1W0YT

Tf7a_3771 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
188
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Selective Phenylglycine Amide Tissue Factor/Factor Viia Inhibitors
pubmed doi rcsb
molecule keywords BLOOD COAGULATION FACTOR VIIA
molecule tags Hydrolase
source organism Homo sapiens
total genus 43
structure length 188
sequence length 205
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0yT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0yT02
3MLVH 1MCPH 1QFUH 1KXQE 5IB4A 1X6LA 2QKIA 1AO7A 3HB3C 5TPWH 4HC1A 4KJWD 1YEGH 4FN0A 2C4FT 1ZT7B 1UA6H 3KPSD 4NCDA 1MWAA 4PJBB 5FCUL 3OX8A 4XCFL 1BAFH 4O2CB 1R5VB 4U1IB 4ZUVA 3ARDA 3MFGB 1PKQA 2BNRE 4HWBA 5TF1H 1JPTH 1QOKA 3WS6C 2QLVB 4JPWL 1MIEL 3GMOA 1IAKB 4JN2B 1TVBB 3TF7C 4TSBH 5DMJB 5E1AA 3UYRH 1BZ9B 4JM2A 3WO4B 3MXVL 3B2VH 3BI9X 3T65B 2X6MA 3VGAC 3QEGL 3R8BB 4MWFA 1CTOA 5J6HA 1MREL 3RTQD 4Y19B 3RRQA 4AENB 2APTA 1JFQH 1N5AA 1LP9A 4QRTA 5T3ZL 3K46A 3L6FB 5GZNC 3BO8A 3MV9A 4NZTH 4LKCA 4XP1H 5T5FL 1KCUL 4BZ2H 4DUXA 1J8HA 1ND0A 2AQ1A 1ZEAH 1XGUA 4WI9A 2CR3A 4GQ9L 1ZT7A 1I9RH 4UQ2B 3MRJB 3VXOA 5J06A 4KHXL 2EKSB 5IHZB 1MI5D 4O2CA 4PLKC 3BQUD 1BOGA 2XN9B 2YPLB 3MV8D 1RJCA 2X4TB 4JO3L 3MOQA 1UB5B 1RQ5A 1V8HA 3RIAF 4OTXH 3FQWB 5JHDD 1S5IH 1NGYA 3GK8L 1MRDL 2BNQB 5C0EB 4FMKA 1CFSB 2VLJD 4OGXH 4X4YA 2PN5A 4MX7A 1FZMA 2DQHL 3OXSA 5I8OH 3OAUH 4ESKA 4EXKA 4QWWC 3T65A 3G6DH 2ITCB 4KXZH 3B9VA 4KWUA 2FSEB 4KVCL 2FBJH 1F90H 3TIEB 1KNOB 4KKLC 1I7RA 3HNVH 4RZCB 4YE4L 1WEJH 3L6FA 3U7AA 3NCJH 4NUGH 1HINL 3CPLA 1PX4A 3M17B 4UTBL 4WI4A 5TQ0H 4HQQH 2H3NA 5I73B 3HAEH 4IRZH 3GSOB 2C1PB 4FTVE 1P4BH 2E27H 3L5IA 5ISZA 4Q9RH 5IHZA 4F58H 5EZLB 2H9GB 1WUNT 3JTSB 4KHTH 2X4TA 4MVBC 4NM8H 4ZQKB 3A6CL 1PG7H 5AAMA 5I1JL 3T0DA 1IARB 2IAMD 2KKQA 4ORGB 4N0YH 4DVBA 3OKKB 4MD0B 2OI9B 4WUUB 2DQUH 1TNNA 5KS9E 3P0GB 1JZ3A 1F3DH 5JUEH 4S1SH 3AREB 2CK2A 2DJSA 2DBLH 5E6YA 3WUWG 1K4DB 5SWZE 