1W0CA

Inhibition of leishmania major pteridine reductase (ptr1) by 2,4,6-triaminoquinazoline; structure of the nadp ternary complex.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
283
structure length
276
Chain Sequence
VPVALVTGAAKRLGRSIAEGLHAEGYAVCLHYHRSAAEANALSATLNARRPNSAITVQADLSNVATAPVSGADGSAPVTLFTRCAELVAACYTHWGRCDVLVNNASSFYPTPLLRNDVGDREAMETATADLFGSNAIAPYFLIKAFAHRVAGTPAKHRGTNYSIINMVDAMTNQPLLGYTIYTMAKGALEGLTRSAALELAPLQIRVNGVGPGLSVLVDDMPPAVWEGHRSKVPLYQRDSSAAEVSDVVIFLCSSKAKYITGTCVKVDGGYSLTRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of Leishmania Major Pteridine Reductase by 2,4,6-Triaminoquinazoline: Structure of the Nadph Ternary Complex
pubmed doi rcsb
source organism Leishmania major
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE
total genus 98
structure length 276
sequence length 283
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2004-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1w0cA00
1NWCA 4J1TA 2IYOA 3RC1A 2QZZA 5DP2A 3PP8A 4F6CA 3PIIA 4MVJM 4CLHA 5G0WA 3ROPA 4YBZA 3R3SA 4TVBA 1Q0QA 3K8ZA 3PHJA 3RWBA 2WDZA 1A4UA 4YJGA 4BNTA 3JQBC 4G81A 4MVJG 2P5UA 2QRLA 1EK6A 2V7PA 5CEEA 3FNGA 4BKUA 3STHA 1ISGA 1R15A 3WG9A 3NYWA 4XKJA 4M54A 2IRWA 4FFPA 4WK6A 4BQPA 2DVMA 1ML3A 1LDEA 1DRWA 1HDYA 3FWNA 1DC5A 4RL6A 3GVPA 4IZHA 1U1IA 1HKUA 5IZCC 1IZ0A 2O48X 4LK3A 4U6QA 1PR3A 4BO7A 3GZ4A 3DHNA 1PZEA 1TI7A 2IE0A 4DREA 1PGOA 5CDSA 2PTGA 3NT5A 2O3SA 4NBVA 5IDXA 2UV8A 1PS9A 3DBHA 5DOZA 4YDRA 3KZVA 1DRUA 4L75A 3VVCA 4BNUA 2WSBA 2HMSA 3L6EA 4WLVA 4R69A 2Q2QA 1DEHA 1W4ZA 5C37A 3VH3A 4BMVA 2Q1WA 3NDRA 4JQCA 2JD2A 3VTFA 2GR9A 1J6UA 2VZ0A 1HXHA 3SLKA 3N58A 3AM3A 3F4BA 2XXJA 4XR9A 4ZA2A 4EYEA 5JCJD 1Z82A 2X5OA 2CFCA 4HX5A 5BNFA 4BNMA 5DBFA 3Q11A 4PVDA 3L6OO 3PVZA 4TROA 3PGJA 3FHLA 2BFAA 3ZNPA 4MP3A 3WYCA 1O0SA 4BNXA 4WEOA 4CV2A 3RUFA 3OEWA 1CJCA 5KJ1A 3GUCA 4A7PA 1ZMOA 2GGSA 4FN4A 3S2IA 1D4FA 4R1UA 5JCJA 3RBZA 1N5DA 3M6IA 1BG6A 4L8VA 3CTMA 3UCFA 5DZSA 3D5QA 4QEDA 1DDOA 4A73A 3NJ4A 4XX0A 2XAAA 1G6KA 1YGYA 3BMQA 3DZGA 1DHTA 2DFDA 4WLUA 5HA5A 4BO1A 3ZWMA 4XCVA 2C54A 3ZV6A 2CUKA 4FC7A 4GI2A 4DQVA 5KKCA 1K6IA 3AY3A 4IY1A 1C0KA 1CF2O 2WYVA 1HDXA 2ZATA 3GY0A 3WJAA 1Q0LA 3UF0A 3LT0A 4PG7A 4I8XA 1RJWA 1IOLA 1E5LA 2C2YA 2ZYAA 4Y6RA 4XB2A 5C7IO 5EMHA 4NH4A 3U09A 2IZ0A 5CG2A 5BNTA 4J4TA 1FJHA 1N9GA 3DBVO 3AUSA 2IODA 3TRIA 3NEPX 5FEUA 2I67A 5BSHA 5KJ6A 1GQYA 4PGFA 5U4QA 3C7CB 3I9KA 4IMPA 1L1FA 3WWZA 5JE8A 3AK4A 4CLDA 5BSEA 3PTZA 1UAGA 3EGOA 1S6YA 4XQCA 1RPNA 3QE3A 4PG4A 1U2DA 2I3AA 2PKRA 4YRDA 1NXQA 3D4OA 4M87A 2C82A 4DUPA 3FSRA 2X4GA 4N18A 4ALIA 3FPLA 5CDGA 5I7FA 1P1JA 3DTYA 4YA6A 1QR6A 1HZJA 3G1TA 5JDCA 3ZWAA 1NVMB 3TJRA 1NPYA 3HWRA 2PNFA 1G1AA 3HHPA 4KWIA 1EVYA 4E2WA 5A4DA 4RO0A 2RIRA 3PQDA 4LW8A 1U4SA 2NLOA 4KOAA 4J9VA 4XIYA 2WTBA 1WMBA 2WD7A 2JCVA 3HUDA 4NPCA 1ZK1A 4URFA 5L9AA 3GRPA 3FR7A 2V6BA 1HSZA 1ZSNA 1IHXA 1LC3A 3F1KA 4R3NA 1U4OA 5KWEA 1KVRA 3PFFA 3WTCA 5IDWA 3JQFC 1HDRA 1KC1A 3FI9A 3I9LA 4L4XA 5FFFA 4ZRMA 5F3RA 2NU8A 4GSLA 1HDGO 1X7GA 2C7GA 3ENKA 5GY7A 1BXZA 1GU7A 4K9DA 2ZTVA 1YL7A 1XCBA 3ZNOA 2FRDA 4JP2A 1TVEA 1PWZA 4R9SA 5A03A 1BW9A 4CMGA 1N7HA 3K73O 3EVNA 3G0OA 4YAJA 2O3TA 3RIHA 4RLHA 1DLJA 3BMOB 3ZWXA 3OICA 1KVTA 4J7CA 2NQTA 1NHWA 3NDJA 1PZGA 4WGGA 1F17A 1WNTA 1I3MA 1TT7A 2C5EA 4I08A 4C7JA 4CPDA 1P33A 1U3VA 4BO0A 4D3SA 4R41A 2AHRA 3WGIA 5TLSA 1YOVB 1YS4A 3JD3A 2Y1EA 4RF5A 4W82A 2BFMA 3AY6A 3DZJA 1PX0A 4PN3A 4P4LA 2EEZA 4PCVA 4S1VA 2H6EA 2NU7A 4EI2A 4WPGA 5T67A 5B37A 4D0RA 1SPXA 3WTBA 4B79A 4BL5A 5I9LA 1Q7GA 1V3UA 2BFPA 3UFXA 3DZBA 2YZ7A 2HCTA 2Y1GA 3LK7A 4E5NA 2OGUA 4ZQGA 1DFGA 2PV7A 1WWKA 2X5KO 4RV9A 5A9SA 3QLJA 4FSHA 1JVSA 2QG4A 4W4TA 2OOSA 3GPIA 1FXSA 3BTSA 3WR5A 4BMSA 4FCCA 4RORA 4U7WA 2EG9A 3VPGA 4KWHA 1QLJA 4N7RA 4XJTA 1ONOA 3R3JA 5JAZA 2V6GA 3L9WA 3GDFA 3A9WA 4XYMA 3NTOA 2Y0DA 3DB2A 1H0KA 2VHWA 2B5WA 5KCZA 3JD1A 4ND2A 1RYDA 2ET6A 4ZQHA 1MFZA 2ZK7A 2EKLA 1ZEJA 1Z75A 1KETA 3JQDA 2J3HA 3OF2A 1B0AA 4G5HA 5JY1A 3K30A 3DZFA 3L77A 3FF4A 3B1FA 4OQZA 4QT0A 4LMPA 5LC1A 3JQAA 5CEJA 3MJ4A 3DO5A 1LLCA 4H16A 1DPGA 1RM4A 4J3FA 4YQZA 1P3DA 1A5ZA 4PG8A 2Y93A 1A4IA 2X86A 2GPTA 4QTZA 1X7HA 4HY3A 4KQWA 4ZU3A 4FFMA 1LLQA 5KVVA 4HWKA 3MWDB 4RVUA 4NK5A 4KQXA 4Z0PA 2Q1UA 3ZN2A 1DIBA 1O8CA 4AJ4A 4Z6KA 4UVEA 4UVDA 4FB5A 1IPFA 4J90A 3GHYA 4WE3A 3I3OA 3KHUA 1SOVA 1YH3A 4OXYA 2RHRA 1Y81A 2EF1A 3OIDA 1HDOA 2OL4A 2C0CA 2YV2A 1QSGA 2EKQA 3ETEA 3WXBA 3WBFA 1HWYA 3QV1A 1I32A 3GHHA 4MOWA 3MJSA 3K96A 4K26A 1CQIA 4E5PA 2DM6A 4WEQA 4WJZA 4R5HA 1XLTA 3VZPA 1NX6A 3F46A 1PL7A 1BRMA 3LVFO 3O8QA 4JBGA 3AY7A 3WX0A 1PSDA 4HNGA 4YT4A 4MVJD 4BUCA 4B3HA 5T64A 3VH2A 4CV1A 3JQ8A 1EZ4A 3LC2O 3CUKA 1UP7A 3DXFA 1W73A 2C7VA 5JO9A 2EP7A 3EZLA 1CEQA 5AXCA 4OXNA 3WFIA 2BFOA 3R1IA 4RPGA 2Q1TA 4R4JA 3W8FA 2VNSA 2HJSA 2VTEA 4K1LA 4KDEA 4K28A 1I30A 5L45A 2R6JA 1Y8QB 1LBEA 4N54A 1TLTA 4CODB 4MVJA 4TQGA 1E7RA 4X54A 2DUWA 4GVLA 1B26A 1H6AA 4DL9A 1C0LA 5KJCA 3MJTA 1GPDG 4D46A 3PK0A 1AGNA 4LCJA 3TWOA 1E7YA 4ROSA 2YY7A 4EITA 1XSEA 4D45A 2J5KA 3E8XA 3GA0A 1GY8A 5DP1A 3F6YA 1V9LA 4KMSA 5F1PA 4NI5A 5TIIA 4WNCA 1HE5A 3AU8A 