IZ1A 2NADA 1KVSA 3LT2A 4WECA 4YAJA 5DP1A 2FSVA 2OGUA 2EV9A 4ZD6A 3RC9A 1OC2A 1NASA 3TFOA 3K73O 3HDHA 3KO8A 2WMDA 3M6IA 4R3NA 3L77A 1P33A 4CMEC 5HBRA 3WQSB 3MTJA 3WSWA 2ZB8A 4KP7A 1SO8A 3U5TA 2DBRA 2EXXA 3ZWMA 3GUYA 3CZRA 4J3FA 4YQYA 1V8BA 2VZ8A 2GYYA 4A2CA 3ADOA 3PDUA 1GQYA 2D2IA 1LSUA 2H6EA 3T4XA 2RIRA 1M75A 3MOGA 4IQ8A 4XD2A 5TX7A 3O9ZA 1HDYA 1GADO 1ZZEA 4E5MA 4P4GA 2CNBA 2VWQA 4Z0HO 3JQBA 5TS3A 1CERA 1LBEA 1O6ZA 3GNSA 2VWHA 3D5QA 2EGHA 4XRRA 2G0TA 5DCYA 4UUMA 1I2CA 1VKOA 4OSPA 4UEJA 3ZV6A 4YB8A 4PN3A 3LT0A 4FOSA 4E2WA 4KTTE 1E3EA 1P0FA 3E5MA 4Z0TA 3KSDO 1LRJA 3HADA 2C7GA 1N92A 4OYRA 3S2FA 2HMWA 2OBNA 5THQA 5L4SA 2DTDA 4B3JA 4JP3A 3ZHXA 9LDBA 1VL8A 2HK9A 2YYYA 5C37A 3TQHA 3AM3A 4E5YA 5L45A 4TMFA 3UCEA 4YJFA 4A26A 1TLTA 1ZO8A 3LF1A 1H94A 4FFMA 3ONFA 3RAJA 4F6CA 4QFCA 4Q3DA 4UEKA 2CY0A 2Y0EA 4PZEA 4CQMB 5LCXA 3QRWA 3B6ZA 2DKNA 4W9NC 5KTKA 4L9RA 1DC4A 3PQDA 3ZWVA 3HFSA 5U9CA 2GNAA 2Y1CA 1KEPA 4BNIA 1LQTA 3ZHZA 4EDFA 1X0XA 1IHXA 1KVUA 4GSLA 4BMSA 3WB9A 4E31A 5A02A 4FSHA 5JDIC 3BTUA 1GFSA 4OKNA 4YJGB 3LQFA 3IJPA 4CJXA 1T1RA 1NQTA 4BHTA 3IJRA 4XQ9A 2WE8A 4TWRA 1LUAA 1BXZA 3QA9A 1XA0A 2CVOA 4JX8A 1LTHR 2PWZA 3OSUA 2B5WA 2OHXA 2DFVA 4D0SA 2PY6A 3H9QA 4U5QA 4FN4A 3DDNA 1U5CA 2P91A 2BFAA 4IDGA 2DBQA 3L6DA 3AK4A 2Y99A 3PWZA 4AFNA 5JYEA 5AQ1A 1ZMOA 1EVZA 5TT0A 1U3WA 3PYMA 5T64A 5T6BA 4IJWA 2FP4A 4EUFA 1BMDA 1PGOA 3OJEA 3Q6IA 3W6UA 5B4VA 3KXDA 1UXHA 5TRTA 1SB8A 4O6VA 4U6QA 3WGQA 5DNAA 3U09A 4WLEA 2B83A 2HU2A 3RFXA 3FR8A 4YAIA 1LXCA 5KJCA 1ONOA 1NTOA 1WVGA 2VYVD 3JD1A 1QKIA 5BR7A 5CDUA 5JCJD 1JWAB 3SLKA 2IZZA 2BFMA 1YKFA 4II2A 3AOEC 4QO7A 5JC1A 2WSBA 4KZPA 4ZICA 2PGDA 4MIEA 1N9GB 2BLLA 2UDPA 4R54A 4XB1A 4RZHA 5JY6A 4XR9A 2B4QA 3O38A 1GYPA 2RHRA 1BXKA 5BSFA 3ULKA 5IDQA 3K2EA 3FNHA 1SOWA 1TVEA 1VJ0A 3EVNA 1DHTA 5ILOA 3HB5X 3ZWOA 1KVRA 3PFFA 3TL2A 3TWOA 1QYWA 3PHHA 5L40A 1NR1A 1RM3A 3VZPA 1E1KA 4JROA 2ZKLA 2B35A 1T2DA 1OFGA 1JW9B 2YV1A 3QWHA 4GLLA 4WUVA 1GY8A 4I5EA 4J2OA 2YDYA 1KVQA 3WX0A 2HK8A 3RCBA 1ZXBA 2Z95A 1T2CA 3UCFA 4PLYA 3EK2A 3JQ7A 4BS9A 3QV1A 1NXQA 1P0CA 2A9FA 1SPXA 2W2LA 3PVZA 2BHLA 3RC2A 5IZCC 1SEVA 5G2OA 4CMBA 2O4CA 4IUYA 3JQBC 1XKQA 4CLDA 2RCYA 2FHSA 1A5ZA 4IINA 2O3UA 3TZCA 4KUEA 4YT4A 2Y93A 1B26A 5C3MA 4BV8A 1SZJG 4XQGA 3S2GA 1JKFA 4NI5A 4S3MA 5TC4A 3DTTA 3HHPA 3ITDA 1GQQA 1A27A 3V2UA 2E82A 2AHRA 3AW9A 1QR6A 1MG0A 3PJFA 1Q0LA 3ONEA 3I9KA 5BNFA 1YQDA 3AU8A 4I9UA 3O8QA 2J5QA 3M1LA 3G1UA 4KQWA 4AJLA 4WNCA 4IPTA 1A9YA 1WMBA 3KHUA 1I01A 3VH3A 3VH1A 2Y1FA 4EYEA 3FNGA 4B7CA 2HCTA 3KVOA 2YY7A 3RUAA 1X7DA 3S1LA 1O8CA 3ZDFA 3ZCXA 1YBVA 2D8AA 2IRWA 2BKAA 1ADBA 4CMKA 2NQ8A 1FDWA 1YL6A 5BSEA 4GWGA 4UREA 3ZI0A 5T57A 2FWMX 1VSVA 4D3DA 3D3EA 1EDZA 5T8KC 3A1NA 3P7MA 4CV1A 4N5MA 2I67A 3ZNOA 1HDXA 2J5RA 1U9JA 4R5MA 4QXMA 3I5MA 2X8LA 3NYWA 4E21A 4GX1A 3DONA 2PGLA 1R4NB 5I9MA 3ASVA 3QLJA 4C4OA 2AEJA 3IKTA 2G5CA 3L6OO 5JAZA 4IDCA 4RF5A 4BL5A 3GN1A 1IUKA 5I9LA 2JHGA 4NFSA 3PJGA 3Q1LA 3WOHA 1E7SA 1NAIA 1O95A 3DHNA 3DZKA 2OUIA 3DZGA 2XOXA 4ILKA 1BXGA 3L0DA 2RH4A 1V3UA 5HRUA 2E37A 4DPKA 1E7WA 3N58A 2IXAA 3G79A 3Q9UA 2GDZA 1XSEA 4JIGA 4DPMA 4HP8A 4UULA 3UGKA 3NGXA 3JD0A 1JAXA 4FJ2A 3ZHYA 2BI8A 4WASA 2Q2WA 5K6AC 4OQZA 4YVFA 1HDCA 1I32A 4D79A 4EI2A 4DXHA 3B1FA 4PFJA 1B3BA 1R15A 1ZK1A 3KYDA 1EK5A 4R5HA 1ENPA 5JMPA 1X14A 5GMOA 1I24A 3WIEA 3WJ7A 4PG8A 5JCXA 2DUWA 4J9VA 5F5LA 3MCVA 3JTMA 3PI7A 4DQXA 1GUZA 3GHHA 3PJEA 4J6FA 1QYXA 1Z7EA 1DAOA 4UVDA 2DLDA 3QW2A 1UP4A 4E6PA 5DCWA 3LYLA 5MGBA 2BI7A 3WYEA 3ROMA 3G1TA 4H3VA 1YGYA 1G1AA 3OETA 3DC2A 2BD0A 1YE3A 4PLHA 4R1SA 3VZSA 3GOHA 4BB6A 2PZJA 1PEDA 1UUFA 5DOZA 1XEAA 1D8AA 2ET6A 3CXRA 3AY7A 4DYDA 4INAA 4J2HA 1ISGA 3FBGA 1SAYA 5EERA 3AU9A 3DO5A 2HK7A 2E49A 1J0XO 3ICCA 4OKIA 4JJFA 1RYEA 2PZMA 3SLGA 3TZQA 1DB3A 1P1HA 4I08A 1VJ1A 1F0YA 3H5NA 4MVJH 4AL4A 2Q1WA 3JV7A 4Y67A 4M8SA 4JBIA 2HRBA 3V5NA 4R3WA 1WDKA 2RAFA 2V6BA 4CM8A 1O9BA 2C2XA 4CV0A 4WGGA 1JA9A 5L7YA 2OZPA 4IDAA 1NVTA 2NTNA 3VC7A 4R68A 5DZSA 5F3RA 1YBMA 1KY5A 3PHLA 4ND4A 4HADA 5FEUA 3DZBA 3WNVA 4LVCA 3DWFA 