1K8DB 1XGRB 3WXVH 2ZUYA 4MCYA 3QULB 3TIEA 5CZXC 1WGOA 3WNOA 1JE6A 4RMSA 1PYWA 4PV9B 4PUBL 2IFFL 3FOLB 3M17A 2VXVL 4L9LB 5FIEA 2ICWI 2BSED 2YHGA 4U6VH 5IHUH 4O9HH 1T2QL 4RMTA 2NCMA 2NR6D 4QRRD 2Y06H 3GSOA 2MMXA 4TPRL 5CEZE 3HC4L 1I9IL 1UEMA 1A3RH 3T1FB 3QDJB 1S7QA 3BKYH 1OLLA 4WHDA 1G0XA 3CFCH 3FRUB 4XNYH 3EJYD 1WIUA 4JFPB 1G9NH 5D2NE 4BA8A 3AM8C 4HF5L 4YHML 5HVGB 3U0WL 4XP5H 3OKKA 2H32H 3DX9A 2AEIT 4JDTH 4WUUA 4P9ML 1NANI 1RJLB 4XNUH 2CPCA 3OJMB 2I25N 2MNUA 3T2PA 3REVB 4YIQB 5CJ5A 2EIZB 3N1FC 4Z78B 5F3BA 3ZDXF 3TFKD 3CDYA 3FO2B 5EO0A 3QDMA 1MFAH 1XGRA 2Q1EA 2ZOLB 1KBGL 3FJTA 1ACYL 1OAQH 5EWIH 5L6YL 1A22B 4NO5B 2BFVH 1ETZA 4DN3L 2IBBA 5K59E 4OIIL 5EZIL 2CLRB 1TCRB 3UTPE 1R3HB 4J3TA 3OKDB 3MCG1 5GGVH 2Z93B 5C08B 1EXUB 4P5MB 1EH9A 1V7NH 4ZAKC 4KKNA 4JDZA 3KPSE 2YD1A 1V5JA 1QQDA 1CIUA 3MLSH 3SE9L 5IVXB 3TZVD 3QDJA 3DX8B 3VD7A 3QRFM 4LCCC 3X3FL 4CVZA 1MCJA 3U30C 4OFVA 5JA9A 4N5EC 4NKQB 5JPMB 4MAYB 1CE1H 2HG5B 1C5DB 4QYOB 2ICEB 2VDRL 3FRPA 1T7YA 1S7WB 1UKTA 3RL1B 2B5IC 4NSKA 2NY0B 3F6LA 1EJOL 5EB9A 1PAMA 2NY7H 3K74B 5GQBA 4J1UA 5ANMA 4OCLC 4D0DB 2EDQA 4F8TA 3MV9E 4YDVB 2ZOLA 3LEXB 1W2KT 3O8XB 5HYJD 1MFCH 1S78C 2DL9A 3L5JA 1V7MH 4XI5C 4NN6C 1EV2E 1H5BA 3LS4H 3UP1A 1KLUA 4MLSA 4LFHD 1IEHA 1R3HA 4HJJH 3JWOC 3OKDA 3QEQD 2COQA 5C08A 3UROR 2DQDH 1MCSA 2XKNA 3LKPA 1Q94B 3PIQB 3BUYB 3GDBA 3P77B 4J6RL 4P5MA 3B8YA 3D69B 2HRLA 4TULL 5D8JL 2L0DA 1H3PH 2V9QA 3PWVA 4LLDB 2FX7L 3MUGB 1MI5E 3BP5A 3UTSD 4Y4KD 2A9NL 4PGZA 3MV8E 3DX8A 1MLCB 3TT1L 4QXGL 1NGWB 4D9RE 1A3LH 4EOWL 4ONOA 5JHDE 1NAKL 2DAVA 1ZT4B 5C07D 4WHYH 4MAYA 4U7KA 3S6CA 3UYOD 1C5DA 1D6VL 3O81A 4F15B 2VLJE 1KOAA 3U82B 3RL1A 1XGTA 3WNLA 1PY9A 4EJ1C 5H2BA 3VI4F 5GRVL 3ZKQD 4ZUWA 2BRQA 1UZ6E 4YDVA 4DGVH 5FYJL 3LEXA 1DLHA 5E1HB 3WYRA 3WFDL 3F62A 4JKMA 4RGMC 1WFTA 1EEYA 1Y0LA 3EDEA 3P4MA 4M7JH 4BSWB 5I75C 3PWUB 2CDGB 3VMOA 1G1CA 3DROA 4JPVL 5D1ZC 1PEZA 5I15H 5ISZE 1JHKL 4P9HC 1G7JB 