3ZU4A 2D5CA 1LRKA 2AA3A 1XWFA 1PJ4A 3DONA 4QXMA 4IDGA 1AN9A 4I9HA 2DTXA 2BI7A 2PLAA 4ALMA 1K5HA 4CQLB 3I4CA 1C3VA 1PWXA 3KYCA 4BO6A 4BV8A 3TZCA 1NQ5A 4DPMA 1E7QA 3C1TA 1IY8A 3TZHA 2GLXA 1DFHA 1EDOA 1XEAA 3EK2A 3PWKA 1Q1NA 1PU2A 2FY8A 2P4QA 3DBHB 4KTVE 2YDYA 4B7XA 3BIOA 2VTDA 1YDEA 3I6QA 4HV4A 4YYZA 1TA4A 2PA3A 1BXGA 2X5JO 3QVXA 4XGKA 2GD1O 4B3JA 3WLFA 4HP8A 4OSOA 3H4VA 3GEMA 2AXQA 3LLVA 4BQRA 1B2LA 3QWIA 4XYGA 4OKNA 4E31A 2BHLA 2HMTA 3MJEA 4AJOA 4BB5A 4YRBA 1NQAO 1DAPA 3SJ7A 2CDBA 1QV6A 3U3XA 3HDJA 1I3LA 3KO8A 5B4VA 2OXIA 1A27A 1X0XA 3CSDA 1GEGA 1PGJA 3QP9A 1U3WA 1C0IA 3ONDA 2HO5A 2WEKA 2GDZA 4BGEA 4CQMD 2HK8A 1PIWA 2B4TO 4FS3A 5DF1A 3GPDG 1YQXA 3WQSB 2W90A 3JQCA 1F8FA 4AJNA 1TEHA 2HDHA 1A7KA 3L6DA 3NT2A 1QYWA 4Z0HO 3RKUA 1LLUA 4JJGA 1GYQA 1VPDA 4J91A 4ZQFA 3QVSA 1Q7BA 3JYPA 3W1VA 1NAHA 1B7GO 1YBVA 1YBMA 3AFMA 5DULA 1LLDA 5A1TA 2Y66A 1DIRA 5GMOA 4CMEC 1GUZA 1EUZA 3ROQA 1KVSA 1LJ8A 4AJPA 3IMFA 3V2GA 1G0NA 1A71A 1NTOA 3AOEA 4YVFA 1BMDA 3HZZA 1N9GB 4UAGA 2E48A 1I24A 4OAQA 2C59A 1E3WA 4BNGA 3H6KA 3HFGA 2VOJA 4QX6A 4FR5A 5TQVA 3TSCA 4DRYA 5FYDA 3QJ5A 2I3GA 1EUDA 1WAMA 4NBWA 4R16A 2POQX 4J4BA 4LN1A 1LRLA 4GLLA 3JYOA 3ZW9A 4BIIA 4W6ZA 4LRSB 1GFSA 2W2KA 4UVHA 2FWMX 4PZCA 4BV9A 5I8WA 4K6FA 5CDTA 7MDHA 2GSDA 3BMNB 3IUSA 2VUTA 2DPHA 1UDAA 2O3RA 1OFGA 1AXEA 4K6CA 1PS0A 1YRLA 2YQ4A 4R1SA 4MDHA 2PY6A 1ISFA 3EY4A 1VC2A 1V6AA 3WWYA 3IP1A 3A4VA 3ST7A 2IXBA 4DBZA 3DZIA 2DU8A 4CM4A 2RH8A 1P74A 4J1QA 2WD7B 4KUGA 1ZSVA 5EINA 4Q39A 4XYLA 1ZH8A 1HYHA 4W99A 3X2EA 1UZNA 4YJDA 5BNIA 3B20A 3GUYA 5HTOA 3GDGA 1R37A 1VJ1A 2BGLA 1P1KA 3S2FA 3NGXA 5L95A 2ZCVA 1D1SA 1UUFA 3L4BC 3I9NA 4DWVA 4ZQBA 5K6AC 2PWZA 3GEDA 1MB4A 3BXXA 5G4KA 4JGBA 4CLXA 1Y9AA 5I9MA 4JNKA 1I33A 5LCXA 4BNHA 3ZZNA 4IIVA 5I7EA 1MV8A 1M67A 3DFUA 3PFWO 1BW9B 5TT1A 3RASA 3OQBA 2JFHA 1YB1A 2NVUA 4FOOA 4DC0A 4EJ6A 2QRJA 3GEGA 4J16A 4BNYA 4GBJA 1T2DA 4NFSA 2AW5A 4E2YA 3BTUA 4IJKA 4R68A 2BI8A 3GMDA 2PGDA 1ONPA 5C5IA 4RPHA 5F5LA 3M1AA 3AUTA 2VNAA 2O2SA 1NR7A 3QWBA 4CMEA 1L7DA 3ZWVA 4A2CA 3TN7A 4RPKA 3WICA 2R00C 4BMNA 4GLOA 1F0YA 1U5AA 3D64A 5JAMA 3DBLB 1MGOA 1NNUA 1DIGA 3AUAA 2AQ8A 1NASA 5JSFA 4QO8A 1SEPA 5F21A 2JHGA 2Y0EA 3LC1O 3MWEB 4NBRA 4IDEA 2QYSA 4NHEA 4NU6A 1XDWA 1YB4A 4GWKA 1KEUA 1KS9A 1XKQA 2WJPA 4E32A 5A05A 4R1NA 1P45A 5CHEA 4NBTA 3SBOA 1ISMA 2BF7A 1XA0A 4LVUA 3QWHA 2P91A 3FBGA 2D0IA 4IDFA 4CR7A 3ABIA 4QQRA 4RQTA 4DIFA 4Z0TA 3JQ7B 2HJRA 3PEFA 4RJTA 3QVOA 1EVZA 3ORFA 4DBVO 3INTA 2EERA 5JXWA 1VSVA 3E48A 3FR8A 3ZV4A 5BR7A 2Z95A 4HFRA 1SCUA 4PLVA 1E7WA 5L7TA 2YFHA 4Z9FA 3P2YA 4MVJE 4E21A 3U5TA 4EJ0A 4RCVA 2H1SA 1ZFNA 3WQRA 4GPD1 4ID9A 4OXKA 3EYWA 3GN1A 4MVJH 1MFPA 4C7KA 1JKIA 5IZCA 3NT4A 1PEDA 1QYDA 2X8LA 2DLDA 2G82A 1TXGA 3VH4A 1MG0A 2B4QA 1I01A 4PZDA 3BMQB 1LNQA 2V6FA 1U3TA 2Y1CA 3BHIA 3K92A 1JLLA 4NZ9A 3JQAB 1JWAB 3KYBA 4CLRA 3DQPA 3KSZO 1SBYA 4YEDA 2YHIB 4BKPA 4OSPA 2Q45A 4QO7A 1D7OA 4E2ZA 3WIDA 1UXGA 2DKNA 2E49A 2E37A 4PVCA 3I1JA 1IL0A 1W8DA 1PQPA 2PKQP 1JWBB 3H9UA 4FBGA 2ZYGA 1WDLA 1YWGO 3I9JA 1CIVA 2BRUA 1WZIA 1E7MA 2NV6A 4FQ8A 4Y67A 3DWFA 2J5QA 1KVUA 2PK3A 5L4LA 3E6AA 8ADHA 1DIAA 3O8QB 9LDBA 4GGPA 4ALNA 3A1NA 3LSYA 4JK3A 5A3JA 1NBOA 3GR6A 5F1KA 5A5EA 5ICMA 3JQ8B 4D79A 1OMOA 1Q0HA 2RH4A 2PKQO 1LDMA 5DNAA 3SEFA 2B83A 3E82A 4BNKA 5B1YA 1ZJZA 1TB4A 2R00A 1XYGA 3HDQA 3ITKA 3IKTA 3B1JA 4MIYA 3GH3A 4WASA 5L40A 3RCBA 2Q3EA 1A7AA 4BNVA 2JFFA 2Y0CA 3NDIA 2DC1A 2NM0A 1HLPA 4XEHA 1GUYA 4E13A 3E03A 2LDBA 1M76A 3NTRA 1IZ9A 1Y9EA 2QX7A 3ZW8A 4QSMA 4RVFA 1HYGA 4Q3EA 4CM1A 3ZU5A 4H15A 1GQ2A 1D3AA 2ZB7A 1Y6JA 3WMXA 2G0TA 5IXYA 1KEVA 2HUNA 3LDHA 1DIHA 3MEQA 3AM4A 3WLEA 2EGHA 4W9NC 3WMWA 2UUPA 1WW8A 1PGNA 1KOLA 1DBVO 2X1HA 4OL9A 5GZ6A 3ZU2A 2V65A 4W7HA 3W6ZA 2FSVA 4R3WA 4CQLA 1UXHA 3H9JA 1Y1PA 4Q3DA 4IM7A 4BHTA 2ZQYA 5ILOA 1YL6A 3GK3A 5K6AA 5JLAA 1GDHA 3FPCA 2F1KA 5ER9A 3I9MA 3KVOA 1V35A 3AUUA 3DDNA 5JW6A 3IIEA 3EVTA 3JV7A 3PYMA 4CM6A 4YAGA 1QG6A 1DHRA 1T2CA 1XHLA 3DMTC 4YB8A 1NPDA 3FBTA 3N74A 1GUFA 2VYNA 2GO1A 2PR2A 1LU9A 2X0RA 1HYEA 3DAFA 4LSMA 1ZVMA 3DC2A 5EERA 3OHSX 1NAIA 1VRWA 3C1OA 2P9CA 2AQIA 3JQAD 3L9XA 4O6VA 1RM3A 4LISA 4AJJA 2Q99A 4RLSA 3RUDA 2VHZA 1JKFA 3GC6A 1EDZA 4MP6A 4YJHA 4E2XA 4BB6A 2Q4EA 4B3IA 1ZNQO 5BSFA 4EDFA 3FNHA 5TX7A 1YVEI 1ENYA 2O23A 4XGIA 2BMAA 4UEKA 4AG3A 5T6BA 1R4MB 2GNAA 2VT3A 2H5LA 1FMCA 3OJEA 2I66A 5TF4A 1YQGA 4FIZA 4YAIA 3PJFA 3ICPA 4EJMA 1B3RA 4TVOA 3GT0A 3E5MA 1C14A 2DQ4A 4D7AA 5A9SB 1FDWA 2FZWA 1MLDA 3LYLA 4O0LA 5JC8A 1R16A 3LU1A 4E6PA 2YV3A 3Q1LA 4JN6B 4WLFA 3ADPA 1T4DA 2JAPA 4U0JA 4PLGA 1SNYA 3ZWPA 2NTJA 3W4IA 4AJLA 4F46A 1YONA 2VWHA 1UXJA 3DAGA 4A5OA 4Z9XA 4QUKA 3UAGA 4XDZA 3RJ5A 3JYNA 3VC7A 3DMTA 4IGEA 3NTQA 1LX6A 2O3JA 1VL0A 1LDBA 3I52A 5IN5A 4UUMA 1LSOA 3RU7A 5ADHA 2HK9A 4KUHA 1I3NA 2OP1A 4GQAA 1E3WB 2O2YA 1NHGA 1PJCA 3X2FA 1T26A 4RVDA 5I7SA 3PGXA 2WD8A 3H9EO 4D0SA 3KUXA 1BHSA 3DTTA 3PPIA 3CXRA 3JD4A 4FPXA 5CDUA 3IP3A 3GNQA 2XXBA 4RF3A 2EGGA 1TT5B 4MPDA 4CL8A 1UXKA 4ZQEA 1UDBA 2W2KB 2CDAA 3C3XA 3H5AA 1R4NA 1D8AA 3IC5A 4FFOA 4PLPA 4CQMB 3BA1A 4U5QA 3LT1A 4GX0A 4HADA 3H5RA 5HM8A 1DC4A 3TQHA 1U5CA 2DBQA 1ZK3A 3HN7A 