3AFMA 4GMGA 4O59O 3DMYA 1P1IA 1XQ6A 4J7UA 3I52A 4OXYA 3HSKA 2X5KO 4TRJA 4O5OA 3SEFA 2OL4A 5A9SA 3JQ9A 1GTMA 1SB9A 2JKVA 2B4TO 1QLHA 4RPHA 3BMQB 4RZIA 3WQQA 5L4LA 3WXBA 4CMEA 4O1MA 3M1AA 5H81A 1HE5A 2JD1A 5IJZA 2VHYA 2HMVA 4U0JA 1Y7TA 3JYPA 4OH1A 1K6XA 2P4QA 2ZYDA 3DFZA 4BQRA 1BRMA 3UVEA 1MA0A 4PRKA 4FW8A 4PLPA 3WGOA 3TZKA 4ZQBA 3U4HA 2WD8A 1ZEMA 4IZHA 1VL6A 3GT0A 1J5PA 3KUXA 1OBFO 2V6MA 3WTCA 3GG9A 2X0IA 5FI3A 2I3AA 2JFFA 3MEQA 3AM5A 5IG2A 1YL5A 3RJ5A 2Q1UA 3RKRA 1DC6A 1B8UA 1WNTA 3HQ4O 1BHSA 3WYBA 2AEFA 4HNGA 1U7HA 2XAAA 4RQUA 2B69A 2I6TA 1G6KA 1Y81A 1UP6A 3GA0A 2B5VA 1DHRA 5F1PA 1GEGA 1R37A 2DUUA 1ADFA 1N7GA 1R0LA 4XGKA 1TA4A 5G0TA 3TZ6A 1W8DA 3ZN2A 3LT4A 2PH5A 4NFHA 4Q39A 1GU7A 5IXSA 3VH2A 4ZU3A 3F1LA 3GY0A 1AE1A 3OIGA 3FBTA 5KKCA 4BB5A 3VZRA 1XQ1A 4BNNA 4J4BA 5G0VA 5TT1A 1Z7BA 2PR2A 1P31A 3F9IA 4DIFA 1DSSG 4E5KA 5A9TA 4DMLA 9LDTA 3L6EA 4AJPA 2Y0CA 1HE3A 1NBOA 3TN7A 4BO7A 4E0BA 1PJSA 5EESA 1LX6A 2PFGA 1LQUA 1Y1PA 3HB4X 4YDRA 4YRDA 1KEWA 4R9SA 3QQPA 1KERA 4MINA 3CH6A 4K28A 1E3LA 3DAGA 4TRNA 4B4UA 5JLAA 5L9AA 2AW5A 1L1FA 3ENNA 3H3FA 5A9SB 5JNLA 4PLZA 1JU9A 4IXWA 3RSHA 1B8VA 5MDHA 3I6QA 4DYVA 1E6WA 4RORA 4J4TA 1ADCA 3TOZA 1MLDA 5ICSA 5AOVA 3OIFA 1R4MA 1R4MB 2GERA 2LDBA 3O4RA 1GV0A 4GGPA 3UCXA 5C7OO 1VE9A 3KM0A 3RU9A 2GRAA 3EGOA 4NJMA 1NFRA 1P77A 1YB1A 2YFQA 4XQEA 1ZXLA 4YJDA 3P19A 3GR6A 4J49A 1A7KA 4OMUA 1YS4A 2ZB3A 3N7UA 2ZCVA 2FMUA 1ZK2A 1ZJZA 5A06A 4HY3A 3UAGA 2NVWA 1LEHA 3JYQA 1V0JA 4BMNA 5JPIA 3RUDA 3O26A 4ESOA 3EMKA 3D4NA 1YOVA 1VL0A 5JAIA 2C54A 3ANLA 4R1TA 3FTNA 1Z73A 1UR5A 3E9MA 3H2ZA 2EIHA 2J5KA 3E03A 5IDYA 4BNGA 2QRLA 3Q2IA 4A0SA 1YRLA 1IPEA 2Y68A 4JN6B 1H9BA 2Q2VA 1NFFA 2WJPA 1C14A 4GKBA 2VN8A 4I9HA 4NFYA 1YWGO 3CEAA 4PLCA 1HDGO 4XA8A 3RUEA 3TJRA 5B4TA 3D3WB 3WJAA 1DRUA 2WDZA 3K30A 3PLRA 1X7HA 1XELA 1Y8QA 1O0SA 1O94A 1ADGA 3ZWBA 3UFXA 3MJTA 3A14A 4CM9D 2Y05A 2B0JA 4AJ1A 4YT8A 4IM7A 1I3NA 5KKAA 1SMKA 3CTMA 5A3JA 4BUCA 4Z9FA 1DBVO 1PJLA 4RVHA 3K92A 1SC6A 5KVCA 4BO3A 4KUGA 4DBVO 2GO1A 4I8XA 2O23A 5K0ZA 1YO6A 4MVJP 3VTZA 5KJFA 1Q7GA 1AXEA 3VH4A 2GSDA 1WZEA 1UXGA 4DL9A 5GZ3A 3SVTA 5JXWA 1ISHA 3ZNQA 3OIDA 1KEUA 3K2BA 3GPIA 4K6FA 5A4DA 1ULSA 3EAGA 1UZNA 1F8FA 3R3JA 2IE0A 3D4PA 1YJ8A 5G4KA 1LDEA 2AG5A 1U28A 1EUDA 1JAYA 1E7RA 4PRLA 2D0IA 3CPSA 3TOXA 5CHEA 4DA9A 5IXYA 2AE2A 4BOYA 2B37A 4ZA2A 5HS6A 4D3SA 3P5SA 1EUZA 2QRJA 3ABIA 1JTVA 1LJ8A 4N54A 5CDYA 2WYWA 2JAPA 4WPGA 3MTGA 1QORA 3JQ9C 4FDAA 3TDKA 3GLQA 4NBTA 4RPGA 4YBZA 4RVGA 1B15A 3ZV3A 2GGSA 4HFJA 3BHMA 3KOUA 4XDZA 3JQ6A 3F1KA 1Q0HA 4GL4A 4IBOA 5JO0A 1DC3A 3RKUA 2AQ8A 1B3RA 3RUFA 1LSOA 3F6YA 4XYEA 2FOIA 5DBIA 3VVCA 1M66A 2X4GA 3NTRA 5B1YA 1EZ4A 1U3VA 1ZCJA 1E3WB 4DMMA 2BGKA 1H6CA 3L4SO 2QYSA 1LSJA 2IEBA 2HLPA 2EJVA 3K8ZA 4KTVE 5KWEA 3LK7A 4M86A 1BW9A 2DTXA 1N7HA 2QW8A 4NH4A 3VTFA 5A5EA 1J4AA 2GN6A 2QRKA 2FPGA 3EZYA 1U3TA 2VRCA 4L76A 4FB5A 5IFLA 2NVUA 2V7PA 2VRBA 3PP8A 2CMDA 3HZZA 5EJ2A 4M55A 3QY9A 2O7QA 4KQXA 4K6CA 5ICMA 4BO1A 4B3HA 2GZ3A 3ST7A 1NPYA 1LLCA 1ZFNA 2VUSA 4CQMD 5BT9A 1ZNQO 1HE4A 5JS6A 2Q4BA 1YB5A 3IAHA 4L4SA 2DVMA 3X2FA 4OOEA 1PX0A 3ROQA 5L7TA 3ORFA 4NR0A 2JHFA 2IDZA 5I8ZA 3GUCA 2YHIB 2C82A 1V3VA 4FFNA 4MVJI 2ILTA 3WSVA 3JQCA 4CLOA 4TRRA 1PL6A 3DZIA 3GNTA 3VDRA 3IL2A 1BVUA 3DR3A 4DLAA 1NHWA 2EKLA 3EYWA 4DBZA 1EUCA 2O3QA 5JDCA 3DBLB 2HDHA 4ALJA 1BG6A 5DOVA 4JLWA 1IY8A 4R9RA 4D45A 1NWHA 3KBOA 3R6DA 4RVUA 2PV7A 5TSDA 4Y8VA 1I2BA 4MVJD 5JO9A 2X23A 5A3VA 4E2XA 1WWKA 3JQAD 2AXQA 3OA0A 4UUOA 6ADHA 3RWBA 3VDQA 1F8GA 1X15A 5JE8A 1HZJA 2PNFA 1HT0A 1MC5A 2WYUA 3GHYA 4DC1A 4XRGA 3RUHA 2O3RA 4JJIA 1B16A 3I83A 4CMIB 4BKRA 2DPHA 3H9GA 4Y6PA 5LDGA 3DBRA 3PQEA 4RVFA 4XB2A 1K5HA 2F1KA 3P2YA 2A35A 4R69A 4YR9A 2W4QA 2AEMA 3FD8A 1DC5A 1YL7A 4CM5A 3I4CA 1PL7A 3KLMX 4R41A 5K6AA 1QRRA 1PR3A 1U5AA 5THKA 5C7LO 4II3A 4ZQEA 4WK6A 3VKUA 5TJ9A 1V6AA 4FIZA 4OM8A 1NYTA 3TZHA 4PIVA 1TT7A 5J23A 1U3UA 1PL8A 3I9MA 5AXBA 1LRKA 4LMPA 1ML3A 1UJMA 4IGEA 4E12A 3GEGA 1GAEO 2VHXA 1YDEA 4JK3A 3TNLA 4NDNE 3RC7A 3FWNA 5KNLA 3JQFC 4B8ZA 2O4UX 3QVWA 4HNHA 