4PRNA 1A3QA 1N59B 4LHUB 1FAKT 3D69A 3QR2A 2DQJL 4GW4B 1A5FH 2YD3A 1GGCL 2OMBA 3MUGA 4LVHC 2OBGA 1VENA 2VR9A 2DLGA 1IT9L 1MLCA 3DX6B 2VDLH 2FNBA 2WBJB 3QG7H 3TBYB 1BQSA 4BUHA 1DN0B 5DDHB 2VZ1A 3ZKSD 4Z7QE 4PJ7F 3STLB 4H8WC 3C60B 3AXLB 1FV1A 3SE4C 5CFHA 3MJ9L 4OQTH 4PREB 4WV1B 5I1GL 2R9HC 4BFIB 4XNMB 1X7QA 5EO1B 1OAYL 3QJFB 5EC2A 1NC2A 4GMTL 3FFCB 3V6OC 4I3RL 4WHTA 3RIFK 1I7ZB 1Q1JH 1B88A 1C12B 1MJJB 2V17H 4YDKH 3U7YL 3PWUA 2CDGA 2YD7A 1GC1H 4IDJH 4LLAA 1ODAA 4OZHB 1H15A 4P4RB 1G7JA 4L8SB 3ZE2E 4LHUA 4FFVC 4LCYB 5IM7B 2AJVL 7FABL 4ZS6C 5MEND 4XP6L 1N0LA 1KEMH 3SGKA 1QSED 2E9WA 2FEDD 3OKOB 5CSGA 3IJSB 3KYOA 5EOCH 1SY6A 5D5MB 5H8DA 3DX6A 1E6OL 4YGAB 5D1QA 1TTGA 4XXCC 4TNWK 1DJSA 3SKNB 3EOTL 1W0YT 1CYGA 3ILPB 3STLA 5CEZH 5CJ8A 4HWEH 3AXLA 1JJUA 1OSPH 1CLYH 4YHIB 4EIZC 3REWB 4AM0B 4BFIA 4XNMA 5FKPA 1TLKA 1WQVT 3QJFA 4GKZB 1A0QH 2AXGB 5D2LB 1EO7A 1HCVA 4R96B 4TUKH 1Q0XL 4OLYH 3GBMH 3TPUA 2I60L 5JMOC 4ODVH 2P8LB 3ABZA 2EDKA 5TDPB 5DXWA 5CINH 3Q5TA 4EDXB 1QNZH 3WO4C 1I1FA 4UDTB 5DUPL 3LEVL 3PDOB 3MRDA 1NANH 4K2UL 3FT2A 5FM8A 3PHQA 4FQXB 5DVNA 3VXMB 3BKCL 1JGDB 2ZG3A 15C8L 3V5KB 3EOAA 1Q72L 1QBML 2D31B 4QRQB 1SEQH 1J11A 4TUOB 4A6YL 4Z0BL 2AGJH 2GJ6B 3I84A 3IJSA 4GRWE 4OT1L 1EUTA 1A6ZB 4LGRB 1KN4L 4G6AC 2DTMH 4U1JA 1VKXB 4UV4L 3JWDC 2ZOKB 1D5XA 1D5ZB 3U9PH 3GI8L 1T83A 1RD6A 4OLWL 5ANME 2BVQB 4Z77A 2L7JA 4J4PA 5EBWB 3VMNA 1OL0A 3PQYB 4GRMB 2IPTL 4H0HB 4KMTH 3BEVA 2AEPL 4GKZA 2I9LA 5D2LA 4JO2L 3CDGB 2J4WH 1S7SA 4R96A 3VGGA 4OFYA 5ID1B 2EXWC 2FX9L 2HJFB 2PR4H 2VLMD 4OZGB 1A7QL 3U36A 5TDPA 4TQEL 5D1XC 4XNQB 1OTUC 4EDXA 1FGVL 1T2XA 4NT6A 4EKXA 1LD9B 2CKBH 2C7UA 5M94B 3PDOA 3MRCB 1A14H 1VEPA 3OAYK 5GPRA 5C8JB 1GOFA 1QRND 3LMJH 1WFOA 4XBEH 5TDOA 1YEFL 3PWPB 4FQXA 1M7XA 1KN2L 5GGSY 5C92A 5LXGH 3V5KA 2BSSB 2OXHA 3HLAA 1MCWM 2D31A 2OX5A 4GXUM 2HAZA 5HGGS 2EDXA 2BVTA 4O00A 3OAZK 2HMID 1VKXA 3IFOB 2XRAH 5JZ7D 4I8DA 3MV7D 2BMKB 5I73C 4QRPA 3ULUL 