1UP6A 7ADHA 1HT0A 4BO9A 4CM9D 1QKIA 4NG5A 3AM5A 3FTPA 1C1XA 1J4AA 4MJLA 3D4PA 4NIMA 3AOGA 1E1NA 4ND3A 3RD5A 4TWRA 3TF5A 5EN4A 2P68A 4JIGA 1YE3A 1K0UA 2VWPA 2ZYDA 5IFLA 3CIFA 4IDDA 4IS3A 4M8SA 5G4KB 5L51A 3V1TC 1SOWA 2B0JA 3DZKA 4QECA 2P9GA 3IL2A 1P9LA 3W8DA 2J6IA 1PJQA 2ZJ1A 4UUNA 3KBOA 2GRAA 1EBUA 4Y9DA 4IXWA 4EZBA 2JJYA 4NDNE 4D3FA 4YR9A 3E9QA 3GAZA 3AWDA 3RSHA 4CMHA 3PLNA 1EFKA 4W9NA 3U49A 4XRGA 1EQUA 1I0ZA 1E3IA 3CMCO 2C5AA 4JCOA 1VKNA 3V2UA 3KYCB 3O38A 4PLWA 3ANNA 1A72A 4NMHA 3AW9A 3G3EA 3EW7A 3U4CA 4Y6SA 5G0SA 1CYDA 1MXFA 2B37A 3I5MA 4UVIA 4ZRNA 3H2ZA 3TOZA 3UW3A 3WDSA 3H9GA 5GZ1A 1VJ0A 1E3EA 3WGHA 1HE3A 3Q6IA 2A4KA 4DLBA 5TS3A 5F5NA 3PRJA 1ENPA 1GQQA 1XQ6A 4NJOA 4Z3DA 3SLGA 4B4WA 4YAEA 1O94A 5TNXA 3TL3A 1PL6A 1FDUA 3EHEA 5JNLA 1E7SA 2D4AA 5T57A 2O4UX 3H3JA 5AYVA 3UKOA 3PJEA 3ZGYA 4RVSA 3D1LA 3C7AA 4U0KA 1LTHR 5DOVA 2HU2A 3OM9A 1O89A 2DT5A 3PZRA 4II2A 4PFJA 1F14A 1E92A 5BT9A 5ES3A 1ZUD1 3JQ7A 1GV1A 5JC1A 1H2BA 5IN4A 1WPQA 3DR3A 5TJ9A 5DCYA 3RFXA 1HZZA 3IOYA 2JHFA 4XQ9A 5CDYA 2W2LD 4L0QA 3TNLA 3I83A 3P2OA 3AI3A 3DHYA 4YTEA 3TZ6A 4DC1A 2TMDA 2CD9A 2AQKA 1R0SA 1AUPA 3DEYX 1P1FA 3M1LA 2CF6A 2OP0A 3VDRA 1JA9A 4PLFA 1Y7TA 3HDYA 2WM3A 3INRA 3V1UA 2X22A 4O1MA 1PQWA 4MIEA 4D42A 5CEFA 4WKGA 2D59A 3D0OA 2D1YA 3ZU3A 1PS8A 1FF9A 2HMUA 4CLRB 4RDHA 2DUUA 1LDNA 3CEAA 1PJ2A 1X15A 4M1QA 2ZJ0A 3HB5X 4J0FA 3DOJA 3K5PA 5ENVA 2YHIA 3PHLA 4BNWA 3Q0EA 4P8RA 3W8EA 1PJBA 3PYLA 4J2OA 2BGKA 5MDHA 4LRTB 5AOVA 1N7GA 1XU7A 3A28A 1Y5MA 3BHJA 3ZWWA 1NYTA 3JYQA 2VCYA 4XB1A 4I5GA 4JX8A 5L53A 3UGKA 3L4BA 3FNEA 4IBOA 4D43A 4CR6A 4CMKA 2J8ZA 3BMNA 4NFYA 1CRWG 3IS3A 1YL5A 1Y8RB 4EUFA 1MXHA 2D2IA 4S3MA 5KVQA 3RUEA 4B7UA 8LDHA 2O7QA 3HE3A 2FN7A 3U4IA 1E6EA 4HBGA 2GN6A 3PDUA 3OIFA 1LSJA 1OBFO 3ZDFA 4IZIA 3WGOA 3H65A 1VJTA 4OKIA 3TOXA 2AQHA 4INAA 4YT5A 3DOOA 3LZ6A 4YQYA 4IMRA 1EE9A 3JQ6A 3OETA 1WDMA 2FP4A 3GAFA 2PGLA 3ZWOA 1P31A 5THQA 4OM8A 1E0DA 5EJ2A 3GVIA 3PJGA 2ZB4A 1BWSA 1AHHA 3DL2A 5DBGA 4DIOA 5A9RA 2W4QA 3DAPA 1JTVA 2HRZA 1FK8A 4M55A 4NU5A 4C4OA 1LA2A 1ZEMA 2O4CA 1EVJA 1JKJA 1QRRA 3JQFA 4DQXA 1EUCA 1K89A 3I9OA 3PDJA 2W98A 3L07A 3OA2A 1P0FA 1Z45A 2D3TA 2VWQA 1LSSA 2E6UX 4GVXA 2NVUB 4FFRA 5A5FA 4FOSA 2VHXA 3K2BA 3OA0A 4E33A 2NTVA 1PL8A 2FMUA 3WBBA 2IXAA 3HNPA 1DLIA 1E1MA 4PIVA 4E5YA 4FJ1A 3RC2A 4AJKA 4HUJA 1H5QA 2Y68A 1DJQA 3V2HA 4IJUA 4XZ3A 2QHXA 4I1IA 4CV0A 1PJ3A 5JDCC 3DBLA 2CVOA 2C20A 4TRMA 3BMCA 2RHCA 1J5PA 4AFNA 3K2EA 2VOEA 5JYEA 3GVCA 1XU9A 2ZQZA 2ZB8A 1I2CA 4BKQA 1R4MA 3CZRA 2HLPA 2I9PA 2P5YA 4BS9A 3GQVA 1LUAA 3JQEA 4WNIA 3RUAA 2J3JA 3TFOA 3GVHA 2JFGA 1I10A 5KIAA 1VSUA 3UUWA 2QIOA 3JQGA 3C24A 3GGOA 2OBNA 5T5QA 1P0CA 3RQSA 3V8BA 4WOKA 4BO4A 4GX5A 4DYDA 4GWGA 1S7CA 2OUIA 5EQDA 4A26A 2OHXA 1GD1O 1OZAA 1QMGA 1UXIA 1Z74A 3HDHA 3MTGA 3NAQA 4CUKA 4DLAA 1ISIA 1Q2XA 3RFTA 4AJIA 2OBYA 3OECA 3UHAA 1O5IA 1XELA 2Q49A 1H2HA 2E82A 4E4YA 4DPLA 4E5MA 4XR4A 1A9ZA 3EUWA 3ZWYA 3F47A 2GUGA 4GSKA 5JPIA 1GYPA 4B8WA 2VHVA 4J0EA 4ZICA 1P44A 3PXXA 1YJQA 4D41A 5B4TA 2XOXA 2UYYA 3FCOA 1CERA 3HN2A 2P2SA 5CAEA 1XG5A 2YW9A 1YB5A 1JQBA 1VKOA 4A03A 4CR8A 3KLPX 3ZWBA 1UZLA 3AJRA 1WVGA 4DMMA 1ZCJA 1M75A 4OOFA 5COAA 4XQGA 3WGZA 4EEZA 4BGVA 1HE2A 3WYBA 3VTZA 1JW9B 3B1KA 3MZ0A 3Q2IA 5JMPA 4MKXA 1CQJA 3VZSA 3KEQA 4TKLA 4XDYA 1IPEA 1Z7BA 3U4DA 4CLOA 1TT5A 4O59O 5IJZA 4NJMA 5JFOA 1DXYA 1L7EA 4ZVVA 3LT2A 4UREA 2IZ1A 1AHIA 4Q3CA 3P7MA 9LDTA 3VKVA 1F12A 2X0NA 2C2XA 3MOIA 3WGYA 2H63A 2PGJA 5C3MA 3NUGA 1JDJA 3UVEA 3ANLA 2EXXA 5H82A 2FZEA 4IJWA 4IXTA 3H9QA 4GGOA 4AICA 1ULSA 2XF8A 3EDMA 4UUOA 1DJNA 1C1XB 3E5RA 4TKMA 3GVXA 3M2TA 1N92A 3F9IA 5FF9A 2BH9A 3I23A 1LC0A 1GR0A 4IIUA 1Z7EA 4P38A 4EEXA 1I8TA 2Q50A 3KYDA 4HFMA 2G76A 3T4XA 4WCFB 1E5QA 1SZJG 2UVDA 2VRBA 4J2HA 2EKPA 3VPFA 5AQ1A 4ND4A 1EQ2A 1GZ3A 2IYPA 4FJ0A 3GMSA 3I6IA 1X13A 3UCXA 2HAEA 2Y67A 4RPLA 3I4FA 4CM8B 4DPKA 2GERA 1HLDA 3OFSA 1U8FO 3QVWA 4MIOA 5A3VA 1YDWA 5TGDA 4ZHSA 2EJWA 4ZN6A 1H9BA 1HE4A 2O3UA 1EE2A 1GAEO 3LT4A 4UULA 5COBA 3W4KA 1P1IA 2I5PO 3ZHZA 1U3UA 5JAQA 1GADO 5IG2A 2DTDA 1RKXA 2AEJA 5DCUA 5KKAA 5KJEA 1QV7A 3PJDA 3DBRB 3RUCA 4J7UA 2X7HA 1FDVA 3IKVA 1GZ4A 1VL6A 4IQ8A 4J7XA 5K9ZA 3FRJA 2GZ1A 4AL4A 4IDBA 1AE1A 3RC7A 3Q2KA 4GAEA 1ZJYA 4Q3NA 5L7WA 3TZKA 3SVTA 6ADHA 2IEBA 2I6TA 1U7TA 2FPPA 3CPSA 4FFNA 1NPTO 3H5NA 5EESA 2Q46A 2FSSA 2TMGA 5CPFA 1BGVA 1MUUA 2CZCA 2DTEA 4BO3A 4CL3A 4DXHA 5AXAA 3BYZA 2CNBA 3ICCA 1H9AA 3QIVA 1T24A 4OJNA 3KRTA 2IZZA 2AE2A 3VHRA 3D4NA 4YJHB 4WLOA 2RBEA 2B4RO 5JAIA 1DC3A 1XR3A 4Q9NA 2HMWA 4UEJA 5IZ4A 4UUPA 3D3WB 3ZNQA 2G17A 3KV3O 4WLNA 1H94A 4E0BA 3UICA 2JD0A 3KB6A 5H83A 5U1PA 3NV9A 4MVJI 2HMVA 4HFJA 4TRRA 5TC4A 3F5SA 3TFQA 3FWZA 1WXDA 3AI1A 3C1AA 1ONNA 1YKFA 4G65A 3GZNA 5FI5A 1H93A 5H81A 2Q2WA 2AEMA 3B70A 3OIGA 4D44A 3GG9A 2VUUA 3WSVA 1B8UA 4RVHA 4NR0A 5CPBA 2YFQA 3UN1A 4CM5A 3A14A 3F5QA 2GASA 3ONFA 1JU9A 3AFNA 5TSDA 4B4UA 1PGQA 1MG5A 2ZB3A 4RPJA 4R51A 1LXCA 5G2OA 1KYQA 4P4NA 4WOJA 4J49A 1X1EA 3WB9A 2YDXA 4N5LA 4TRNA 4OGWA 3V1YA 2EHDA 3G1UA 4BGIA 3Q9UA 4QFDA 5FWNA 3HB4X 1DRVA 5LDGA 2HRBA 4D3DA 1F8GA 1KC3A 1UR5A 1IULA 1ZBQA 1WLYA 3MJCA 3E9NA 4CMIA 2BLLA 3NRCA 