3WNQA 5JAMA 3W1VA 5JAQA 2C0CA 2J3IA 2YZ7A 2QHXA 3ZWNA 1HF3A 1F06A 2GCGA 2P9GA 4YRAA 3GAFA 1VPDA 1GZ3A 4BNKA 1XLTA 4YA6A 1FDVA 4MIOA 3JD2A 3V1TC 3WLEA 4PZCA 3ZNNA 1R12A 2CSUA 3GVCA 1UXKA 1YVEI 1KC1A 4CLHA 3NAQA 1GZ6A 4UVGA 1SNYA 2IEDA 3JYOA 3E6AA 1ZH8A 2GZ1A 4CM7A 3F46A 5I8WA 1GL3A 1RM4A 4BKPA 2VHVA 1HETA 3C85A 3MJEA 4WLVA 2AMFA 3PLNA 4CLOB 3H7AA 3Q3CA 3DOCA 4CMAA 3PGXA 1AXGA 1LI4A 1NQOA 4TZTA 2PKQO 1AUPA 3E9NA 1SCUA 2HAEA 2JFHA 3DB2A 5H83A 2VUTA 1F12A 4FJ1A 2HMTA 3VPGA 4L74A 4QTZA 1DEHA 4AJHA 1JDJA 4BKQA 4ZJUA 4OOFA 4Z9YA 1Q7CA 4L4RA 4XJTA 3PHIA 2Q46A 3NUGA 3WTBA 4Z9XA 2BFOA 3F47A 4CLRB 4Z6KA 4IMPA 3DQPA 3RROA 1PQUA 1TXGA 4NHEA 2AE1A 3FTPA 3JQGA 2B36A 1MXFA 1JWBB 1NPDA 1KYQA 2J6IA 1B0AA 2VHZA 2XXBA 2ZYGA 4J90A 4RF2A 4MVJE 3DBVO 4NZ9A 5DBGA 4WLOA 5L4NA 3GDOA 3W8FA 4NBUA 2RHCA 4RJTA 2GN4A 1PQWA 4LK3A 4DPLA 4LRTB 3V1YA 3OQ6A 4MP3A 3E48A 4ALMA 2Y0DA 1P1JA 5AVOA 2FPIA 3D5TA 3B70A 2O50A 7ADHA 1LDGA 2QZZA 1Z75A 1XU9A 3EW7A 1ISFA 2VZ9A 4KDFA 5KJ1A 3E8XA 3JQ8B 4JXKA 3TRIA 2VOJA 3WGTA 1GR0A 1W4ZA 3PYXA 3AY3A 4E2YA 1PSDA 1R66A 2SCUA 1YH3A 2O2YA 4A7PA 2BGMA 5HTOA 1H5QA 1UP7A 4GX2A 4AICA 3UXYA 1D7OA 2J8ZA 1X1TA 3C7AA 4NIMA 3RBXA 4AJ4A 4CUZA 4IIUA 1H2BA 4RPJA 1R0SA 2FZWA 4OGWA 3UW3A 4CR7A 4DIOA 2P9CA 2Q45A 1S6YA 4KWIA 5KVQA 4DGSA 1P74A 5F1KA 2A94A 4JP2A 3RIHA 2CUKA 1DDOA 3HN7A 1NQ5A 3D4OA 1ZSYA 4TRMA 1GDHA 4D42A 1CF2O 4BNUA 1DFHA 3PDJA 4UUPA 4I5DA 1BGVA 4PLVA 1SOVA 4B7UA 1IOLA 3BXXA 2WYVA 5CEFA 1DFIA 2TMDA 4EGFA 4FD3A 5I7FA 3NX4A 4FS3A 2ZATA 1TT5B 1LDNA 3ZWCA 2PH3A 4DWVA 5ITWA 4X54A 1QYVA 3P2OA 2HJRA 2DT5A 3SJ7A 3ZV4A 5B12A 5COQA 4HFRA 4CQLB 5HM8A 1BW9B 2X58A 3IKVA 2ZTLA 4Y98A 4YAEA 2A92A 1DJNA 4WEQA 4J43A 3WIDA 3NT5A 5KOIA 1P1KA 1MB4A 2CDAA 3RVDA 3NGLA 1RM5A 3KYDB 4UVIA 1IZ9A 4FBGA 4NU6A 1VI2A 4BGEA 4TVOA 2OOSA 1CRWG 3IP3A 4HBGA 5JDIA 4YT5A 1GEEA 1MGOA 1T26A 4J1SA 3CINA 1B2LA 1C1XB 1EDOA 4YJFB 4M54A 1G0NA 4DC0A 3GN2A 2CDBA 4IS3A 4MKRA 2VUUA 1BXGB 3HUDA 1YOVB 4CM6A 3WGGA 1X1EA 4GKVA 4CM1A 2G17A 1TB4A 2CF6A 4N7RA 1JVSA 3H9JA 4U8GA 4BKUA 4LVUA 3AOEA 1C0IA 4YEDA 4TKMA 1HSOA 3DBHA 2P68A 1TEHA 5CP8A 3CMMA 4CMHA 5FF9A 4J16A 4RO0A 1EMDA 5JCJA 2AA3A 4EJMA 4XCVA 2ZTMA 3FRJA 4E3ZA 1GCOA 1CWUA 3RQSA 1YQGA 3DAFA 2UUOA 3C3XA 4R4JA 2C07A 2Q2QA 2R2GA 4S1VA 4CR8A 1E7YA 2I9PA 3R1IA 1I30A 4RV9A 4B79A 3BHJA 3DTYA 4XYBA 2X0NA 3W4JA 5JMWA 2POQX 2NUAA 3PGJA 3OQ1A 3UN1A 5AXAA 4E4YA 5AYVA 3KSUA 3H3JA 5G0UA 1U4OA 2O3TA 1H9AA 5GZ6A 5TJHA 3BMQA 3OJ0A 4L8VA 2OP1A 3GVPA 5ITVA 2YW9A 1Y9EA 2NM0A 4H15A 1E1LA 3K6JA 2OORA 1Q1NA 4QEDA 1ZIDA 3MJ4A 2H9IA 3ON5A 2ZTUA 2HRZA 1Q7BA 1P3DA 2ZB4A 3ZU2A 2Z1MA 4F46A 3ANNA 5IF3A 3H9UA 1OC4A 3AWDA 4D41A 1FDUA 1LU9A 1O89A 1PWXA 2C59A 3BTVA 3LLSA 3PEFA 4XX0A 4CM8B 3UF0A 2W98A 1PS8A 4J7XA 5KJEA 1V3TA 1DO8A 1ZSVA 3QHAA 3VVBA 4QFDA 3V1UA 1D1TA 4R51A 5KVVA 4FGSA 2HMUA 3D3WA 4DUPA 5HA5A 4YRBA 5DBFA 3PHGA 1XYGA 4LCEA 5IN5A 3DMTA 5ENDA 3EHEA 4DTIA 2TMGA 1K2WA 1SEPA 5TLSA 2QQ5A 3K9QO 1EQ2A 3I3OA 3F5SA 5EQFA 5HWSA 3ANMA 2G82A 1ZK4A 3WGHA 1T2EA 4XGNA 3VHRA 4RL6A 1XCBA 1C1XA 4ZGWA 3V2HA 4XYGA 1PTJA 4Q3CA 4NPCA 4DLBA 2Y1EA 1XGKA 8ADHA 3SXPA 4BO9A 2WE7A 1U1IA 3Q11A 4BVAA 5T8KA 1W0CA 2Y67A 3U4DA 1N8KA 4OXKA 3BAZA 1M6HA 3DEYX 2DTEA 5CDGA 1LDMA 1N9GA 2X86A 4NG5A 2D1YA 1HRDA 2Y66A 3HN2A 1PJTA 4TZKA 4BNVA 3NTQA 1HYGA 2PK3A 2H63A 1OZAA 4CMCA 4EEXA 5G4LA 3QVTA 4PG6A 2H1SA 1MXHA 4Q9NA 3AUSA 4J1NA 2VOEA 4WJZA 2EKPA 2WD7A 3RUCA 4Y6RA 1EBUA 3RC1A 1BDMA 4DRYA 4EITA 2Y1GA 3L9XA 1E5LA 2C5EA 2YJZA 2PD6A 3CKYA 2GN8A 4NJMB 5CPBA 6LDHA 3I9NA 2VNSA 2X9GA 1ZW1A 4D7AA 1FJHA 5T67A 5DN9A 1BWSA 5DT9A 3OQBA 1H0KA 3GNQA 4XYMA 1U2GA 4JBHA 3UOGA 3QP9A 5CG2A 1AGNA 4BNZA 3FI9A 1IZ0A 4AJIA 1HTBA 3UH1A 2NLOA 4EBFA 5L51A 1D3AA 1UAYA 3H4VA 1S7CA 1ZMTA 4XEHA 1C0KA 1Y6JA 4U0KA 2C5AA 1PS9A 1ISIA 1I33A 4LISA 3EDMA 3A28A 2EKQA 3CSDA 2W90A 3RD5A 3BMOB 4QECA 4W7IA 4ND5A 3BMCB 3DHEA 2EJWA 2JCVA 2WWRA 3HDYA 4J9UE 3VKVA 1BVRA 1B8PA 2I76A 4YQZA 2VWGA 3DZHA 4DQVA 1XIVA 1E6EA 3L07A 3GAZA 3I1JA 2EG9A 3A9WA 2NU6A 3X2EA 3V2GA 1DIGA 1DAPA 3KYBA 4YACA 