3LN9A 4LSVL 1DQJA 1KENH 4HUKB 5KVDH 3WFCH 5EBWA 2HT3D 2QQNL 4GRMA 4HKXB 5IFHH 2X44D 1FLRL 2OI9C 3W5MA 2I07B 3CCHA 1FZKA 3ME0A 3NH7H 4NPYB 5HHNB 4LLYB 4P46B 3UDWA 3AREC 1FFNA 4XNQA 3CZJA 1NBQA 5BOPA 1R0AL 3MRCA 1T4KB 1E4WH 4LSDA 4IBLT 1CZ8L 3UJTH 5FO8A 1RSFA 2BRRH 2PO6D 1CGTA 5IR1A 4FFYL 4L9LC 3TCLB 5KVFL 1VSCA 5EBMA 4LVEA 3T77B 2EE2A 3KDMB 3QAZB 3GRWH 3QFJA 4GOSA 5E00A 4YUEH 1CBVL 2AEWA 3D2UD 5EU4A 3RBSA 1ZHKB 3GSUA 1UH3A 4PRPB 3EJZD 4R0LA 1P6FA 3VFGL 3N06B 3BPNB 3V4PH 3VRJA 1JI1A 3RDTD 4GAYB 4LSRH 5DQDH 4R7DA 2BHZA 3S5LB 5IJVB 4DKFH 4I0PB 3RDTA 1HKLH 1QYGL 3TVMC 4NPYA 1RJYA 4K9EC 3NBNA 1A6TB 3BT2L 5TH2B 1NKRA 5MERA 2V7HA 3O4LD 4M6NL 3D48R 3MCLH 2GTZA 3FHAA 4WUKH 4J3SA 2AV7A 3EGSB 1BBDH 1RZJL 2UZIL 3F12B 4OUUA 4ZTPL 3SKJL 1KG0B 5MENE 5HI3C 2R0WH 1QSEE 4MAUL 4B0MM 1BIHA 1MFBL 3IU4H 3T3ME 5IJKC 3OWEA 3T77A 4LCIH 4WTZG 4PRHA 3KDMA 3MRNA 4NO2B 3HMWH 4X0KB 4OI9A 3CUPB 4LVNB 1FNSL 4MQXD 3O45A 4RFOH 1UJ3A 4NKOA 4KUCF 4NWTH 5ICXB 4E41D 3DV4B 3MUY1 2FEEL 1QHOA 4GAYA 5GGRY 4PTUA 2G9HB 4X7TA 3QB7C 5D7JD 3N85L 4YFLI 1B0WA 3BDBA 2EE3A 3MSPA 2P7TB 4NNPH 4JHWL 2NY0C 5FM5M 3SDAB 3T0VA 5HYIA 3RX8A 4XHQA 3Q3GB 5CIPA 2ZSWA 2YRPA 4LLVB 1J1PH 4ZXBD 4FOMA 4GFTB 2CRYA 3IVKB 1LK2B 3CU1A 5ID0B 4U1GB 2J6EA 3F12A 3EGSA 3O8XC 4X98A 3WFBL 1KG0A 3OTTA 5T1MB 2CLZA 4O5LH 3UX9B 2W9DL 1LO4L 2JCCF 1NAMB 1ZA6B 3HS0A 1ZLWK 4CU8A 3HB3D 3VJ6A 2OTWA 4N8VA 2R2HA 1YEKL 4JKPL 4X0KA 1JNLH 1F4HA 4E5XB 2F54B 3DIFA 1T1ZA 4MNGE 4NKDB 5E8OA 2AK4B 3JTTA 3PHSA 3T8XA 4ODXB 4GRWH 3SDYL 3C09B 3MLZH 4HAGA 5ITFA 3W82A 2C3WA 4G3YH 2G9HA 4P3CL 1T5WB 4F15C 4FQPA 2MQ3A 2MHAB 5DJZA 4X6DB 2P7TA 4WY7H 4MQSB 2D4FA 3HR6A 2P8MB 2F53D 4PJIE 2DLHA 1GRWA 3B9KB 1QRNE 1WTLA 4P23B 3S37X 5C0IB 4ZYKA 5JPNB 2GT9B 1N0XL 4NC1C 1BZ7A 1T89A 5F8RC 3WFHA 1SHMA 2B1HH 5T1MA 5C71A 1H8SA 1Q9LB 2NY3B 4QRPE 3L1OH 5GZND 1MAMH 1NAMA 2G5RA 5DVLA 1WWCA 2ZPKL 1UWEL 5IB1B 4C83B 5B39G 2FR4B 2PYED 3MV7E 1QSFB 