3ONEA 1B3BA 4BKOA 2Y99A 3CMMA 1ZKMA 5JCXA 5KTKA 3JD2A 1VM6A 3PIDA 4BO8A 4H7PA 2VHYA 2OFPA 4I5FA 4ZD6A 3ZWCA 2J5RA 3U4HA 1NR1A 1BVRA 1OOEA 3HG7A 3VAZA 1ZSYA 4CMAA 3OJOA 4WECA 4XYBA 3KOUA 1X0VA 1KBZA 4ONEA 4BNFA 3VKUA 1PR9A 3A06A 4N5NA 4TZTA 4R54A 2QRKA 4GMGA 3AI2A 4IGFA 4Z9YA 1X14A 2FR1A 2WYWA 1SO8A 5EIOA 5ICSA 4BNJA 3G49A 4PG5A 4XD2A 1GPJA 1N2SA 4MVJF 2AG5A 4XQEA 5L7YA 1KEPA 1EK5A 3RBVA 1UH5A 4Z3KA 1YBAA 3E1KA 1R4NB 3IJRA 3OEYA 1E3SA 4CQMA 3DHEA 1Y8RA 4OH1A 4WUVA 2PD6A 1WZEA 1HTBA 3FNFA 3QWAA 1ADGA 4YJFA 3GGPA 4Q3BA 3ZCXA 2Y05A 5EL0A 4IJVA 1QXSA 2BD0A 1GYRA 5C7OO 1K6JA 4LVCA 4WCFC 3UOGA 3SX2A 3LC7O 5G0VA 1N1GA 4AJ1A 1DOHA 1A9YA 3ADOA 1EEHA 3V5NA 4EGFA 3O26A 2R2GA 2SCUA 3VZQA 2Q1SA 3T7CA 3PWZA 4CLEA 4N5MA 2YJZA 4IS2A 2DBRA 4IQGA 3OP4A 4PRKA 4EUHA 4J1NA 4YXFA 4MINA 5ENDA 4DLLA 1FDTA 1R0KA 2NTNA 4JLWA 4BOYA 3RAJA 5THKA 4PRLA 1UDCA 2Z5LA 1VL8A 3WSWA 3EAGA 3M2PA 1ARZA 1E77A 2LDXA 2P4HX 4PLHA 2QQ5A 4E5KA 2NVWA 2F00A 1YXMA 4LSWA 3CKYA 4XRRA 5DCWA 1U2GA 1SC6A 1B14A 2A92A 3KTDA 4IINA 2NACA 5LDHA 3S1LA 3GN2A 3Q3CA 4KP7A 4L9RA 4UVGA 2EWMA 4J6FA 2DBZA 2JKVA 1PJTA 3C7DB 1ID1A 4OMUA 3AOEC 3KLMX 4FJ2A 2IDZA 2G1UA 2GN4A 3ZV3A 1EFLA 3BMCB 1T1RA 3GRKA 1ZXBA 3F1LA 4BNIA 1T4BA 4P22A 1GZ6A 1MP0A 4IUYA 4ALJA 2OORA 4OQYA 5L3ZA 2I76A 1R12A 4ILKA 3KSDO 1OC2A 2E4AA 3QA9A 2JCYA 3ETGA 1ZMTA 2WWRA 3FD8A 4ESOA 2AG8A 3VH1A 4PZEA 1RM5A 1HDZA 2O50A 4L4RA 3VPHA 2GZ3A 3OJFA 4BVAA 3ZV5A 2Y1FA 4Q3AA 1SEVA 1UJMA 2ZKLA 1E3JA 3RVDA 4DQUA 3JQGB 4BNNA 4KUEA 4HNHA 3TDKA 1KEWA 5AVOA 5BSGA 3JCZA 4O5OA 4BNLA 3ZHXA 3PQFA 3WNQA 1C1DA 2O7SA 5IDQA 4UEOA 3SXPA 3ZHYA 5KVSA 1DB3A 4EUEA 2I99A 5K0ZA 2UAGA 5JDIA 4XA8A 4AJ2A 5KVCA 1AXGA 1E6UA 1GTMA 3D7LA 3RBXA 1LQTA 2BKAA 1ZK2A 3HJAA 1XIVA 3GDOA 1K3TA 2X0IA 4CUJA 1EVIA 4J4HA 2YUTA 3F3SA 3N7UA 4LMRA 2PZMA 1KY5A 2WMDA 4LGVA 2C29D 3E18A 4Y98A 4JP3A 5B4UA 5L4SA 4PLZA 2FHSA 2VRCA 4TZKA 5DBIA 3G17A 2J3KA 4U6SA 1HF3A 5HRUA 2D8AA 5HS6A 2FR0A 4GL4A 5CG1A 1R0LA 4R9RA 5KJFA 1Y5RA 4QFCA 1EBFA 5I9NA 2RAFA 3DFZA 2JAHA 3FTNA 3HQ4O 3JQBA 4PLTA 3SJUA 3TZQA 4BKRA 1ZK0A 4NJMB 4E3ZA 4DTIA 1O6ZA 4I5EA 1K6XA 2VRCD 3K31A 4KDFA 4WLEA 5DN9A 2G5CA 2DFVA 3S8MA 1ENOA 4OOEA 1ZK4A 5KOIA 3MJVA 1LI4A 1WP4A 2EV9A 2EW8A 2VZ8A 2PD4A 1R6DA 3ETDA 4CMJA 3CZMA 2FPGA 3GG2A 4CM7A 3MCVA 1M2WA 3KYDB 2V6MA 1LSUA 3CE6A 4WCFA 2UDPA 3GOHA 3JTMA 2ILTA 1I2BA 2VWGA 1PZHA 3WIEA 3IJPA 3ITDA 4CM8A 1V3TA 4JJFA 1SAYA 3NGLA 2ZIZA 4HXYA 3WQQA 1SB9A 3ROMA 5IXSA 4NNJA 1ZIDA 5MGBA 3H3FA 3AU9A 3JSAA 1BSVA 2Z1NA 3ZNNA 3WFJA 6LDHA 1E1KA 2DPGA 3GNTA 1SMKA 5EPOA 2OO5A 2PZJA 3QW2A 2J3IA 3VVBA 5CP8A 4B8ZA 3DBRA 4CM3A 4JJIA 1P1RA 2DAPA 3CH6A 3QSGA 3ZWNA 5TT0A 4E12A 4YJGB 4YCAA 4BO5A 2Q4BA 4DVJA 3ASVA 2PFGA 4M86A 1BTOA 4TMFA 3VZRA 1YQDA 3OQ6A 4M89A 1P77A 3W6UA 3WGQA 1CWUA 1NFQA 5T8KA 1PZFA 4GKVA 2I65A 2ZTLA 4J43A 4FC6A 2X23A 2AEFA 1MA0A 1U28A 2JL1A 1D1TA 1HRDA 1QP8A 3RUIA 1ISJA 1QORA 2A35A 4TSKA 5TJHA 1YOVA 3NJ8A 1IYZA 3O03A 3LQFA 4IDAA 3O9ZA 4YRAA 3S2GA 1HDCA 1GCUA 1KIFA 3OSUA 1NWHA 3RU9A 1X7DA 1BDMA 1NQTA 4BGUA 1T1SA 3QVTA 4XGNA 3RC9A 4GH5A 4XIJA 2B5VA 1JAYA 5T8KC 4GMFA 3GNSA 4LCEA 3F4LA 5FI3A 3GGGA 3WOHA 3GZNB 5HS4A 1N1EA 5JY6A 3HADA 5A06A 2Z1MA 1RYEA 1DFIA 3EC7A 1NVTA 3LF1A 5C7LO 3U0BA 2CVZA 1QYCA 3WYEA 2EIHA 1PGPA 1UZMA 4GX2A 3Q9NA 4KZPA 3RROA 1E1LA 4I9NA 4YACA 1H6BA 3O4RA 3KSUA 3R6DA 4KTTE 4YPOA 4L74A 2VQ3A 4ND5A 3WGTA 3COSA 2GZ2A 4FD3A 3PHHA 3RUHA 4R5MA 3SC6A 1JAXA 1YO6A 4NQZA 3GF4A 3JYLA 2FR8A 2AE1A 4FFLA 3RI3A 4ALLA 1LDGA 1HETA 1M66A 3RKRA 1O95A 2HK7A 3PLRA 5I7VA 1LRJA 2X9NA 1H6CA 1UAYA 2VYND 1HEUA 3PYXA 1CETA 4NK4A 2CDCA 2WE8A 3ZI0A 1T25A 1M6WA 4OYRA 1B16A 4L76A 3QRWA 3IAHA 4GKBA 3PHGA 1WMAA 4RVGA 3RJ9A 1ZZEA 1IHYA 1I3KA 5JDIC 2YV1A 5U9CA 2GN8A 4FW8A 4JBIA 3GLQA 3QY9A 4GX1A 4B4OA 3OJLA 2YHUA 1NFRA 1OI7A 1BXKA 4MKZA 3CINA 3PZBA 4O63O 3JD0A 3H7AA 1VE9A 4IQ0A 1DC6A 2NSDA 4ND1A 3MTJA 1RWBA 3SC4A 4ALKA 1T2FA 1PTJA 2RCYA 3DZHA 3QHAA 3T7EA 2X9VA 4CLOB 4F45A 5JS6A 4XJSA 3C8MA 1CDOA 1HL3A 3NKLA 3ANMA 3B6ZA 2X58A 5TRTA 3L0DA 2VUSA 1WDKA 1DSSG 1E3LA 2A94A 2ZTUA 4W7IA 3VDQA 3UXYA 4II3A 2NU6A 1M6HA 5A02A 4JXKA 1NM5A 1U8XX 1BVUA 1GL3A 2PZLA 5ER6A 1NFFA 4FGSA 2CY0A 1UP4A 5AXDA 1JN0A 1I2ZA 2CVQA 1ZO8A 2FOIA 2O3QA 3TL2A 1J0XO 1OC4A 5G0UA 2W8ZA 3NX4A 3QWFA 4F6LA 4B7CA 3QQPA 1PJLA 2VZ9A 3WGGA 4XWYA 1Z6ZA 4TRJA 4WCDA 5EQFA 1J49A 2CSUA 2PZKA 3D3EA 3JQ9A 4J9UE 1Y8QA 4CJXA 1NVGA 3OQ1A 5G0TA 4I9UA 4CMCA 1E6WA 1LDYA 4L73A 1R66A 2Y1DA 2NWQA 2OZPA 4MVJP 4YT2A 5GZ3A 1MX3A 3PI7A 1NQOA 3IQDB 4I5DA 2GYYA 4M49A 3D5TA 4HKTA 2D5AA 3BTVA 1V8BA 4AJHA 4RQUA 5F1OA 5J23A 4A0SA 5A04A 1XGKA 1Z73A 4DIBA 1ADBA 2GN9A 2PD3A 1ISHA 1F06A 1ORRA 5AXBA 5G4LA 4YT8A 1G0OA 3BTOA 1BDBA 2GF2A 5ITWA 1P1HA 1KERA 3BMOA 2Y1OA 4FDAA 3C85A 3OMLA 2FPIA 1W0CA 3JQ9C 3ULKA 4BO2A 4CUZA 4YAKA 1T2EA 1K2WA 3UH1A 1JVBA 3T4EA 2HQ1A 4IPTA 2B69A 4CV3A 5CFZA 1I5RA 2BELA 5ITVA 2X6TA 3HFSA 3LLSA 1BXGB 2CF5A 3ZH2A 2A9FA 2H9IA 1NP3A 3KETA 2B35A 3UCEA 4XYEA 2HKIA 1PQUA 1GCOA 4RF2A 1XQ1A 5COQA 3K9QO 3WJ7A 3D3WA 3OJ0A 1LQUA 4DA9A 4NBUA 4ITUA 5IF3A 3DMYA 1GEEA 3GFGA 2VYVA 4ZGWA 3MOGA 1DO8A 2PH5A 2QW8A 1X1TA 1QYVA 