4CUKA 3PIDA 3TPCA 5TQVA 5CDSA 4MP8A 4XYLA 1PZHA 3NDJA 4NBVA 1A9ZA 4R16A 4CODB 1E3IA 4OQYA 4J0EA 4WLFA 4OSOA 3NJ8A 4W99A 4FC6A 1NX6A 4EEZA 4I9NA 2BH9A 2O3JA 3KV3O 1NPTO 3RFTA 3NT4A 2X0RA 4R1NA 1J6UA 3TL3A 4H16A 1OI7A 2I3GA 1WMAA 2I5PO 3JCZA 4U7WA 1E7MA 5CFZA 4EUHA 1K89A 1LLDA 2CVZA 4J4HA 2G1UA 1Z74A 3KYCB 5IDWA 3RFVA 4MO2A 2WEKA 4CLEA 1WDMA 1NNUA 1XG5A 1U4SA 3A06A 1CETA 1H6BA 4GX5A 4P4NA 1DIRA 1WZIA 2FR8A 1M67A 5L95A 2C7VA 2X0JA 1NWCA 2NACA 3GVHA 3GDGA 3A4VA 1T4DA 4B4VA 1U8FO 1GQ2A 3PZRA 4XIJA 1GYRA 1I0ZA 4D43A 5DF1A 1UAGA 4MVJM 2GD1O 4KDEA 3H65A 3HDJA 5G0WA 3WGYA 3D7LA 4URFA 2NNLD 2JD2A 3LU1A 5A5FA 3COSA 5H82A 1HDZA 3T7CA 1BTOA 3TSCA 4G65A 5A05A 4BNJA 1EBFA 3C1TA 3SX2A 3ZV5A 3NDRA 2J3HA 7MDHA 4MVJG 1PZEA 4BGVA 1H2HA 5KCZA 3ZHBA 3OEWA 4CQLA 4HXYA 3KETA 3NDIA 1I5RA 4N5NA 4ND2A 1HXHA 2E48A 3QJ5A 3JYNA 4MVJF 4P4LA 2EP7A 1MFZA 1OMOA 1ZJYA 4GVXA 5AXCA 3GH3A 3JQFA 1UDBA 2YDXA 3FPLA 4EJ6A 2HMSA 1PJBA 4PG7A 4HX5A 2Z1NA 4H7PA 2QG4A 4NNJA 4LRSB
chains in the Genus database with same CATH superfamily
1YR2A 4C29A 2WPNA 5I9BA 2JBHA 3IR6A 4OHYA 2GM9A 2AMYA 3GFBA 2QLFA 2J9YB 2PTHA 1OT5A 1XLWA 1XTPA 2UAGA 3ZY2A 3H75A 1DFGA 2ZANA 4YT2A 3PUYA 2IOQA 1XQVA 3RS4A 1HLDA 1CB0A 3IIJA 4RLSA 1JSXA 4RKRA 4C2TA 3O4IA 1ZGGA 2OGSA 1COZA 3PICA 1E0DA 3PXEA 1CZHA 5CYOA 3W6NA 4AUEA 4F21A 5JJBA 5LN1A 3CJRA 2H1VA 2OCIA 4GE3A 2Y1OA 2PL3A 3BMNB 4ESVA 4H0CA 1O9GA 3WYFA 5IM5A 4MVCA 3Q12A 4P84A 1KFJB 3D3QA 1COWA 2B1IA 3I6IA 4J3JA 3ZW8A 3RIMA 3LC0A 4EY8A 1EWQA 4AKIA 1QHEA 3GYGA 4CV2A 3M2PA 2AOTB 2PRJA 2WTBA 4YAOA 1P9OA 2ICAA 2P3OA 1N9ZA 1V5WA 3MBIA 2C2HA 3R0JA 4LHZA 1XTSA 4CL8A 4AQDA 5JS8A 3VZSA 4RLHA 3HVJA 5DDIP 3PHJA 1XMPA 1RRKA 4I50B 4BGUA 1ISSA 5B2FA 3SQXA 3B53X 1C29B 3CRQA 4OUDB 1WP4A 2WICA 3BMNA 1M8FA 1NP3A 2CDCA 2Y77A 3OICA 1R3DA 4YMUA 4G3XA 2CXRA 1TKCA 2A1TR 3UG6A 2YHUA 3H8WA 2IHUA 3ZJYA 4P4SA 1Z0ZA 1RHRA 3EH2A 4B3GA 3K2IA 4PINA 1U90A 3H8VA 4JXJA 1O4WA 2XKBA 5C8XA 1W36D 2YRWA 3BSFA 1N36B 2JJQA 3UAZA 5EI5A 4HQKA 1G19A 4RIGA 4CT5A 3WRXC 1G20A 4RMGA 3QPUA 4CV3A 5ER9A 1Q0ZA 3S8MA 1F1BA 1GVNB 4ZO7A 2R8ZA 5CLJA 1TTTA 1H66A 1P44A 4G5HA 2WC1A 4QULA 2FFQA 2HPHA 2POCA 3LECA 4E1VA 3VU1A 4EB0A 1SK9A 3K0FB 3P1JA 3VI4B 1WABA 5K0LA 3OJFA 3GLIA 2NT3A 2C9BA 4EDHA 1EINA 5A4KA 1JQBA 4CCYA 3JATB 3R3UA 3OT1A 3T0IA 4KFSA 3GFGA 3QEMB 2F9MA 4UAUA 1EE9A 1J8MF 1TPYA 1POWA 1MAWA 1NV9A 4NU5A 1TCBA 4QUGA 4CM3A 4XIYA 4B6OA 2GK4A 1G5QA 1VG9B 2KE5A 2P6UA 4K9DA 2QTBA 1EE2A 2XGGA 3IV6A 4PX2A 4YFVA 1OY1A 1AKQA 4FR5A 4Q21A 4CN9A 1YQUA 1QV7A 4NMLA 4OBXA 2Q9CA 3UNXA 4QUIA 5HE8A 3TQSA 4O4JF 1MR3F 4H17A 4ZQGA 2ZVDA 4I3GA 4TXHA 5EHQA 4I66A 2G8LA 3THWB 1T36B 1XZFA 2WNIA 2ZJ1A 4PGFA 2IU3A 2KX7A 2O7VA 1GN9A 4ETMA 1PHRA 2NU7A 2XAUA 1ENYA 3FB4A 1J9EA 3A1SA 2GN2A 3K15A 2D54A 3N2EA 3FJOA 1Y1RA 1QVAA 2YIDA 3C7KA 3COWA 3FJ1A 3ICOA 3PL5A 3EEOA 1R0KA 1Y3CE 2Y1XA 3FF4A 4INPA 4ZTBA 1Z7GA 4NQRA 4BX3A 4FJ0A 3SYTA 4MP6A 1NRXA 1BA2A 3DKPA 1QGZA 3LPDA 3TE7A 3H8JA 3ZY6A 5BSGA 1GPMA 3HRKA 4OJNA 4X85A 4B2LA 5IAAA 1G63A 2FPGB 3AI2A 3DKVA 3EXEB 4Y2QA 1GDTA 2HL6A 4G0MA 1U8ZA 4LSGA 1Z47A 1X92A 1N3IA 2FGJA 3KYJB 5JZ9A 3UV6A 4NJEB 3CR7A 3DBRB 5EN4A 1P0MA 3DEKA 2CXPA 3CCCA 3DZFA 1R5BA 2FYTA 2YOGA 1NQAO 5LNK6 1HNWB 3BREA 1USWA 2ID9A 2X4LA 4L9AA 3ZGVA 4JI0B 4MUEA 2HHLA 1CY6A 1YBAA 1GZ4A 4UHHA 1WM1A 1SU6A 1PV1A 2P6PA 3H2IA 4Q3NA 4Q7LA 4CU2A 4ESHA 4NENA 1J0BA 4ZO4A 2QL5A 5EMMA 1M1XB 1OBOA 2D1RA 2R6DA 3F2IA 3N3AC 2IV7A 4ZV4A 2DFPA 4EBBA 3ASYA 3JX9A 1KZ9A 5AVRA 5AUNB 5KI6A 4DABA 1IB6A 3QXGA 1M83A 5F3WB 2Q1TA 2A84A 3RJ9A 3T5CA 1W2HA 4M36A 3NNNA 4PG5A 3OM9A 5CEJA 2ZDHA 1LI5A 1R9GA 1R6BX 2JAHA 4IHQA 3KQLA 1J9ZA 4TWZA 4WEOA 1Z3CA 2HDNB 3OLVA 2WAYA 2D4AA 2E7ZA 5IPFA 1OCEA 1L4BA 1WVIA 1WDLA 2YN4A 1GT91 3PGLA 5T4BA 2Q9UA 3V00A 1P18A 2ZUCA 3FCOA 2WOJA 3A4IA 3MQFA 4Q9AA 1A9XA 1DPGA 2WJGA 3MWEB 2CJYA 2R0QC 2ZPTX 2WLTA 5KTOA 4J7CA 1Y5IA 4UM8B 3L1HA 1L8QA 2EL9A 2W0SA 1YB6A 3G6WA 4IH1A 5ABPA 1E2KA 2HXYA 3IIIA 3UHAA 3G8DA 3AF2A 1HZZA 3PC8A 2JZCA 4OH7A 3FSGD 4CTKA 5ADVA 4IZ6A 2NSYA 3B12A 4HLUC 