1JWMB 5GRVK 2DLFH 4Z9KB 3U79A 3AU1B 1XCTA 2BOBB 1KPVB 2VL5B 4JKWA 1F6LL 4OCRH 5DK0A 2F54A 2VIRB 3RWCA 4YR6A 2O5XL 5IHBA 5KSAA 1YZZA 1KFAL 1S7RB 1X5YA 4MJ6B 4PLKD 4OGYH 4MD5A 2B1AH 2R8SL 5CBEA 2WBJC 2LFGA 3MLXL 2GHWB 1PJ9A 3I75B 4HUVA 1FH5H 2DQIH 4G6FB 1BEYH 3T09A 1QR4A 5J4MA 5CD3B 3C60C 4OZ4A 5BV7B 2QR0A 3T0EC 3L5XH 4WV1C 1K6QL 1CR9L 5HGAB 1IGCH 1MJUH 4H88H 4QWWD 4DKAA 4OD1L 4NQXA 5JPNA 3INUH 1SJEB 2FH8A 3VGFA 4KROB 3OR6A 1H3WM 1FIEA 3Q6GL 4KKLD 2IPKB 5KSVA 4XPBH 2HFFB 4XVSL 3WIIL 3QT2A 5IB1A 3ET9F 4P2OB 4NP4H 4X6CB 2Z31C 4PGCB 2UUDH 4ETQB 5SWSA 1JWMA 4EVNA 4L8SC 1P2CB 3AU1A 2BOBA 3DBXB 4Y16B 1V3KA 3GNML 3H3KA 5I30L 2VIRA 4F57H 1JV5B 2CJUH 4PY7B 4Q9BA 3VWJC 3BWAA 5JIHA 5J56B 3PP3H 1S7RA 4AEIH 1DFBL 4MVBD 4LBEB 5CZVH 3TT3L 4NCC2 1OM3L 2BVOA 3IF1B 3ZYJA 3MO1B 3BKMH 3N1GC 5DEGA 5IIEB 4HS8L 5GISH 5INDB 4G7VL 1KELL 2V5SA 1KCSL 2M2DA 1X9QA 4XP9L 5HGAA 3QHZL 3MNZA 1IC5H 1LK3H 1SJEA 1ZLSH 4Y4HA 1O5DT 1IGYA 3C2AH 4X5WB 5KS9F 5CZXD 3ROLB 3I3BA 2DMKA 2IPKA 3HNSL 5E8EB 4FZ8L 1DBML 3QG6B 5DD1L 5JXAH 1TTUA 5B8CC 1VFMA 1NCDL 2YKLH 3UPCA 4P2OA 1SBBA 1NCWH 3O3DB 2BC4A 1JGUL 4J3XA 2D4DA 4Y16A 1SY6H 4X6BB 1N7ML 3HMXH 4E41E 2A9MH 2IBGA 1EGJA 3O6LL 5DURB 3L3KA 5C0NC 5C1MB 3BMWA 4LBEA 4OZFB 1OPGH 2YPKB 4OKVB 3R8QA 3T0XA 2EH7H 5IIEA 3T04D 3BN9C 5FOJA 3GMLB 5KSBA 2W1NA 3IJYA 4FQHB 3BEWB 4J2XA 5DR5L 1I8MB 4XMKH 1FE8L 1ZV5A 5DF0A 3CSGA 1MRCH 3FMGH 1J5OH 3BOVA 3GSNB 1T1WB 1MCWW 1OLZA 1S9XB 3K2UH 4G9DA 1BGXH 2HH0L 3ROLA 3LRGA 3QG6A 1KJ3L 4KQ4H 2V2XA 4PRIB 1WAAE 1VACA 5J9PB 4LLQB 1G7MB 3KLAA 1P84J 3BHBA 3WSQL 5IB2A 1PSKL 3O3DA 4LPCA 2WP3O 1CD1B 4KTDL 5KZCB 1Z3GH 3VH8G 4YH6A 4ZAKD 1I85A 4S0SD 3QO0B 4AEEA 2N4IA 4X6BA 5CJOH 3VFPA 2NTSP 2FATH 1DBAH 2JTDA 4FXGA 3LQZB 4JFEB 5D6CB 5ESQB 5K59F 3DV6B 4JM4H 4UU9A 1CLCA 2V6HA 4PJEB 4RNRB 3P30L 4N5ED 3WKML 3W9DA 3HZVB 4X9FA 2QSQA 3SDXE 3GUTB 4NNXB 3MGTA 3VXRD 4U1SB 1X5XA 4DTGH 5C0CD 4M4RA 1I7UB 2A73B 4OJFL 4YHPB 