3PWSA 5DDIP 2B36A 3EMKA 1C1DB 5IDYA 5JYDA 4RZHA 1ULUA 2EJVA 2YQ5A 4OIMA 3KXDA 4NFHA 4H3VA 3ASUA 4RDIA 4E30A 2OMEA 1LEHA 3G79A 2VYVD 3P19A 1OAAA 3KEOA 4G2NA 4Y6PA 1IB6A 3OH8A 3INGA 1ADFA 5DT9A 1QLHA 4CM9A 1FDSA 1V3VA 4J1SA 4DYVA 4ZJUA 4R1TA 4OHUA 2EW2A 2X9GA 1O9BA 1N8KA 2NVBA 4AVYA 3LF2A 4A27A 2P9EA 1GV0A 4R01A 1SB8A 4DGSA 2UUOA 3U62A 4CMIB 2VN8A 1KY4A 4DMLA 3RFVA 2NQ8A 2NADA 2NU9A 1VLLA 2XPCA 3GFBA 4MO2A 4F3YA 5JO0A 4RGBA 5L4NA 3OBBA 2NUAA 3ZHBA 2HSDA 3WS7A 5I8ZA 3TPCA 1DAOA 1T2AA 2VT2A 1ZW1A 3H8VA 3VOSA 2WE7A 2X0JA 3PHIA 3R0IA 1EMDA 5IAAA 4HFNA 2BGMA 1HSOA 5HWSA 4EW6A 5A9TA 1B8PA 2YYYA 1Q7CA 3HSKA 1RM0A 2JCXA 4U8GA 1ENZA 2DBVO 1ADCA 4JBHA 3L4SO 5KNLA 4IDCA 4MKRA 4CMBA 3P5SA 2AMFA 5JBIA 4A10A 1KVQA 1U9JA 1YJ8A 4PG6A 5ILGA 4L4SA 3VPSA 4BNZA 3IUPA 3FN4A 3BHMA 1PJSA 2JD1A 1V0JA 3ON5A 1U7HA 2EP5A 5JMWA 3ENNA 3BZUA 4RZIA 2ZTMA 2NNLD 2W2LA 4RF4A 1MC5A 1MC4A 4EBFA 4FGWA 2C07A 2IEDA 5BQFA 3IDSA 1B15A 3S2EA 4YWJA 2ZCUA 3ROKA 3EZYA 4YJFB 2GCGA 3U9LA 3VPXA 2PH3A 3E9MA 1IE3A 3DOCA 4JROA 1ZXLA 1QYXA 4PLYA 5HBRA 1B8VA 1C0PA 2QYTA 4OO3A 3S55A 4PLCA 3PQEA 2QZ9A 3H2SA 4CM4B 3WNVA 5B12A 4AJEA 3K6JA 4MP8A 1VI2A 3W4JA 1IUKA 3BAZA 4Y8VA 1I36A 2CMDA 2Q2VA 4P4GA 1H6DA 2WYUA 1W6UA 4B4VA 3KM0A
chains in the Genus database with same CATH superfamily
3IR6A 1U28C 4QRIA 3GQBA 4K7JA 1W1WA 3EQZA 3II6X 3MMPA 1NI4B 1CZUA 2QZZA 3KEMA 4JJKA 3KTFA 3PP8A 4BFUA 1G5HA 2VH5R 4CLHA 4BXOA 1XWWA 2ZUDA 4YBZA 3ROPA 1JV2B 4NCXA 5LXTB 3K8ZA 3BXHA 3FUWA 4DBLE 3B53X 1ZJ5A 3COZA 2YJ4A 3S99A 4G81A 4MVJG 3MT7A 4LZLA 3BORA 3TEJA 1EK6A 3E3AA 5CEEA 1V39A 3FNGA 3ZVLA 1IOWA 4A23A 1ISGA 2MINA 2QPTA 4D9KA 5JNWA 3VO8A 2JEZA 3WG9A 1N2BA 3CSUA 3DFKA 2BJVA 3OIUA 1QZUA 3A25A 5JSUA 4WK6A 3WYAA 1CG6A 4BQPA 2R5NA 4S1WA 3WKAA 3GZJA 3LQQA 3VYWA 4LYDA 4DVGA 3OOWA 4F12A 1C9YA 1HDYA 2WKSA 2O8EB 2JEYA 4LGCA 5H5JA 1SR8A 3LGSA 3D7KA 5KDOA 1U1IA 3H2IA 2BGRA 4EZIA 3A9UA 5IBPA 1SURA 3P2IA 4LHZA 2IC5A 2PL5A 1A5AB 1SCKA 3E3OA 3GZ4A 3DHNA 3THOA 1A4RA 2NSHA 5J4YA 4DREA 1YU9A 3TLGA 4UAJA 3RYFB 2UV8A 1M6VB 2RKWA 1BFDA 4YRZA 4CT5A 2C5SA 3O94A 3HCNA 3SC3A 4L75A 1PCXA 1QF9A 1UEJA 2NGRA 2WSBA 3IUBA 2HMSA 4A8JA 4DR4B 2O8CA 3LW8A 1W4ZA 3ISVA 1V96A 5ADWA 3V4OA 2H18A 5AW7A 1YSCA 2GEDA 4PWYA 1GAJA 2Q1WA 3DL7A 3TGLA 1PSZA 1WCXA 2JDIA 3CH5A 1RRFA 2GR9A 2C9YA 3GUHA 3H6GA 4H60A 3VTFA 3MIIA 1J6UA 1IIBA 1KI6B 1Y89A 2RB4A 2TMKA 3OWXA 1HXHA 4PYRA 3SLKA 3N58A 1H23A 3WK5A 5HZMA 3AM3A 3TLYA 2BIFA 2X5OA 1B8OA 1ESCA 4WFQA 5H02A 4G67A 2H11A 1KFKB 1MJFA 4BNMA 2EWVA 4PVDA 2WRZA 3KG2A 1Z6YA 3MSCA 4QASA 1LF0A 4IFBA 1TUBB 4HLUA 2BFAA 3ZNPA 5JHHB 4M21A 1EGMB 5KBYA 4YJ2B 4DLKA 1B41A 3RUFA 5DYIA 4YROA 3UWPA 3MTBA 3AZQA 5AH0A 4A7PA 1ZMOA 2W48A 2O5RA 5FAKA 2GGSA 1N1MA 2QM7A 1Y3HA 3GYGA 4JLPA 4BPBA 4X94A 3UCFA 5DZSA 1THMA 4P35A 5HYVA 2X4IA 4QEDA 1JXAA 2AG0A 3NJ4A 3E05A 5HTKA 2A5YB 2CUNA 2DHDA 2YQZA 4RHCA 1G6KA 1YGYA 1HFJA 1VIVA 2P2NA 1OT3A 2W2NA 3DZGA 3V6MA 5CBKA 1O8BA 4PO8A 1RJ9A 3ZV6A 1ODFA 4DQVA 4GI2A 4JP1A 4RM2A 3CH7A 5KKCA 4C78A 3AY3A 4NAVA 4MWBA 1WVMA 2XMGA 2ZATA 3GY0A 1HDXA 5AOCA 5H7XA 3JRXA 1Q0LA 2FSIA 2OLJA 3UF0A 3LT0A 2N1MA 2H7YA 3IEXA 3OQVA 4KQ6A 3T3PB 1RJWA 4M6WB 1R4ZA 4S2UA 3ZJVA 5ANRB 2ZYAA 2WF8A 1RKVA 3NBAA 5C7IO 4GYJA 3DKPA 2IZ0A 5CG2A 4F1JA 4BLUA 3THXA 3QYAA 3ORRA 2XEDA 4OJKA 1N9GA 1ZGHA 2D5LA 3DBVO 4LC1A 2ZI9A 2FZ5A 5AIAA 1D09A 2BEVB 3BGIA 2FZGA 3QU5A 3RKSA 3QG1A 2QTWB 3V4SA 5BSHA 2P27A 4OK5A 4PGFA 1L1FA 2IU3A 5E4FA 5JJLA 5BSEA 4AURA 5ESRA 2XZDA 1S6YA 1MF7A 1J97A 7AT1A 1NTRA 4ZICA 2ZZMA 4HWGA 4RGVA 2H52A 4M87A 3D4OA 3GB9A 1W35A 2PJDA 3BZWA 4NCHA 1T8YA 4DUPA 5EKTA 4DIEA 3HEBA 2X4GA 2GEFA 4PICA 5IKXA 1T0JB 3IXLA 2C8LA 2BZ1A 2X5XA 4KR2A 2HZBA 2AJCA 1LK5A 4M0UA 3WMFA 2IHVA 1KPHA 4N8DA 1G1AA 1YVUA 1ZINA 4KPFC 2V4MA 1DADA 4KWIA 3DS8A 5A4DA 1NC1A 1FEZA 1FX0A 1WCIB 3A4LA 4A6PA 1Z5VA 1B76A 2IPMA 3BSYA 3ETHA 3K72B 2NLOA 3TMKA 4J9VA 4CKEA 4NCBA 1WMBA 5BOSB 3HUDA 4JWKA 4NPCA 1YNOA 3GRPA 1NVBA 1HSZA 4AN0A 2SHKA 1SY7A 4EHNA 3DGFC 4K8OA 2WJAA 3NH9A 3F1KA 2AHOA 3O7WA 4ZAZA 4MLCA 1KVRA 2HIGA 3V34A 2EW1A 3T5PA 1U11A 3UMBA 3R8FA 1GZ5A 2BFDA 3FI9A 3I9LA 2XYPA 3IR5A 5E6UA 3ND5A 1XJQA 4MI6A 5F3RA 5ED4A 2BYTA 1QWOA 1HDGO 4C08A 4KOEC 3GRCA 3VJLA 5A5GA 2ZYTX 3DULA 1BXZA 4KIJA 2FKNA 3OM0A 3P4YA 4R9SA 3MLBA 1ZUIA 1BW9A 4CMGA 1M34E 5KPJA 1P9WA 2H7CA 2XVAA 3FYUB 3K73O 2OGTA 4UNRA 1U9IC 5BMVA 1ZOOA 1DLJA 1MO5A 4PYOA 3ZWXA 4EMTA 3OICA 4AKEA 2V3WA 4AZ0A 2OV4A 1TYAE 1TADA 3H1TA 4V1CB 1PZGA 4CF5A 1CP2A 2PPLA 5LMNB 4O4LA 6CHYA 1N2HA 3ZD6A 2GYUA 2XUZA 2YY6A 4KSBA 1ZY2A 5BSTA 2GH1A 3ZOKA 2C5EA 3KQLA 3PNQA 4R6WA 2OBBA 1LBHA 4BZXA 4YLGA 4G9EA 1I2DA 2NV2B 1KI1A 1F48A 3DZJA 4PN3A 1JIXA 2VDWB 4PINA 4ARZB 3AR6A 2QRVA 2WBLC 4HDOB 3C6KA 4S1VA 1G66A 3C5HA 5E0OA 4I8IA 5DSXA 4KN6A 2NU7A 3GCDA 3GCGA 4WPGA 1JAHA 1JG6A 4EI2A 5B37A 5JR3A 3H0EA 3WSTA 3WTBA 4BL5A 2N47A 3P26A 2FSVC 5FORA 3UFXA 1FYXA 4BQFA 3COVA 4Z7JA 4HMQA 3QW4B 5C1DA 2ZBVA 1ZL2A 1QHEA 2XLCA 3FTFA 1P72A 3FAZA 1A1SA 1AO3A 2R86A 3LK7A 5BSWA 4ZQGA 5CB4B 3GAAA 1QHYA 1JF8A 1XZHA 3QI2A 4TKUB 1U8UA 4LDJA 3LFHA 1JVSA 3PNMA 2QG4A 5TPZA 3VVMA 1FXSA 2VYCA 3BWCA 2ZCJA 2CJPA 