2O8EB 1MUUA 5DGCA 4LYYA 5ADUS 2ZUTA 4JI4B 3T3PB 4G56A 3JASA 3NFRA 1U28C 4HG2A 4AJOA 1ZCBA 1AGYA 5BNTA 5I9NA 3LCVB 3G2MA 3HBLA 4BNTA 4P1ZA 3BQ9A 1NM5A 3RLFA 3GL9A 3UJAA 1THGA 3FMPB 3WKAA 2I91A 1CIJA 1HE1C 2CVHA 2FA9A 2O59A 4O2AA 3Q8WA 3SC6A 1SC3A 1UJNA 2WB4A 4LZNA 1BQ3A 4WK4B 5KX5B 1ZVKA 1ETHA 4XWYA 1E1YA 2R2AA 4RK0A 1NF9A 3SU8A 5A1JA 2DXIA 5CUQA 4PEVA 3ZDXB 3SHOA 1QSGA 1NXTA 1QNLA 3I45A 3AFGA 3RANA 4EVRA 4LJRA 1L4GA 1V11A 3L4BC 5FPPA 2XI4A 4LE0A 3WR5A 1OAOA 2FPMA 4B3MB 2B82A 3IUPA 5TB5A 2BEJA 3CO5A 3AVWA 3GFFA 1ZD5A 3KL2A 4DR6B 3RVNA 4TX1A 5F78A 3HB0A 5TGZA 3BHIA 1GKYA 3D3NA 4QHTA 4B4DA 1T1SA 1ZKMA 1ID1A 4E33A 1NFQA 1ACMA 5HP4A 1CYEA 1R0YA 4ZWNA 3PPXA 5LPNA 3HFJA 5L7WA 2CNDA 4PLFA 1Y5RA 1SXJC 1FTWA 1SC9A 5ALYA 3GGOA 3SEAA 3HWRA 5CA0F 3U0VA 4JDUA 4HN9A 3LCMA 1JHYA 2ZR7A 4ZQIA 5CB4F 4CMJA 2HO4A 4OQEA 1ZN2A 1FPMA 2O19A 4U3JB 2DU8A 4C6HA 5AKYA 1J8YF 3MERA 3A05A 4Q4AA 5SZKB 1AM4D 1X7GA 1C4XA 4TSFD 4LNAA 1N2JA 4DMFA 2Z09A 2V3VA 1IIBA 1R5NA 4YJGA 2CVPA 4TKLA 1UPXA 3U49A 5JNRA 3KSAC 1ECPA 1E2FA 1J49A 1SKBA 2Z56A 3CIOA 3SZUA 2ZQYA 1VHQA 2DKOA 2Q8QA 3IPLA 5FD8A 2W58A 2WYHA 4IMRA 1AQUA 1IHOA 1BCSB 1TVKA 4UFOA 3HDQA 3U4IA 3TEFA 4AJKA 3LC1O 4ZAXA 2XVXA 4YPOA 3MXOA 3OT4A 1P1FA 1P5FA 2OBYA 2OFPA 1NONA 1JKJA 3WMWA 4Z99A 1D6MA 4ZJYA 1HM5A 1RMTA 3JQ8A 2W2NA 2UVQA 4B6GA 2JGIA 3LJKA 5BVHA 1X13A 1DDGA 4W4TA 3OM0A 5HSGA 4JNKA 5CT8A 5IZCA 2DKFA 5I6DA 1TZCA 4NK5A 2FDRA 2Q1SA 4PBSA 1GAXA 3U31A 5TQ0A 1L5RA 2FMKA 4MJLA 3E22B 5C8YA 4MGKR 4OK3A 4BN0A 2AJTA 2VPQA 4DRXA 4C03A 1I3KA 4OQMA 3AF6A 2NP7A 4WKGA 3JU3A 4IZIA 5K6RA 5C1OA 4I1UA 5EMHA 1VYVA 4XUGB 1H2ZA 2NU8B 4QTXA 4HDOB 3ZIAD 5JYBA 3JWJA 1Y6FA 2GRJA 1Y4ZA 4OHFA 4BVJA 1Q11A 4HGRA 3UICA 1Y1KE 4C0WA 3VKGA 4RD1A 3OJWA 1KARA 2ZYIA 5KU1A 1DI0A 1NRWA 1ORRA 5DSXA 1PNQA 5F51A 1Y8QB 1U2DA 5B37A 1FSFA 1C1DA 1R4AA 4QQFA 5CAEB 2OXIA 4WH0A 2K4MA 3CF0A 4X8LA 1N2SA 5FLEX 4ER7A 4XUDA 3DULA 2GB4A 4YIKA 2FRXA 4YP5A 2CHEA 2AFVA 1W2WB 1Z4LA 3WMXA 3H1TA 2X22A 4M1OA 1P1RA 3PQ6A 5EG5A 3RSSA 3O21A 4C21A 4XJXA 5EQDA 1EEXB 2ZUEA 4TUYB 3TIGA 2Q3DA 2VHWA 3HFGA 4ZVLA 4EM6A 3O84A 2OC9A 3SQNA 3O94A 5DNEA 2B30A 4KO1S 4GDFA 2OO3A 4OPMA 1E3JA 4AJ2A 3OH8A 1MJFA 2GN9A 3V80A 4QVIA 3CNOA 1FFXA 1GUFA 3QTLA 2H16A 1HMPA 3CE6A 1JXAA 4KNVA 1Z2CA 1TECE 4J6EA 5D2CA 4Z0PA 5AW1A 1Q2XA 1XDBA 1YULA 4LF4B 2ZROA 1ZD8A 1JDNA 1M7GA 3TKAA 3EPRA 2X5OA 3W5AA 2R86A 4LXUA 1RFGE 3VAZA 3OG9A 4PZDA 1PU2A 3TBFA 1T9AA 3DBLA 2HNAA 3OEYA 2O2CA 3EPPA 3M0EA 4D3FA 1QRTA 2NU8A 4O2BA 1OWMA 4TSKA 1EH5A 1Z0AA 2YJTD 1Z26A 1CIVA 2JL1A 2IP4A 1A50B 1NVGA 2DC1A 4BX2A 1QGDA 2ZT5A 4OUKX 5AW0A 2ZU0C 4IOKA 1AGRA 4XGIA 4CIDA 4DRXB 5JTUA 1RTTA 5FLYA 1U7PA 1B6GA 3ETJA 5IUKC 3V4LA 3U3OA 1CFZA 4CPDA 4B7XA 2QUIA 2B4AA 2HY7A 3D6FA 5DRTA 4HMPA 1THTA 2I7TA 3BIOA 4KSYA 4Y2RA 3BH7A 3E3LA 5F1OA 1TA9A 3AJRA 4QXRA 4UZEA 4X1YB 5CTJA 4KOEC 3GXOA 3TTTA 2QYOA 3Q3VA 1DO2A 3A4YA 2MDTA 3QKSB 1K63A 3UG7A 4AZ0A 1A98A 1PNTA 4IDDA 4AZSA 3PKJA 5FTKA 2IEZA 2VPXA 3DQZA 1X9GA 5C7IO 5D86A 4CF4A 4CKEA 4QGFA 3U0BA 1EQAA 2FUNB 4GOKA 1BCSA 3IP9A 3BD6A 3ORRA 1I7PA 2RH8A 4K26A 4MUIA 4ZU1X 1NQXA 2G9VA 1HT2E 2C4TA 3AM4A 1YUBA 1CPYA 1RQGA 4TVKA 1ST2A 3D3KA 2B3DA 4UCWA 5DYGA 4ALLA 3U17A 1W5SA 2IVZA 4TROA 1AUOA 1F14A 5EP3A 4CT4B 1H4TA 5K0JA 2CUZA 1XMXA 1PO7A 1JEJA 3LL4A 1BMQA 4RFLA 2UYGA 1XWIA 3DKRA 3QEOA 3ABRB 2HOQA 3NTVA 4YGXB 5DHFA 3HCNA 2I99A 3PUJA 4MPDA 5TVGA 3ZQJA 2EHDA 2Z08A 4KU4A 4RCVA 4S1PA 3TRKA 1PJQA 1UQUA 3U48A 3EXFB 5CDTA 1D1QA 5CD1A 4JLAA 1QOZA 3CLTD 3GG2A 2V7EA 2QE7A 1HNXB 1FW8A 2IYAA 5A3SA 1A72A 1N1MA 3BQMB 4IQ0A 1N25A 4M9CA 2SKEA 3GMDA 3I61A 4MRNA 4UE3S 4EA7A 2RHTA 1HE2A 1I8TA 4JR0A 3ZIDA 4WCDA 5JXJA 3RYIB 4BNFA 1EVJA 1UT5A 2JJYA 1NE7A 4XGRA 3CURA 1NN5A 3MZ0A 5DP2A 2GBPA 4DDTA 5JQGB 2VRWA 1E58A 1LNQA 4FOLA 3TIIA 4D97A 1I2ZA 1EFHA 4H6XA 4BMVA 1E1RA 4ZI7F 2JCXA 4MYTA 4OO3A 3I9OA 1MVNA 1AN0A 3VR3A 2WT9A 3EHDA 4LGCA 5H3HA 4EG6A 3HE3A 3WP0A 2VSNA 2Z5LA 1E77A 3SBOA 3SJUA 1Q1QA 2YR0A 4H08A 4BCCA 1BE1A 4RLFA 3KJFA 5JROA 4CUJA 3PFHA 3C8MA 1VKHA 1PI3A 2XITA 2P9EA 