3DO7A 3BEWA 1I8MA 1CU4L 3RVTC 3L3IB 3NIDE 1KEGH 5CS7A 4EUPB 3BP4B 1WISA 4PY8J 1QR1B 3DRTA 3UO1H 5I16A 1T1WA 3KPMA 4FFZL 4MA7L 2EYRB 1S78D 1GGBH 1T22A 4P46C 4PTTA 5J1AB 4XI5D 3HAEG 4M43L 4MNQD 3ZSTA 5K9QG 4P49A 4LLQA 1G7MA 3ES6B 4HWNA 5I1EH 2BERA 5ICYA 2ATPA 3BAEH 3GMMA 5KW9L 4OM1H 3WXWH 3QWQB 5FECB 1HHHB 1FO0L 1NEUA 3N1PC 3OKYA 4NC0B 1U3ZA 3AAZA 4U6TA 2ZSVB 2YSSB 4UT6H 1GIGH 3PF2A 1OWRM 4NBZB 3V8CA 3DV6A 4DQOH 4R3SB 2FWOA 1OAZH 4PJEA 4X6FA 1BD2D 3HZVA 4NZUL 1INEH 1D5BA 3BGAA 1S8DA 1I7UA 4YHPA 1QO3A 4J23A 4LRIC 5DD5L 4UT7H 2J7LA 3KPTA 4TNVF 4EUPA 2BY3A 3BP4A 1M05B 3CFBA 5F9DC 1QR1A 1NMAL 4I0PC 3FL7A 3EBAA 2EYRA 2XI9A 3QCVH 5SWSE 3RJQB 5HDBE 3QO1A 4XPFL 1HXYA 3NZ8B 5TQ2L 1UM5H 5BOZG 3MV01 5E6IB 5D1ZD 4IRSB 4DN4H 3N0PB 1H0DA 4JGMA 1RU9H 1UZ6F 5JIKA 4ZFOL 3RNQB 1ZAGA 3R1GH 3TN0B 3OV6A 4P2QB 3DSFL 2ZZUT 2E8ZA 2NMSA 3NN8B 1LO0H 1QFWM 4UNVA 2HLAA 1FN4A 2C3GA 1IL1A 4R3SA 1OAUL 1QFWH 4B41A 3RUGE 4YK4C 2R0LH 3L5WB 5IVNA 3EW3B 5FM5O 4JB9H 2FJFA 2RBLA 3SGJA 1NEZB 2R9HD 1S7XB 3MLRH 3LZFL 1M05A 1A47A 2KH2B 1UCBL 5F3HB 3FT3B 5GRXG 5JW3H 1WFUA 1Y6MR 4Z7QF 3SDAC 3G6AB 4K8RL 2R39A 4M03A 3MXWH 1VGKA 4ZFZB 4XWOC 3S34H 3QIWB 1UVQB 5I1CL 4FFVD 1RZGA 3GBNH 3RNQA 4ZS6D 2O93L 4N0UE 3CX5K 4P2QA 4WO4A 1U3JA 1GXEA 4D0BA 2VLRD 4AMKL 4L4TB 5B21A 5F1OB 3G6JE 1G9MC 4CUCA 3I9GH 5KSBE 5BW7C 4DUVA 1HQRB 5IVZB 1WC7B 4LARL 1P7QD 3NPZB 3ZE2F 4U49A 2YC1A 2GY5A 3VD3A 4N1EA 5L8LB 4NKMB 4Q2ZB 1I4FB 3SGEH 1KLGB 1NEZA 3C09C 5B22A 1JNJA 4XP4L 1PY4A 3CK0H 4OM0H 4RA0C 3BH9B 1T03L 5DHVA 1OCWH 2HRPL 4PPTA 5KANI 1X5AA 3FT3A 4NM4H 2Y25A 2YN5A 4X4MA 3DVGA 2CGRH 2C3VB 1RIVL 2J1KA 5EFIA 3EYFB 1P7KA 3B9KC 2FCBA 3VFWA 1OAKH 4P23C 4HS6B 4Y19D 4EI5B 2XTJB 1T20B 3WE6B 2QEJA 1XF5B 2D3VA 3RGVB 2NY3C 4WHYG 4I3SL 1M7IA 3O2VH 5I0ZA 3KJ6L 2OJEA 4D9LL 4WFFD 1MIML 2APVA 4DFHA 4G6AD 4HUXB 5IMOB 4H20H 4RGNE 2QV2A 5T1KB 4PP2A 5DWUH 3CLEL 2Y5TA 4M02A 1CVSC 4JPIA 2EDWA 3NA4A 1HQRA 5JQ6L 