4EFLA 3FA2A 3PCRB 4HRVA 1XF9A 4MV1A 3D8TA 3PC4A 4UQPA 2JFPA 4FCCA 4KO1S 4HVAA 4U7WA 1AVTA 5LLSA 3WAGA 3LT5A 3CY6A 2V55B 5D3KA 1UPUA 1M0WA 3V8PA 1YR6A 4WBNA 4QARA 1ZZGA 4MRSA 1LF5A 5JAZA 5A71A 2XA1A 3AKEA 4D96A 4Q1EA 4TWZA 1P6UA 2ONZA 3AUKA 2VHWA 3PGLA 4WOPA 4Q03A 2Q5HA 5KYVA 1AZSC 1G8SA 2B78A 4ZQHA 1JMKC 2FJUA 3WY9A 3PFNA 1ZEJA 3R7FA 1K6MA 1NLYA 2JAUA 3KQMA 4N5IX 1O03A 1XZ8A 4R1OA 5T3YA 2HYDA 2J3HA 3OF2A 1AXRA 4K9PA 5CLFA 5JY1A 3G0GA 5J5VA 1BEEA 3GLUA 1OWLA 4JH0A 2ZYWX 1NUQA 3FF4A 3M3PA 1JLLB 4OQZA 4V38A 2XZOA 3CG0A 3JQAA 4V0ME 4RY2A 3MJ4A 5K2MA 3C5CA 1GGHA 1P8AA 1YKGA 4H16A 3EGVA 4CZ2A 1Q7RA 4YRGA 3TW8B 2NVOA 2WVJA 3ZDXB 1JTEA 4OHCA 2F3QA 2Z1DA 2HO4A 4QJIA 3FHOA 3VSCA 1D1QA 4OAOA 4D5EA 5KVVA 2RH9B 3T4PA 3VSDA 5MFPA 3I72A 4I1VA 4J0DA 4KQXA 4B82A 2Q1UA 2VHTA 1O8CA 5EEGA 1N6NA 3EJ6A 1NMYA 3C8UA 4UVEA 5FX2A 3FTCA 1FS6A 3AF1A 4DLSA 2J67A 2MWMA 5BN5A 4ME6A 3I3OA 1YH3A 4KQKA 4ZMBA 1IHUA 1Y63A 1HG0A 2EF1A 3K35A 3OIDA 2WPDD 1HDOA 4HF7A 1NUPA 2C0CA 2OL4A 2YV2A 3OY2A 3ZY5A 3HU1A 4IMJB 2ZETA 4QTYA 2WFLB 1MKYA 5KYYA 3AR3A 2I9KA 3MHTA 3AETB 4Z4IA 2WJ4A 2JFZA 1P4RA 2NTEA 3GHHA 4L3WA 4MNTA 4YCLA 1Q7EA 2DR0A 3K96A 4E5PA 1E79D 2DM6A 1XWIA 3HVKA 2R8ZA 1XTKA 4X60A 4AKTA 1KK3A 3WX0A 3G6WA 5K5EA 2VKQA 1UBCA 5JSZB 5T64A 3MCWA 3VH2A 4BVHA 5T6MA 4A8TA 1SKYE 1K0FA 1MGPA 2QDXA 1UFKA 4DR7B 2A14A 2WJGA 4P5PA 3RNOA 4B6QA 1KH1A 1XRJA 2GCOB 2C7VA 2V45A 1YI8A 3FSJX 1CEQA 4FSDA 4KXVA 2WF7A 5JO9A 3ZE9A 4O4LF 4A0GA 4B31A 3R1IA 3W8FA 2Q1TA 1OU4A 2Z2KA 3HB0A 2OR3A 1I30A 1U7DA 4XOUA 1C8BA 4TL6A 3IP9A 2XUAA 1XYYA 3D02A 4DSUA 4GR5A 3NVKI 3EGCA 3H86A 5KOJB 3LX8A 5K8LA 4G0OA 4MVJA 1RR6A 1TVKA 2IP4A 1E7RA 4H08A 3QLTA 2DUWA 4JUIA 4KV9A 4X54A 3FDIA 1JRLA 1V11B 1X39A 4EL5A 1C0LA 2PUCA 3R0QA 4LDAA 2EFCB 1Y3AA 3MJTA 2DR3A 5EG5A 4Z4QA 3L1HA 2PA0A 2HQRA 3AR9A 3IPRA 4HNAB 4OHYA 4DCPA 4UMFA 3E4DA 1C30B 3GFPA 1GNVA 3IELA 1FU7A 3NP9A 5F1PA 1HT3A 3FVRA 4WINA 4DN6A 2PUAA 4DDMA 2ECOA 1JEJA 2YOHA 3ZU4A 2DXIA 2D5CA 3DONA 5F35A 1XWFA 1PJ4A 3IT2A 2IS2A 4IDGA 1OTXA 3A6EA 4D8WA 1P4GA 2PSJA 2DTXA 1W5SA 2BI7A 2PLAA 3KZMA 3OY7A 5JRDS 2E4XA 1RHQA 5FUWA 3T5TA 2JI8A 5KNDH 1PJRA 1C3VA 3A6JA 3CLTD 1IG3A 1JYFA 3KYCA 5ALIA 3TZCA 4DNOA 2ZJ4A 5CITA 1JDPA 1JIQA 1W85B 1XDBA 1P6XA 1DFHA 4KX3A 3WB2A 1IBCA 5ALSA 3EK2A 4HVCA 4LF5B 4LY3A 1VE3A 4BFSA 1II8A 2P4QA 4EI9A 1EINA 2HPZA 4CKCA 4KTVE 3EVCA 1M6VA 1YUBA 3RSOA 1R9JA 2I7CA 2J07A 3LCCA 5KWIA 2E5LB 1XCLA 4OXRA 4Q7EA 4YCJA 1JFSA 4CE6A 1TA4A 2FMFA 2H2FA 3RHSA 3UY4A 4H1HA 1LBQA 2JS7A 2GD1O 3DEHA 2VIIA 3BXEA 3S27A 5BMVF 7YASA 1YCFA 3H4VA 3V3TA 4EKEA 1YAHA 1QCDA 5F9HA 1KYXA 3DTVA 4K88A 4NCNA 1KI8A 1X92A 3TK1A 4XYGA 5K01A 3LTNC 4OKNA 3KU4A 1A50B 1VLZA 4GI5A 5KVSA 4UCQA 3TXAA 2SECE 2XGSA 3MJEA 1P9OA 2DFKB 3S2UA 1EWVA 3SYLA 3TDNA 1DAPA 2HK6A 3F49S 4AWBA 3P9XA 2B2NA 4YP7A 3IAFA 1KKLA 1X3LA 2FXVA 1TQ4A 1VGQA 2QT0A 1X42A 1X0XA 1CQPA 5KTSA 1E9CA 1GEGA 3QP9A 3T3NA 1LPOA 1PE0A 1U3WA 2V7UA 2D2VA 2IY8A 1C0IA 1P81A 2ZUTA 3VU8A 3IDOA 4YJ2A 2WEKA 3SYMA 2GDZA 3OZGA 2HK8A 4KQJA 1PIWA 4EAAA 1EDDA 3Q87B 3A36A 4RBNA 4RTOA 1L5ZA 4LJRA 3FUXA 3GPDG 1GXSA 1XKTA 3EQ7A 2W90A 4HDCA 2VK2A 4QYMA 2MMGA 4ZEVA 5DTJA 1BU8A 5IJWA 2WT8A 3JQRA 1A7KA 1CJVC 3H1BA 5IAKA 5AVXA 4NRDA 1V8OA 1LLUA 1W9HA 2Y0BA 2ZRHA 4KXWA 2PRYA 4ZQFA 4XWOA 1Q7BA 3HXQA 1SXJD 3NFYA 1NAHA 1B7GO 4JXXA 2QVBA 1RHRA 1YBMA 1MB3A 3W5IA 3AFMA 4HYYA 5DULA 1LLDA 2A3RA 4M0DA 5CBPA 2H9YA 2Y66A 4HLDA 2WSSD 3K53A 1RHMA 4R9NA 2ZWMA 1GUZA 4CDRA 4RXMA 2VP5A 1KVSA 2D5BA 4P82A 3FB4A 1IBRA 4AJPA 3URMA 1SRRA 3CW9A 3IMFA 3IYLW 4IIJF 4JT4A 2FRDC 3WLSA 4EZEA 1RACA 2X6QA 3IJ5A 2JB9A 3AERB 4B73A 4KE7A 1WB4A 3HZZA 4GUDA 3S5JA 4DHWA 4TYNA 1N9GB 2GBGA 3DVLA 1P8JA 3HS3A 3QBTA 2C59A 1Q2UA 2OQRA 4QX6A 3TSCA 5AJWA 3LUKA 1DU4A 4RVOA 4BQOA 4BEWA 3CVUA 1DBSA 3A58B 2IS1A 3ESDA 5FYDA 3W34A 2ZVJA 1V5WA 4YRLA 1XEWY 3REGA 2BTQA 1G1MA 1WAMA 4NBWA 4MGKR 2IGBA 2A0UA 3NM6B 3IHLA 3BK1A 3K32A 1ESEA 3AB8A 4GLLA 2RJOA 1FBTA 3RG2A 5AJUA 4R3UC 1M2HA 1GFSA 1BX1A 2GM3A 5CDTA 7MDHA 5K8JB 3O2SB 3UBTA 2H1RA 4DLTA 5B7QA 5ADUS 2ILVA 2P9FA 1QZZA 3FFWA 3RK4A 2KBFA 2PY6A 1PT6A 4HGNA 1IN5A 3OD1A 1GKLA 5IT4A 1XCOA 3ISTA 3ST7A 2RGNC 1G60A 3FZNA 3RV4A 5HQ3B 1UWCA 1ZSVA 4QDTA 2VSXA 1LI5A 4NLLA 1UBSB 3HBMA 1JSRA 1JIJA 2BGLA 3S2FA 4UHFA 1DAIA 5L95A 2ZCVA 3FRIA 3GV0A 3IOEA 3L4BC 5CVVA 4DWVA 5SZHB 1I3OA 2IVFA 3BXXA 4GQBA 4JGBA 4LHEA 4YJKA 1UXOA 1Y9AA 2XQVA 1UKVY 1U2RA 1N4AA 2OCKA 3RS5A 4QODA 2YJTD 3IPLA 3JAKA 1FA9A 2F4NA 4O2BA 1S9DA 4UBJA 1Q77A 1GPWB 1NRXA 3FHCB 4LX0A 4AT1A 3LA8A 1ZBDA 3U3MA 3UJ3X 3ORQA 1IEWA 1Q12A 5DVZA 2ORIA 2Q3DA 4NKRA 5TT1A 3RASA 4HGOA 5DEOA 5HFAA 3G2HA 3PICA 4EJ6A 2QRJA 3KB2A 2KI5A 4JI3B 4NFSA 2WILA 5BR4A 1XOIA 2BI8A 3KJIA 4TTAA 2PGDA 1RE0A 3CN7A 3LYUA 1BKDR 4G85A 4G86A 4EWLA 1S2GA 3M1AA 1KH2A 3LUFA 3ZQ6A 1SQFA 5I4KA 4DARA 4YHHB 2YX1A 3R6GA 3ZWVA 2YZKA 3K0KA 4JQOA 2A2ZA 4LI3X 3TN7A 3HEAA 4UJ5A 4B5LA 2FW9A 2WUEA 5I7HA 4N3GA 1JL3A 3GJSA 1ECFA 1E64A 4NOMA 2OM6A 3CR8A 4INPA 2AQ8A 1NASA 4MI3A 2JGMA 5JSFA 1RXUA 3G13A 4QO8A 1X1RA 2R65A 1FUUA 3NI2A 3QVVA 1ZGCA 2JHGA 3BULA 3LC1O 3MWEB 4K9LA 2QYSA 4B85A 2WJPA 2BLNA 1WL8A 1QHXA 