2FP3A 3N76A 2VPPA 2WJJA 4OP3A 4UQOA 4EHAA 4EJSC 3L8HA 4ENSA 1GGKA 1K3FA 1EFPA 1LDBA 5AJXA 5LC1A 4YUXA 3DE3X 2IYUA 3O0DA 3WLMA 1JKMA 13PKA 3DTVD 1FW6A 2C29D 1K92A 4O3MA 5BWNA 2ZB7A 3OX3A 5HUHA 1NG9A 1BE8A 4BU0A 1EHIA 2C5HA 1TIBA 4XKJA 1VMEA 2NUAB 5L6MB 3FAZA 3OIWA 2GK3A 3ENWA 3Q3IA 4FVTA 4UOEA 4G85A 3QH4A 1U2RA 3UUFA 4F8EA 3CRZA 3P9PA 3JS5A 3GC6A 3HMKA 5AW6A 4PC1A 4A6PA 2OOKA 2KSQA 2O0MA 1BDIA 4TQAA 1R6DA 2R6CA 3FIJA 3SIPA 2ERXA 1TM3E 4GP6A 3GLFB 2YICA 3NHMA 1EG2A 2VTDA 4MQLA 1IAVA 3RG8A 5EIOA 4AF6A 2XQJA 1A69A 1UBOS 1IIRA 5TIIA 2WHQA 1VFNA 2RGWA 3AXTA 1QRSA 2ZREA 2UUPA 1L5GB 3V7WA 1B0UA 1D1SA 2QQGA 2ZUFA 1NN1A 2EYUA 3UEOA 4RA9A 1FZTA 1RP1A 1NJSA 2WIKA 2UZIR 2YQ5A 4NOKA 3VNBA 2AFHA 2QD1A 3A27A 5EIHA 4YUAA 2WJIA 3JQAA 1O6CA 3T0GA 5B1SA 1YU9A 5T3YA 1KA9H 3X1MA 2NU9A 1TUBA 3MT0A 4LHVA 4XJVA 4EB6B 4HYYA 1JP7A 1CE8A 3FF1A 2XHEA 1W581 1SCUB 2HUNA 2Q3EA 3HSSA 3KFXA 5G0SA 3HACA 3CFYA 4FHFA 1CZUA 1D6NA 3WY9A 5JNTA 3ZXUB 4BQPA 1UADA 1VRWA 3OE4A 2BFCA 1TZBA 1KQPA 1E2UA 4KE6A 5TEVA 4ASUA 5KMGA 5C8YF 2OE2A 3OQNA 2CFSA 3NWPA 5JSFA 4COOA 1ULTA 1H8EA 2R4TA 2VO1A 4PTLA 1QIGA 3LUJA 1JVBA 2EKZA 4LC0A 5EL0A 1E9FA 1TD9A 3OZWA 4ETIA 4F72A 5A5VA 3C98A 4DMRA 2ZYAA 3SGLA 1OAAA 2OO5A 3I2HA 1YUNA 1MAHA 1E9VA 1Y7LA 3GFOA 3FTEA 2WFMA 1PJ4A 2I4IA 3F8SA 3TLEA 2Q7OE 3THWA 1ISMA 4NYMR 3U3KA 3AI3A 1KPHA 3GUUA 1Z17A 4DWWA 4LHXA 5AI8A 5IVDA 1E9RA 1UFVA 1VMKA 3PNMA 4JYZA 4ND1A 3MVEA 4MR8A 3NP9A 1C0LA 2BHTA 2Q29A 1RKUA 4LOKA 5CLHA 3PNYA 1ZNXA 1HX7A 4FFLA 1Z0UA 1KC3A 3FYUC 3LZ6A 3P0RA 4RL4A 4TMTA 3VO8A 4BNWA 2X0FA 1L4EA 3W4KA 2FF7A 1R0WA 3JQAB 3TJMA 5J47A 3BRSA 2YNMA 5CXSA 3S2EA 3SQOA 4NSNA 1WY7A 4P3NA 1TQ2A 2JFVA 3T4UA 4CEJB 2EF0A 4IIJA 2Z9DA 1H1DA 1MC1A 2WKPA 3FCXA 4WZ6A 3L8GA 5BSHA 1L5WA 3LHSA 3OLZA 4Y0AA 1J24A 1EFKA 2B8TA 3AL2A 4LJ4A 4M76B 5E7JA 5KQRA 2P4EA 1QP8A 4QGSA 1R5OA 4MVXA 4RTQA 3P96A 5TNXA 3N8DA 2ZBPA 3WL5A 1JDUA 1H2EA 2WMNB 4B8WA 4BFWA 7GPBA 1YZHA 3ID6C 4N4AA 4YRJA 3KLPX 1W4AA 3HDTA 4FT2A 4Y2TA 2MMCA 4P34A 4KXQA 4IEFB 1DL5A 4BBPA 4GWKA 3R7WA 1R8YA 2QZJA 1Y9AA 2ZTVA 1K9VF 1AUXA 3PZBA 3HR7A 1Q3KA 1HEUA 1W0KA 3EXHA 3KSZO 4W9RA 4GPZA 5IAGA 1L7EA 2MSCB 3PXAA 2HXGA 3Q8XB 3AF4A 3IP1A 4L95C 1U31A 3OTWA 2OC4A 3L8CA 4POOA 1BYUA 4FCCA 4Q12A 3ZKWA 4LBWA 5BSTA 3ZGXA 4JQSA 2XA1A 3D9QX 2JK0A 4MLCA 2BFEA 4LI3X 3CVUA 5TQ2B 4Q0MA 2PZ8A 2XNKA 4CEHB 3PEUA 3LHKA 5E7QA 4OJKA 2XLBA 1QO7A 1YB4A 3WB1A 1PRYA 3M1IA 1HYEA 4RK1A 5J40A 1UFOA 1X8XA 2EP5A 5CX1B 2A30A 2XA9A 3GFRA 5FYQA 1O95D 3DAPA 1Z88A 1GD1O 5FI5A 4Z3DA 3VR2A 3ZHOA 3ER9A 1JNXX 1P81A 1TT5A 3OJLA 1MX3A 1P73A 3LKZA 5K3AA 1DC8A 4C7KA 5LZ2A 1I7NA 2DHEA 3C5CA 3OESA 4KBFA 4EO9A 4C9BA 1G5FA 1K0UA 2QM0A 2WFLA 4HLQB 2ZZKA 1KI7A 4IJUA 1JH9A 4HB2A 3IC5A 4BEBA 2BFNA 1ZRNA 2PZGA 2AH5A 1N3YA 4WNAB 2G80A 1TYBE 2QAJA 3GZTB 4N0PA 1MZPA 2IUTA 5AVSA 1P9LA 3GRCA 3ZCTA 4O4LB 4C6TB 2CJWB 3ZWWA 1QUFA 4AKSA 1WDWB 3TR5A 2NN3C 3KT6A 3P9SA 3RG2A 5K0BA 4LJKA 3ZGNA 2QP9X 4M0EA 4CLRA 1G0OA 2H59A 4LNUA 4QUEA 1UBRS 1UJ5A 2E2WA 3L01A 4F6LA 2LDXA 3ZWPA 4G24A 5DYNA 2Q3JA 2YJ4A 3EC7A 3R23A 1V7CA 5CB4B 4OQ4A 3VAAA 2N1BA 2WSSD 3BWEA 4JSYA 5DGHA 1WW3A 1NG1A 2FI1A 1E1QA 1CTQA 2VQFB 5FWXB 1YU6A 2EW8A 3OKFA 5CNMA 1L5LA 2RDMA 5JRJA 4KQMA 5KQSA 3C1AA 3E61A 2OM2A 2YQZA 1MVOA 2R8RA 4DNXA 1OX4A 3AHJA 4F5EA 3JZDA 2AG8A 2ZYSA 4E07A 2DBVO 3BXFA 4HD8A 3FSRA 4DM4A 1YBFA 2PD4A 5ARDA 2WDPA 2XUDA 5E3IA 3W6ZA 1UPBA 2HWKA 1SZDA 2P40A 4GLBA 1V9SA 2ANBA 5EKUA 4ARSA 2R1TA 3NONA 3EF1A 1K7SN 5K6TA 4HT3B 4KXWA 4ACBA 4M0DA 2AWOA 2RBEA 3M5DA 3TAXA 2VJOA 1H6DA 4CDNA 2V65A 1D03A 2GBIA 4RVDA 4I19A 1XDSA 4I6GA 1T4BA 3C8UA 4UEWA 5EJGA 4M9SA 5HDQA 1TCCA 3AY0A 1J2RA 1J5XA 2IZ1A 2NADA 3LC2O 4YAJA 4BVAA 3KZCA 1OC2A 3M6IA 2AHOA 3S2SA 3SF8B 1V1JA 4F84A 3FPSA 1P33A 3A9CA 4FKMA 4MR9A 4NOJA 5BQ3A 2ECOA 3QKWA 4PWYA 4JYAB 4KP7A 1KGSA 1L7BA 4EG7A 2M1ZA 3S29A 5H5JA 2WKWA 3CZRA 3W04A 4HZIA 2IQIA 3PUVA 5T7BA 1UFKA 3B3FA 1QO0A 1GA6A 4OBEA 1LSUA 2H6EA 3T4XA 2QL9A 4F4DA 5BN5A 1JG6A 3UOAB 2GJAA 3O9ZA 4R9UC 4E5MA 4P4GA 4Y3UA 2VWQA 3B89A 1ZUHA 3JQBA 2V59A 