3VXRE 5C0CE 3GHBL 1J18A 2FECI 4JCLA 4F80A 4Z8FL 4HK0B 3MJ8A 4RBPK 4NKMA 1I4FA 1WBYA 2XN9D 2YPLD 3GSRA 1BQHA 2XNAA 4UMGA 3PNWB 4GRWF 3RY4A 1EFXA 3LKSB 3WN5A 5CUSL 1ORSB 2P45B 3BH9A 2XA8L 2G2RB 3CH1A 1AGBB 1S7TB 2EXWD 2BNQD 4P59L 3DGCR 1E28B 2ZCLH 2GKIA 4FP8L 5I8KH 5BV7C 1FFOA 3CSYB 2X1OA 4MNQE 5D1XD 2PW2B 3RZWA 1KSRA 1OTUD 2C3VA 2NY1B 5C0BD 2NZIA 1T80A 3SQOL 1FPTL 2Q3ZA 4FA8A 4KZEH 5I66B 4NIKB 4I4WB 3OMZA 5DD6B 1L7TL 1ZHLB 1IM3B 4HS6A 1T20A 3VGHA 3L7FB 2PCPB 2JIXD 5DTFA 3TYFB 3RGVA 4PJ5A 1NUDA 4HULB 3VRLE 4GAGL 5EOQH 5J1TC 3I02A 5BQ7B 4HMCA 4E0RA 2VO5A 1BD2E 3BZFB 2PXYA 5IFJA 2BVPB 2Z4QB 4Y16C 4LDLB 1F13A 1VDGA 1KC5H 3OJDB 4U1KA 3AY4A 2L4OA 1JPFA 2FD6H 1QFUL 5I19H 2RFXB 2OMNA 1AGFB 5TPWL 1TQCB 2G2RA 2WW8A 3VFNB 3DVIA 1SVCP 2FO4A 1AGCB 1UA6L 3LN4B 2WINA 4XGZB 1VB9A 4Z76B 3HZKA 5CAYB 2D7QA 1DLFH 3P9LA 3ARED 2PW2A 1BAFL 1L7IH 3HZMA 4MHHI 4CVXB 2AV1B 5I66A 5IWLC 4I4WA 4C4KO 1RZ8B 5TDNB 2EYTB 3E2HB 1JPTL 4PJCE 3IDGB 5DD6A 4F7CB 4L9DA 5LKNA 5BZDA 5IOPB 1FYTB 2AKRB 4TSBL 5EPMB 2WP3T 1Z0NA 1IBGH 2V5TA 3UYRL 4F3FA 3MGOB 2ZJSH 1OGAB 3QUXA 3JV4A 1C5CH 4JAMA 3BDXA 5CWSB 3O6FB 4MD4B 3IXTA 5M95B 3D25A 5K9OA 1OF2B 3KPOB 2Z4QA 5C2BH 4N9GB 1MQ8A 1JFQL 4I9WD 4H25B 3HFML 1LEIA 2W0FB 2VN4A 4NZTL 4S1RH 4XP1L 2D2OA 5DD3H 3EFFA 1LO3H 4XBGB 4CKVX 1AGFA 3V6OE 4UQ3B 1ZEAL 2F8OA 4K55A 3TVMD 1SBSH 3H3BC 1AGCA 2XWBB 2VWEC 1I9RL 1SQ2N 4Z76A 2BNUB 1RUKH 3GM0A 4L1HA 5A2LH 1X5FA 1FNLA 3TV3H 5ESAB 3VD4A 4U1MB 4UILL 1HILB 4XTRC 3C6SB 2EYTA 3VFSB 4F7CA 3FQXB 4PJFE 1FG2B 1S5IL 1U93B 3BGMA 5F1IA 1I9EA 2VDQH 5B3JE 3OJVC 3LAFA 1CFTA 5HI3D 1JZ7A 1OSZB 1UXSA 3QA3B 1Z9SA 4OGXL 3MGOA 2X1PA 3ARXA 2VLRE 2JJUA 2ILLA 1X5JA 3OAUL 1U8OB 5C09B 3HG1B 2R23A 3N9GH 3IU3A 3G6DL 3O6FA 2R1YB 5GSRB 2X1QA 1FQ9C 1YUHB 2FBJL 1F90L 4PJBE 1I1CA 3P0YH 1I8LA 3HNVL 1XGQB 3E1F1 1YEHH 2X41A 1WEJL 1CTNA 3A6OA 2BSRB 3NCJL 4NUGL 3SE3C 2UWEB 3ECBA 4OBSA 4X4ME 3T3MF 5TQ0L 4HQQL 4ZNEA 4IRZL 