3M9XA 2AN1A 3K8QA 4JSRA 3HCRA 1Q22A 1WULS 2BKXA 4P9NA 3SOZA 2GJKA 2BR5A 4JI2B 1M8KA 1Z6XA 4ZOAA 2LCIA 3VHXA 4HNSA 3FBGA 1XZCA 2D0IA 2Y2VA 4M1OA 4M3NA 1IQRA 4UPEA 1CY0A 4RQTA 2C2GA 2V7QD 4QQRA 3IRUA 5INTA 1ZM7A 3SQWA 3G5UA 3ZDEA 4KPEC 1JEOA 4RJTA 4IXNA 3ORFA 5HSGA 4N8EA 2QTNA 1QDLB 2GI4A 3GLHE 4IXDA 3ZV4A 2Z95A 1ZCBA 2EU8A 3LKZA 3WK6A 1NBMD 5L7TA 2HJ9A 2JFNA 4XM2A 2SNIE 1JFVA 2YFHA 1UBKS 3IESA 4RXTA 4WXEA 5G3YA 5HFNA 1GVHA 4E21A 2CJWA 1OH6A 3WQRA 3DVQX 3NTUA 3QPCA 1O0BA 3EOAI 5IAGA 8AT1A 4WZBA 1W46A 2GA8A 3I8SA 2R7LA 1PF7E 4RWZA 4XASA 4ZO4A 4C06A 4R9UC 5IZCA 4IAOA 1TXGA 2B4QA 1IDN1 5LP6A 1V45E 4UHDA 3BMQB 1CFJA 1UMCA 1LNQA 5FA6A 1H0SA 5DGCA 1EX9A 5A7FA 3NBQA 1FLNA 1JLLA 4C1BA 5TQJA 1ZM2A 2FX5A 3OO0A 2QBYA 2EL9A 4N65A 4XAQA 1DUIA 1N2IA 2E18A 3JW8A 3KYBA 3ZHVA 2DULA 2O6HA 1RRGA 3MRVA 3OHPA 3L0CA 3P32A 4K3VA 2FETA 2RD2A 3HMKA 1EM8A 3QFTA 1S02A 5TS2A 3VU3A 1SBNE 1GT91 2JK1A 4OP2A 1L7MA 2J0SA 1N5LA 1B0UA 4KREA 3OP1A 1IHOA 1YU6A 4OSPA 4BKPA 5BPHA 2Q45A 2VBFA 3WB1A 2JFWA 2D0OB 4H77A 2XCSB 2DKNA 4OHPA 1PYOA 1A8SA 5EIAA 4PVCA 5LQRA 3UMCA 4DLNA 3IUMA 1HT2E 3H9UA 4IIEA 4FBGA 3UJ9A 2ZYGA 2PAAA 3KR2A 4KL8S 4MEBA 1Z39A 4F3NA 5KYYB 2BVNA 2HZ7A 1SQ6A 3P20A 1WZIA 1FUIA 3I01A 2PK3A 5L4LA 3E6AA 1Z33A 4F91B 3BIFA 1EA7A 1JT9A 1DG1G 2X8BA 2JFYA 9LDBA 4GGPA 5JALA 2IYRA 3D31A 5EHQA 3A1NA 5DRTA 4JK3A 3GR6A 4PQFA 4ZEOA 1G19A 5ICMA 3JQ8B 5DK4A 4RELA 1U3CA 1Q0HA 2RH4A 3QYPA 4MLDA 4V0SA 4BNKA 1ZR2A 2B83A 3A6GA 2I7XA 3E82A 5DYTA 1ZJZA 2R00A 2VI5A 3UEOA 4C2BA 1WCWA 1F5SA 3B1JA 5CJ2A 1N34B 2QUBA 4OMCA 3HPQA 1F2TA 1X74A 2VCEA 1VYHA 2I4MA 2VJMB 4BNVA 1JG4A 4QVGA 1WOYA 2C2ZA 1HLPA 2NM0A 3U31A 3KD2A 2WQ6A 4MUBA 1FFYA 1EXNA 1J00A 1A88A 3VZCA 4EG5A 3SIPA 1OFTA 2IXFA 1Y9EA 2QX7A 1L7PA 5JQWA 1NV9A 3M5PA 4FQ7A 3HBFA 2AFRA 3QTLA 4LWOA 2PS9A 1Q3HA 4LRQA 5I4BA 2H1LA 2ZB7A 3GBSA 3OAAD 4KK3A 1PG5A 4GZ6A 4Z99A 3OZUA 3PG5A 1KEVA 2HUNA 3LDHA 4XVHA 4F92B 4Y9SA 3WL8A 1X9HA 5FWAA 2GTIA 3EVGA 4DMGA 4ZCPA 5BR1A 5C1OA 3UPTA 1F7UA 3WMWA 2QN6A 2XTZA 5BQ3A 1THZA 1KOLA 3NYIA 4OL9A 4TLEA 3ZU2A 2V65A 4W7HA 2WWVD 1JSLA 4CQLA 2ROQA 1L5QA 3AR7A 4I55A 1W0JA 4Q3DA 4D57A 1G17A 5ILOA 1YL6A 4HGQA 4AG5A 1RQPA 2W2OA 3K9BA 3IAXA 3VDMA 3KVOA 1UKYA 2VVTA 1SC1A 1Z8FA 3DDNA 2DFTA 3OMXA 2PFSA 1P3Y1 3WIOA 4Z4CA 3L6BA 1I7NA 3GCWA 3TIIA 4I4TB 4D4IA 1PUIA 2ECQA 3CZ9A 5IYZA 1Q1QA 3N39C 5KQPA 3DKKA 3A27A 1QQ5A 1VJDA 1HYEA 1IIRA 1YCGA 4LSMA 4DW8A 4EFMA 1ZVMA 3LC0A 1J8QA 1NNEA 3FPHA 4ENQA 3TRFA 3OEHA 5FWYA 3LVBA 4EF6A 5IT9A 1KAMA 1N32B 5GONA 2AQIA 4O6VA 2ZPAA 3OQPA 4RLSA 5HGJA 3AKYA 3RUDA 1WNFA 1N3LA 4E2XA 4MP6A 5D6OA 1V95A 2AFIB 3H0KA 1YIOA 2GCEA 4HN9A 4JJ8A 4MZXA 4B3IA 3KIPA 1ZJ4A 2QU8A 5TPZD 1E20A 4YJ3A 2YIDA 1A3CA 1XC7A 4G36A 4K6HA 4BFZA 5TX7A 4K2HA 1U1EA 2XE8A 5AM2A 2QT9A 1R4MB 5KC9A 1FMCA 5CW2A 3OPXA 3I0NA 5TF4A 2I66A 1G18A 1FRNA 3M6LA 1R8YA 4G0WA 3TW6A 1YQGA 3I05A 1RCUA 4N3BA 1P7PA 1FPQA 2I6UA 2YWEA 3GJ8A 2RKOA 3ICPA 4GE3A 4MWZA 4CIAA 4WAUA 1L5KA 1C14A 1U1FA 2VUHB 3GEHA 4C21A 5LMUB 1FMTA 1BROA 3AGQA 5A9SB 3UMSA 5KZMB 3VV2A 2IHZA 1ISSA 5JC8A 2HM7A 1J8FA 2G3YA 4E6PA 4EUKA 4RHXA 1U0LA 1R5BA 5DM1A 1X8LA 3ADPA 1P2BA 1T4DA 2JAPA 1ZH2A 4U0JA 2WJVA 2FN9A 4PLGA 5CA1A 3D43A 3OFVA 3ZWPA 4AJLA 1IDOA 1N3YA 1N9ZA 4A92A 3OX2A 4DJJA 4NPHA 1L8LA 4NE7A 1GZVA 1JLSA 3MC1A 1L4KA 1UXJA 3BXOA 3ITNA 1G8HA 4A5OA 1EFCA 5KHAA 4DJDC 4F2HA 1DQRA 1TTQB 2XWQA 1F4PA 1GG9A 3QBJA 4MUAA 4WERA 3FKSD 3C3JA 1PZNA 3CV3A 1WMEA 3FVWA 3KT8A 1YS1X 1K7XB 4G9GA 4IGEA 1XO1A 4L0MA 3DXZA 4OHKA 5AT1A 3CNOA 4H7FA 4TV8A 4L16A 1NP7A 4RA9B 2BN4A 1A2BA 3RR2A 4MR8B 1LSOA 1EK2A 3RU7A 2WPDA 1NULA 1WB5A 2QJRA 3EAFA 4HYQA 3ZK7A 1NXOA 1EXDA 1I3NA 5CFNA 4GQAA 3W8NA 2BGNA 4HYTA 1F8UA 4NWIA 1QQBA 1X3SA 1PJCA 3X2FA 3A1TA 5D3ZA 3JWPA 2WD8A 1X8XA 1RQGA 3BE4A 1FMJA 3FYDA 2W37A 2IYQA 4LEIA 1MC1A 5GM2A 1E2UA 2ZOSA 2WB2A 3JVDA 2HRQA 3OLZA 2RARA 3JD4A 4L27A 5CDUA 4L02A 1J20A 1NLUA 2V96A 4EJSB 5K99A 4I6JA 3UMJA 5F9MA 3ANTA 1UXKA 1Z17A 4BLOA 4ZQEA 1QOPB 1UDBA 2CDAA 1N5IA 3BXFA 1XZQA 2G36A 2WG1A 3H16A 5JNUA 3AUYA 3ZVNA 3THWB 3HKBB 1D8AA 1GTZA 1OLXA 4X7BA 4NXMB 2DE0X 2D6FA 3BA1A 1SIUA 4U5QA 1KO5A 4HADA 4EX6A 3H5RA 3OUUA 1AO0A 3DD1A 5KYXA 1DC4A 1QTIA 2Q4TA 2CXRA 3TQHA 3EULA 4Y2UA 2HRDA 4URXR 4S04A 1ZK3A 3ESAA 1VMAA 1XD2A 2AMJA 2GHTA 5EWJA 3OTHA 3D2BA 2X1LA 4BO9A 3L8EA 7ADHA 3IPXA 4I1PA 4KQ2A 4R1QA 3WLPA 3ESBA 4HAXA 3FTPA 4X7RA 1D2AA 1TC2A 1C4KA 4ND3A 4K2AA 4UDXX 2V1UA 1NATA 3TF5A 1T9ZA 2F3PA 3F6EX 1TO2E 4ZDKA 1MX1A 1K0UA 2ZYDA 3GWZA 2J3DA 3IT0A 2B1JA 4DQKA 4EB6B 4OQMA 1NMQA 2H00A 1Q0RA 4IDDA 2RHOA 2C2WA 4M8SA 1ST3A 2BMJA 1KYYA 2EZUA 2OLKA 2WJHA 2FP3A 3V1TC 2C9ZA 2JFOA 2ZAIA 3FPBA 4M37A 4NX2A 5ITZA 3IL2A 1O08A 5CH8A 4H0CA 1SCJA 4X97A 5LL6P 1GTL1 2J6IA 1PJQA 1OX5A 4DC9A 3F3KA 3QEAZ 5HX7A 5IASA 4WACA 1GUDA 2DJ5A 2WP8J 4AQDA 1KARA 4RTKA 5HUJA 1T0BA 3RAFC 3O8NA 3NNNA 4C01A 4CGYA 4EZBA 5CD9A 2JJYA 3GAZA 3RWOA 5FFMA 3UOAB 5FPKA 1S89A 2R7AA 3PNOA 4O8CA 4D6XA 5AHRA 1OYWA 2DQSA 1L7QA 2H7XA 5KWJA 1XA4A 1P73A 3GFFA 1E2IA 1EQUA 1I0ZA 1RKQA 1E3IA 3FMPB 4ER0A 4JCOA 1TMGE 4G07A 4A8JC 2L42A 3MWGA 1R64A 3V2UA 4FBLA 3ZGVA 5IABA 2XRZA 5B2EA 2EBHX 