5TS3A 1CERA 1O6ZA 3C3WA 3RABA 3W7AA 3TR0A 4NCJA 1OLOA 4UPEA 3K0SA 4N3AA 3GEBA 1TQDA 4IEIA 1FS4A 3KP1A 1VKOA 4OSPA 1H22A 3I9V1 4HMQA 1QIHA 4LYEA 3ZV6A 1CFJA 1M54A 4ME6A 4KR0A 1FTNA 1GNPA 1P0FA 4OHVA 4Z0TA 4TWAA 2XGOA 3ROTA 2K87A 4G4SP 1E2HA 2OBNA 2H54A 3K09C 2DTDA 5L4SA 9LDBA 1R8JA 2HK9A 1TE2A 4KJXA 3Q7EA 3AM3A 4NZZA 3TNFA 5K8LA 4WZAA 2QI9C 4A26A 1AXRA 5IBQA 1TLTA 2Q62A 1ZO8A 4FFBB 1NZDA 1N7JA 5AJVB 3ZU6A 2ES4A 4LHYA 5KOYA 4QFCA 3TTSA 5DGDA 1YACA 2PX3A 4UEKA 2Y0EA 3RRBA 4PZEA 4D81A 4QVKA 2DKNA 1Q77A 4W9NC 2AN9A 3E15A 3EOAI 2E1RA 1L5YA 1RAAA 3ER6A 2F1IA 3HJNA 3FY4A 1WETA 2I8AA 1X0XA 4ZPXA 1DJPA 4FLFA 3BQNB 3RS8A 4ZT7A 4NS1A 5A02A 1O94D 1KWGA 4FSHA 4DN6A 5B58C 2GJKA 5IH7A 4OKNA 1IEQA 1XYVA 4DLKA 4CJXA 1T1RA 2QT9A 1NQTA 2AFIB 4BHTA 2WE8A 4TWRA 2CV0A 1LUAA 1QCZA 3X1YA 1BXZA 3L02A 2VAVA 4BWYA 2H08A 3KSRA 4BLQA 3AEXA 4Z9BA 4BVFA 4HMOA 4JHLA 3SR3A 5KX5A 5CM2Z 2IK8A 2QVXX 1XZBA 2OHXA 2QMYA 1DZ3A 3I05A 2PWYA 4TS3A 3ROEA 1L9XA 1U7DA 1U7UA 3LWZA 4GUDA 4P86A 1U2EA 5EE3A 3KE8A 3ED5A 4N5HX 3L6DA 4ARZB 5HKKA 3R24A 5KINB 5J4LA 1FNMA 3ADDA 4AFNA 3PA6A 5ALHA 4ERNA 5AQ1A 1ZMOA 1EVZA 1X1BA 2P2LA 1U3WA 4V0LA 4AMYA 4FKBA 2BONA 2O8EA 1PGOA 1HEYA 4D9CA 4HAOA 5B4VA 3KXDA 4K1XA 2V1UA 3F9RA 2PKXA 4JBNA 2ALJA 3CR8A 5DPMA 1LBQA 3LDGA 3RFXA 3G13A 3PF9A 1FRNA 1LK7A 1ONOA 3EZ6A 1C30A 1TMYA 1CY8A 4GF5A 1Q14A 2B34A 4QTTB 3DMFA 4NLLA 5JCJD 3EGVA 1ZH4A 3D7KA 4OMDA 1WHSB 1YD7A 3DOFA 3PX2A 3SLKA 4ZI3A 5CLFA 1FU7A 4AN1A 4PHHA 2C2ZA 2QP3A 4YXWA 2WNHA 3AOEC 4QE3A 1XX6A 5KQLA 2GPWA 2J67A 4MQMA 1DKNA 5ALFA 4BP9A 1QKKA 2ZWOA 3A6GA 2ZJYA 1U4NA 2P9QA 4QG7A 1D1PA 4RZHA 2H48A 4HI0E 4UUQA 4C0BA 4DR4B 4LQCA 1FXUA 2XNDD 1N34B 2RHRA 2ZRKA 4D6PA 5IDQA 3ZUGA 4WKPA 4I4TB 4B43A 3FCSB 1TVEA 4K8OA 5J5CA 3LUAA 2V6IA 3EVNA 3QEJA 4HRYA 2WAAA 1IJBA 2ZYVX 1CJTC 2OHHA 4RMJA 2C3MA 2HBRA 2MIIA 5ILOA 5E3JA 4LS3A 5AI9A 2B4KA 3PFFA 3TL2A 2XRFA 1WJGA 3FMIA 4FLEA 3IEXA 4R2LA 1MKYA 3VOTA 2I7XA 2P9BA 4B84A 4EF5A 5MGNA 3N07A 2R4QA 3LKVA 3P9XA 1MVLA 1FP1D 1GY8A 5EMNA 3R09A 1QC5A 3LGSA 4FD2A 4J2OA 3ZBUA 4HGOA 1KVQA 3I5AA 1KK2A 5JNSA 1RYNA 3UCFA 2X5NA 3I8SA 4YRPA 1J0EA 4LXHA 4PLYA 1GNLA 3EK2A 3LW7A 2A9FA 3ELUA 3RREA 3MS2A 1RBMA 3U7HB 4MUKA 4DFDA 1SEVA 4LJAA 5B7QA 3QELB 1ND6A 2APJA 4CMBA 3IUMA 3IQWA 1K27A 1B4DA 4KZKA 3MWEA 4CLDA 1RRPA 1UMBA 2WJAA 4CFSA 1P7ZA 3RK1A 1PV2A 3MGCA 1L5OA 1Y1LA 3QJGA 4IVNA 4Q9IA 3EC1A 5T6MA 4BJ6A 2QSJA 4KUEA 4HDCA 4QYSA 2R7NA 2Y93A 4TL6A 2O05A 1B26A 5IK2A 1DOAA 4LXIA 5JSUA 3PCTA 2ZI5A 3S2GA 1J0DA 1JKFA 3AWIA 4NI5A 4FDMA 4YJ3B 5EJAA 5B7NA 3ZD7A 4R40A 1JQ5A 1TF7A 3DW1X 4LAFA 3VYTB 4B48A 4C87A 1Z4PX 4OHCA 2C04A 5EA2A 4EA9A 1W5EA 4I4IA 4OX9B 5LM3A 5C0OE 3T7DA 7AT1A 1FC0A 5HNKA 1S9DA 1C3JA 1KJNA 2H2WA 4ER0A 1CD5A 3CN9A 1OZ0A 1YQDA 3M5WA 5BW8A 1QAMA 4I9UA 4NENB 2J5QA 4R8SA 1OIWA 4KPYA 3M1LA 1U2QA 3G1UA 4H7IA 3ZWKA 4X61A 3RRJA 3U7IA 1GGNA 2BFBA 1FX0A 2JGRA 2VJMB 2XGSA 5HF6A 4FYMA 3KHUA 2GCOB 3COZA 3VKWA 3VH3A 3VH1A 1PSZA 2A3NA 2RAUA 4R8VA 4UNIA 5C4GB 4EYEA 4PZ0A 1F2TB 1DVRA 4JYCA 4AKHA 2TYSB 1A5SB 3PCRB 3S1LA 1O8CA 5LKRA 1XPRA 2D5LA 4H7JA 3Q0TA 5JATA 5JXHA 4CMKA 1TU3A 1YL6A 1FIUA 4UREA 3LCUA 1L5SA 4XTRA 1OXBB 3R9KA 1EDZA 2QAGC 2XNJA 4NMMA 3JW8A 3P7MA 4PXYA 5JVDB 1YA4A 1YJ5A 3OZDA 4GOXA 1FQOA 3HCDA 2J5RA 4KIGA 4LZLA 3DMRA 1L5HA 4EP1A 2A33A 2IU6A 4QXMA 4MI6A 1CZOA 8ABPA 2X8LA 5H02A 4E21A 1XF9A 3HCOA 2O20A 2CBZA 4L5JA 2ODTX 4BGDA 1EDDA 3NRJA 4AZ3A 3UV7A 3T12A 4H3KB 3QLJA 1NF2A 5DNVA 3ZE9A 3T9DA 1AG9A 4TKZA 4RPCA 1N0IA 4RF5A 4B3RB 4BL5A 3LWDA 2Z6AA 5I9LA 2GVDC 4OB6A 1C9KA 3KZ1E 1BYIA 3F5FA 3UHFA 4GGMX 6PFKA 2CL7X 3KQUA 3DHNA 4YIHA 5M34A 2FFJA 3DZGA 1M8PA 3FKSD 3L0DA 2RH4A 4JB0A 4R7ZA 1XMQB 2PXXA 2NUBA 3Q9UA 2YZ2A 4JIGA 1Z68A 1TJ5A 2NVOA 2AOUA 1Y5LA 3A3NA 5KPJA 4HP8A 2QRMA 4MDYA 5B6JA 3QEMA 1OAOC 3C6KA 3DOUA 3NGXA 3T5DA 1U2ZA 2P0EA 1YRYE 2BI8A 4QYXA 3U7EB 1L3CA 2BVNA 4RJIA 1U0HC 2IOHA 3VO9A 2UZ1A 2LGJA 2ZAGA 3QKIA 3SFTA 3TMKA 1I32A 2H29A 5KOHA 2FQ1A 3HL4A 3C41J 4JMPA 1AOXA 2R85A 2CSXA 5BPFA 3RVOA 4PFJA 5FUQA 1L7VC 2ZWPA 1KE1A 1ZK1A 4YDQA 5JV5A 1EK5A 5IJAA 4MVYA 4ZC1A 1X14A 4MV1A 4CG2A 4QAJA 5B2ZA 1I24A 1SXJA 2D5BA 2XMDA 1R0BA 3HJRA 5C1BA 1VLJA 5DK6A 1NF8A 2KBFA 2HIAA 4J9VA 5HHTA 1V47A 4GT1A 4IIJB 1SVSA 3P8ZA 4FK8A 4DBLE 2A59A 5EIBD 1C8VB 3GHHA 2B1JA 2HW8A 3X0DA 5LOVA 4JLOA 4J6FA 2IEGA 3HVKA 4E51A 4RE5A 5CX1A 1RRCA 5JQWA 1DX6A 1WE2A 2Q6IA 3PCXA 4HVTA 3M4NA 4MI9A 3QW2A 4UVDA 2E3JA 3EQZA 3K32A 4DQKA 1VOTA 2QR3A 1IFXA 4B2YA 1UINA 3F49S 2BKXA 2PKEA 3KK0A 2SICE 5PNTA 3VU0A 4BO6A 5AVQA 1JQLB 1KAMA 2Z5GA 1FA9A 4H3VA 2PLNA 4N8SA 4FGUA 1JKXA 2J3LA 4MW4A 3K70D 3OLYA 3GW8A 3PXDA 1G1AA 3X44A 3GJ4A 2VAWA 4G37A 3P9RA 1YE3A 1SIWA 2JCSA 2C42A 1RYZA 4PLHA 3KHSA 4BB6A 2VTBA 4M88A 5JR3A 1UUFA 3GMTA 2OQRA 4U7FA 1MJ5A 3GV0A 1XEAA 2BV3A 4C4RA 2Y92A 2EBHX 4RXUA 1D8AA 3S28A 2ET6A 1NI3A 1L5VA 2FZCA 2ZT6A 4INAA 4L4ZA 4AO6A 5CNJA 5KMGB 3FBGA 5TXGA 1A2KC 1YQEA 3OQIA 2YN0A 1B1AA 5EERA 3FSGA 3U7JA 2E49A 4KQ2A 2R1VB 3KQTA 4JJFA 4KR2A 4OHPA 1RYEA 3W3AD 3AYZB 3CNEA 5BUSA 4ZYTA 3R7NA 3OQPA 1VJ1A 1FVXA 4D82A 5F2OA 4O2LA 2JA1A 3JV7A 1RZRA 4TYQA 2QTZA 3W77A 3CS3A 3ELDA 4Y67A 5EZQA 1UWCA 2MMGA 1VI6A 4M8SA 2VP6A 3L0CA 1IU9A 4M0MA 1QU2A 2BM8A 2V6BA 1ZMXA 3Q5EA 4EABA 3VJRA 2NGRA 4CV0A 1Q1BA 4WGGA 1TNDA 4YRZA 5J2UF 5FQOA 2X0DA 1YCGA 2Q5IA 4IDAA 2IX3A 3WKDA 2O8FA 1YJAA 5A7FA 5FFMA 3PHLA 4YRCA 4MEBA 2ASVA 4N8EA 3W6OA 3WNVA 4LVCA 3DWFA 1GR1A 2JARA 3G0DA 4R8MA 1FUEA 3EC2A 4J7UA 4OXYA 3QBEA 2X5KO 4EA6A 2D2VA 4TRJA 4O5OA 4C7OA 2OL4A 2C7BA 3PC7A 1SB9A 4LV6A 4HDQB 5AK4A 3BMQB 4MCHA 4MW1A 4RZIA 1M0TA 1RKBA 4KXLA 4NABA 4F3CA 3G2OA 3EXHC 3KG2A 3QUAA 1UJCA 4TLAA 5H81A 1DCTA 1WCIA 4HQLA 1R6VA 1F6WA 2VHYA 3WGMA 5A4AA 5A71A 1RPAA 2NUTA 4U0JA 1BN7A 4OH1A 5JLJA 2CHFA 2ZYDA 3DDOA 1CUBA 5JZOA 1D5CA 3FTCA 1K97A 1AKNA 4PHTA 4BJ1A 3IVMA 3DKIA 4GR5A 1SVKA 1V5GA 3UJ8A 1IWPB 1EP9A 1UOQA 4WXHA 2QRVB 4XFJA 1J5PA 2VJQA 3KUXA 2X0IA 1RE0A 2V74B 2I1LA 4ILEA 2HRCA 3HM9A 3WDKA 4IKOA 1YL5A 2NZVG 5L3QB 3ZE2B 2F3PA 1SH7A 5HFNA 2BDTA 2QG9A 3FYDA 3HQ4O 1BHSA 1KORA 2VYFA 3WYBA 1Q7TA 1U7HA 1J0CA 3LD9A 1RI1A 2B69A 2VNKA 3KAQA 2KB0A 5BWOA 2BCGY 4Q48A 5B55A 2H4YA 4LZPA 4RETA 3AVQA 1O96A 1R37A 2PYDA 4XGKA 1R0LA 4IFTA 4BRZA 3ETCA 4NULA 5MFZA 2FUKA 3OZUA 2AFIE 2UYQA 3QPBA 1C50A 1VE5A 3ZC3A 2TSYB 4L22A 1GGMA 5IXSA 2ZE6A 1NJ6A 4ZU3A 2PMKA 3F1LA 4HB0A 2VJAA 1H1TA 4LF7B 2H8KA 1S2NA 2MINB 4HJXA 5JAOA 3FFBA 1T5TA 4ZZIA 1S01A 4BB5A 1G8GA 2OVBA 2NU6B 4BNNA 3B3AA 3CSSA 4N6OA 1ZVQA 5G0VA 5BSVA 1AY0A 3IT3A 3VOBA 4B46A 1P31A 3LY8A 4BVGA 2OFFA 2AXEA 1DSSG 4QGAA 4HQOA 5AHOA 4EJ2A 1S4MA 1TUIA 3U80A 5LBUA 3HNRA 4FNOA 2NUTB 4P3KA 3RQIA 1HE3A 1X1RA 3TN7A 3UJ3X 2XB6A 2PFGA 1LQUA 3N0RA 3AVXA 1Y1PA 5C52B 1P6XA 1Y5NA 1W0JA 2ZJ5A 3B8HA 1QVRA 3MFQA 4FZRA 1SVNA 2LWIA 4TTIA 4JV5B 1SVMA 3LUPA 3CT4A 1YZFA 3CH6A 4MNTA 4Y0NA 1E3LA 4L51A 4EQ6A 2O5VA 2I6UA 3A04A 1PFUA 3H3FA 4HQFA 2CHUA 3GPCA 1JU9A 3VKHA 4O4IF 3DM9B 1T8WA 4X0EA 1JLLB 4DIEA 3S68A 1HTTA 1MLDA 1A8PA 1JAZA 4UM7A 1VB3A 2BGJA 1KOGA 1R4MB 1N2BA 2LDBA 4MQFB 5LYYA 4CQJA 5FWYA 2FJUA 1W5AA 3FRIA 4Z86A 1OBVA 4MGEA 3R77A 1U0FA 4FZ5A 5CK4A 2Q0HA 1SZCA 4LDJA 1NFRA 2ZUBA 3G0HA 2NV2B 5I45A 2R60A 1E0JA 2OSVA 3AB3A 2J32A 3P32A 5CHYA 2R6GA 3L06A 1D2MA 4GRIA 4BFCA 4J49A 1A7KA 3E23A 1M1NA 2HADA 3B9BA 1JHOA 2GK6A 2QNIA 1XZPA 2WD9A 1KY2A 5KWSA 1ZK2A 2HK6A 2JCBA 2DPLA 3G59A 2NVWA 5A06A 3RUDA 3MGGA 1MV5A 4HAVA 2RKOA 4I3FA 3EMKA 1L1QA 2JLVA 3D4NA 1NKTA 4OJTA 2GAAA 1GTG1 1VL0A 3I4LA 4QPNA 3UMCA 3ANLA 5C1IA 1TM2A 2PJZA 2ZRNA 1BRTA 2ZW9A 3EBOA 2QXYA 3M5CA 1JBKA 3N6XA 4MJ3A 4B17A 3DD1A 6ABPA 2PVPA 1ISPA 4RTOA 2JFPA 4G5GA 3EVCA 4G36A 3E03A 1DKRA 2IZOA 1QQ5A 4HAUA 3VHXB 5SY9A 2SKCA 4RDXA 5DHAA 4L2IA 4W8OA 4A0FA 1MJGM 3DYVA 9GPBA 1U1DA 3PUIA 5CW1A 4F4HA 2BZGA 4HH1A 4B83A 1C41A 2WI8A 2XQKA 1C14A 3QVVA 3RUEA 4PLCA 2GS9A 1M3SA 1E2MA 4FYVA 4MICA 5B4TA 1VSTA 2WFZA 4K9NA 3TLMA 1Z6QA 5B1IA 1QCCA 2G5GX 1EDBA 2G88A 3UUGA 1Y8QA 2QTWB 4F4FA 4J8PA 1N2CB 2JHPA 1ADGA 1G9XA 3OZFA 3ZWBA 1A9SA 4GP7A 3A14A 1JMKC 1C9NA 3U26A 3L0ZA 4KLCA 1KR5A 4ZVUA 1G5PA 2BMVA 2P27A 3PQ8A 4GKJB 1FFDA 3L6CA 2BEUA 1JG7A 1SMKA 3CLTC