1FFBA 2HNBA 2ZU6A 2E3JA 1S3FA 3O38A 4ZEWA 3SFZA 3DE1X 3G3EA 2XXAA 4EJ2A 3I5MA 1CUGA 2RCNA 4UVIA 4D2IA 4UFOA 3S7TA 2O2IA 3HKEA 4BB9A 5ENZA 2G1AA 1A8HA 4DMHA 1GPMA 5GZ1A 5DYNA 4U9IS 2B1RA 2CHGA 4R2JA 1TM4E 3WGHA 4X92A 4ANFA 4D9NA 3OC0A 4MV5A 2AK3A 2WU0A 5F5NA 4DLBA 5I01A 3ORSA 4GMHA 1GQQA 2P69A 4IHAA 3CZ4A 4TT3D 1PR4A 1WXEA 1XQ6A 4AS2A 5SZKB 4B4WA 5C4MA 4LC0A 4DBLC 1RZRA 1IN1A 2AJLI 1RAFA 4Y6OA 2HXYA 5TNXA 1PL6A 3FJOA 1XTIA 1FDUA 1U9CA 3AHEA 1USWA 1E7SA 1ZOPA 1D4AA 3GDWA 4MYDA 4WXHA 5T57A 4EG7A 2AN9A 2O4UX 3H3JA 3RRFA 4G5SA 5LD2B 5AYVA 1WHTA 4HDQB 3VHXB 4FX2A 4MAAA 4C2TA 2P4SA 2DKOA 3D1LA 5BN1A 3WL4A 2DT5A 1M7BA 3IMCA 3PZRA 4II2A 5GWXA 4DLUA 3T5CA 5ES3A 1XK6A 1ZUD1 2JFBA 5TEVA 3OM1A 5KSOA 5TJ9A 4KLZA 3RFXA 3N5KA 4JYAB 5B7PA 2QLBA 4AXBA 3FVTA 2R97A 4KAXA 4F5EA 1P4HA 3HNOA 1AQJA 1Z0KA 2XVMA 2XZPA 5IF9A 1AUQA 4WA7A 2ZI6A 1XROA 2CJWB 3AI3A 3FDFA 2H4YA 3PNSA 1WPGA 3C98A 2P2GA 4HWTA 2YY5A 2AQKA 4KPGA 2WSSA 4PGHA 3ZYCA 4AF6A 5GADl 3BWDD 4AMZA 1PFQA 1ILWA 4M1MA 5AK0A 4ZAGA 3JQPA 2OP0A 3NATA 4FYHA 5DWDA 1JA9A 5AP9A 3KQWA 1YDGA 1XQ9A 2IYFA 3JZAA 4QRDA 5K0BA 4W1QA 3P0HA 2CHQA 3OFNA 1S8OA 3HDYA 3MGCA 3VNQA 4B3FX 1HEIA 2X22A 1MDBA 2ZDQA 1SUBA 2BE9A 1J2JA 1UMCB 4K40A 1JQKA 3DMGA 3F5MA 3LPNA 2Y27A 5H9WA 4LF7B 1BCSB 4L28A 4MWDA 3E0XA 5AW6A 2ZJ7A 2BKEA 4WKGA 3RAPR 1DNPA 1H3NA 1IXKA 1PS8A 1K7EB 3DO8A 1NX9A 4Q9HA 5JG7A 3CEAA 3TD2A 2IL1A 5AM4A 4IQFA 2ZJ0A 3CKLA 4M1QA 4D3YA 1IBMB 4J0FA 4KU4A 1ABBA 1AH2A 2FWIA 2UZ3A 2XKAA 3OE7D 1GTJ1 1E32A 1T4CB 4FHFA 2CBGA 2P2YA 4TWBA 3TL6A 5JJBA 2JHCA 4UMDA 1C8LA 1SA0A 2BGKA 1X80A 2R6R1 1N7GA 1YVDA 1XU7A 1C9MA 1OY1A 1WEKA 4IEIA 1JP7A 1WD7A 1GJRA 1ZIPA 4YAOA 1LVHA 5BWCA 4PYJA 4KFSA 3EF0A 1BN7A 1AX9A 1QO7A 2CVFA 1NYTA 3HXLA 1H42A 1UBEA 1NUTA 1YIAA 3G85A 3JYQA 4GVPA 5LQKA 1OD6A 1EJ6A 4TS9A 2ARKA 3WRWA 4JX8A 3HYRA 3IQGX 3HKCB 1R3UA 3PXCX 3FNEA 1JDSA 4TVSA 1RS0A 3CE9A 3F71A 4YV7A 5K3EA 3BMNA 1KP3A 3Q5DA 4A6EA 3WZLA 2ACKA 1Y8RB 4LJSA 1RNLA 4FNMA 3RIMA 2D2IA 1RHJA 2FNAA 5KVQA 1A8UA 1VPEA 3RUEA 4DM4A 4EJFA 2O7QA 5LPNA 3TNJA 2QR3A 4UAUA 4IF6A 5HF8A 2X15A 3U19A 4P3OA 3HB7A 5E3IA 3RHZA 1YKSA 3R6LA 3BWXA 4DNPA 4D0NA 4BFXA 4RTQA 1H8HD 1T5HX 5AFSA 1VJTA 4AKHA 3TOXA 2FLVA 4PC7A 1X1SA 3E7WA 4AG6A 4CI0B 3KFXA 4JUDX 10MHA 3PJRA 2HCFA 2PVCA 3DOOA 4HWSA 3AESB 1T3LA 2BM9A 4J8PA 4IMRA 3NO4A 4CEIA 1O6FA 2FP4A 3S0JA 1HPLA 2OD7A 1T29A 5THQA 3EPPA 5HIJA 5EIBC 1VG1A 5EJ2A 2DWUA 5ICFA 3ZDBA 2XUOA 1Z5ZA 3DL2A 5CLHA 4DIOA 3HU3A 4M99A 3DAPA 5ALVA 4PPFA 1RPZA 1RE1A 1FK8A 2R751 3HJBA 3N5CA 4HDRB 4NU5A 1ZEMA 1ZP6A 3B2EA 4XDGA 3RTGA 4DYHA 3AV3A 2G0AA 2W98A 1YZLA 2SKCA 5ALHA 2JIDA 1Z45A 4JBWA 3I62A 1YS6A 3E84A 4WOCA 5BT8A 1JJFA 3BGSA 5AM1A 1KZ1A 2ZAGA 4ZAWA 3KUUA 4FOSA 2TYSB 3W9BA 2FN3A 4AU1A 4ZCTA 2H07A 4I7EA 1MQAA 4HB2A 4LTMA 1C5KA 2ZIWB 1QH0A 2FMUA 2FWPA 3KTOA 4DLPA 1FXWA 5FBQB 3T9CA 1E1MA 1UAAA 2PSEA 3RC3A 2P67A 4L5AA 3BBLA 2W6MA 1GTG1 4A6XA 1FL9A 5F78A 2QHXA 4MQMA 4I1IA 5FWYB 3IVRA 1PJ3A 5H70A 4JMPA 4PHCA 4PPYA 1IPHA 2BGUA 4BX0A 1BFUA 2CLCX 2HBRA 3FB1A 4FEAA 1YMUA 2C7PA 3BMCA 2RHCA 1IUNA 2AFIA 4AFNA 5BNWA 2PDAA 1G5RA 3M89A 3H8SA 2CXHA 4PS0A 4UTNA 3ZDDA 1ZUNA 2IDJA 3GVCA 4YJ3B 2GD0A 4D9FA 1XU9A 1QQ6A 2V0GA 4KV7A 3RODA 5KMGA 3C3YA 4BKQA 1R4MA 2Z0MA 3CZRA 3M4XA 1P19A 2HR1A 2GBFA 5IJ0A 2FW7A 2JIZD 1LUAA 4JLKA 1U7OA 3T61A 2KHZA 4QYTA 2BR4A 2A78A 3ZCVA 3GLKA 2J3JA 4CDGA 1FYFA 1E3QA 2Z4TA 3TFOA 5FTJA 3N7AA 1G3MA 4CQNA 1M2OB 1I10A 5C4IA 5KIAA 1T10A 1GRRA 1TFUA 4XCXA 3IEMA 3JQGA 1O6BA 4PHTA 3A8TA 3NORA 3PITA 5FI0B 1D6JA 4KKXB 2AOWA 2ZT6A 2HADA 5KINB 4FK8A 2QWXA 1ONBA 2PGIA 2UYOA 3QX7A 3HYTA 5J2UF 4GWGA 4FOPA 5EZYB 2OUIA 4KQIA 4F0JA 1BE8A 5EQDA 1SVNA 3MTGA 1OZAA 4TS1A 4ZO8A 1Z74A 3OQOA 4MHOA 1QG4A 2GBLC 1ISIA 2C98A 2UZ0A 3OJWA 5NULA 3RFTA 4BRZA 4E1BA 3UHAA 2FTKE 4XSVA 4LWPA 5A6SA 4E4YA 1HE1C 4IXMA 5ALNA 4XR4A 1A9ZA 3EUWA 3CH4B 3ZWYA 4AX4A 1JX6A 2GUGA 4KGVA 3DGEC 1NVXQ 1QHFA 4JLJA 2VHVA 1FJ2A 1KY3A 3C70A 1M7GA 1P44A 3DEKA 3OOHA 2OESA 3NXSA 2QAJA 4D41A 1OPXA 3H42B 3T7JA 2RBGA 5B4TA 3X1MA 3CNBA 3BK7A 4S2EA 3WYNA 4E07A 3TW0A 1AUOA 3B6IA 2EZ9A 3FCOA 4RA9A 2Z3WA 2IIVA 2FPKA 1V48A 4KE8A 3GJ7A 1SG6A 1YT5A 2C4KA 5AJYA 1FP4B 3KLPX 1UZLA 3U7QA 4E1VA 4KB5A 4IGAA 5KAPA 2QTMA 1OU0A 4ZDJA 2YRFA 2YBEA 1F9EA 3FLMA 3JPWA 4CF3A 4J3JA 4ETNA 1KOGA 3JXEA 4EMUA 4OOFA 2JH9A 3WGZA 4BGVA 3ROGA 3H04A 2CNNA 2J6BA 3CRZA 3LKBA 4GZLA 1XCPA 1VE1A 4MUEA 5DHFA 3Q2IA 3NNSA 5JMPA 4KXUA 1SN7A 2H3EA 1P17A 4BMCA 1B4DA 2PV0A 3FPEA 1M2FA 1GL7A 1L5GB 3QA3E 1Z7BA 4MPTA 3U4DA 1E1YA 4O59O 1LLFA 3G7SA 2AXNA 5LYJB 4LXGA 1SQSA 1E60A 4PAWA 5GVSA 3THWA 4ARIA 1AHIA 1M2EA 1YACA 4Q3CA 2Z56A 4CDMA 9LDTA 5JQGA 1O3YA 4ZQIA 3EXHC 3MOIA 2QN3A 2C5GA 3MMNA 3BKWA 1O7JA 2PGJA 3PUIA 3DM5A 3RU3A 3UVEA 5MGNA 4RULA 2Q4DA 1JR3E 2FZEA 3CJRA 4IJWA 1XN4A 3PL5A 2HHJA 1V25A 3G8AA 5TQ2A 1OROA 2IZOA 4XWGA 3DA8A 3RU2A 1BE6A 1UBNA 2EHJA 1DKRA 4O2LA 2CKDA 1RJEA 1MO2A 1Z0AA 2QMYA 2BH9A 1FFGA 3F9IA 1QRAA 1M1XB 5FF9A 2WPNA 5AVUA 4KQCA 1L5WA 3DZ8A 2G76A 5E4YA 3QXJA 3RFFA 1WCYA 4LJ8A 2PUWA 2UVDA 4J2HA 3QXXA 4DDUA 3U7IA 5AQ1A 1EQ2A 1U0HC 1GZ3A 5AKJA 5JZBA 3FIUA 3I6IA 3WGJA 4TUYF 3UCXA