5LBSH 3MBXH 5D7IA 3X11B 1P4BL 2NY0D 4Q9RL 3ELAT 2QQLH 5ESAA 4F58L 4NM8L 4U1MA 1RHHA 1G7PB 5E9DB 1HILA 1PG7L 3C6SA 4N0YL 1U93A 3O8XD 5EZJB 3D5OF 4ONGH 3QIBB 4HXBH 5JUEL 2A2QT 5A2IH 3HR5B 4S1SL 1U6AH 4LCWB 4OCSL 4WFFE 4F7EB 2NXZB 2OL3H 4U1HA 1U8OA 3X3GL 5C09A 3HG1A 2DBLL 4CGTA 1O7VA 2R1YA 5GSRA 4POYA 3WXVL 3BGFB 4HX1B 1LEGB 4LDOB 3G04B 4A6YB 2AJXH 3FQUA 1XGQA 2GJZB 4LNRA 5I2IB 1KV3A 2AK1H 1CICB 1Z9MA 3QHFH 1T1XB 2DKSA 1HNGA 4U6VL 4L8DA 2UWEA 3NIGE 1LILA 3MREB 4K3GA 1ZTXH 4O9HL 1U95A 4QHKJ 2BNQE 5FYKU 1N6QH 2DMCA 4BK4A 2Y06L 2XWTB 5KN5B 3X11A 4XCNB 1A3RL 5C0BE 3BKYL 1T6WA 5JOFB 5I1KH 3CFCL 3KPLB 1G9NL 2JELH 3RWEA 1G7PA 1I9JH 2DLIA 5JIPA 4PJ5E 1LNUA 4XP5L 1BLNB 5F7WC 1TJHH 2XTLA 5EUOB 3WV0A 4XNUL 4MDIB 1URLA 2W0KA 3QIBA 1F6AB 3GJEA 35C8L 3HR5A 3LB6C 4LCWA 2FDBP 4HT1H 1DR9A 7CGTA 1QPXA 4MZ3A 2APBA 5F44A 2YMXH 3KNBA 5E6IC 4PJIF 2DQFB 4IRSC 4KKBC 1YN6A 4L5FH 3SCMB 3WEXB 4S1QL 4HX1A 5I8CB 2XZZA 1LEGA 3G04A 3TN0C 1OAQL 3BE1L 3F7VB 4Y2DB 5EWIL 2A83B 2W65B 2AS5M 2GJZA 2F58H 2BFVL 4NN5C 1P1ZB 5GIRA 1FNHA 3U2SA 4G8IB 3WNNA 4HFWB 1CICA 2BOCB 3BJLA 3RU8H 1FAIH 4M1GH 1CQKA 2DB8A 2WBJD 3MREA 5GGVL 4JGUA 4PG9A 3OXRA 3KR3L 4U6HB 3CVHH 3F6IA 3WUWB 1REIA 1GZQA 3C60D 5DI8A 1A7NL 3T0ED 1OHQA 2CDEA 3H42H 3FO0H 3F7PC 1KIRB 3VFOB 4XPTH 3FFCD 1G7QA 1BLNA 3MX0A 3SDDB 1CE1L 5MI0B 1BMGA 4WW2B 1KIPB 4AEHH 1P9MC 3MRQA 5IKCA 2GK2A 4RMUA 1UC6A 3Q1SH 2AJUH 4RGOH 2Z31D 3QIWC 3U46B 5FA4A 3VMPA 1KUMA 4ERSH 1HDMB 1IGIH 3SCMA 3VCLB 3WEXA 4FQQB 3I3DA 4I9WE 2ITDA 4MJIA 1MFCL 4MA3B 4QO1A 1V7ML 3C08H 4Y2DA 4JFDA 1J05A 3MLWH 1JUFA 3VWJD 1P1ZA 1TJGH 3A67H 4G8IA 4HFWA 5DMKA 4Z7VA 3OF6A 4P5KB 4NYLB 4OLEA 1QP1A 4HJJL 3NZHH 1W72A 2RR3A 2ATKB 1SJXA 2DWEA 4NBXB 4U6HA 4XBPB 1H3PL 3WUWA 3DMMB 3E0GA 4H8WH 3GO1L 1KB5L 5E7BA 4Y4FA 1HYSC 3FT4B 1T7ZA 3CFJA 5DJ6B 4TSAL 2K3TA 1A3LL 5HHQB 4Y5VC 2HYMA 1MY5A 3LS5L 3KGRA 3FCTB 4ZOBA 4K23H 4GRLB 1YDPA 3VFRB 1ZA3B 1F02I 3ARWA 1GH7A 1S9YA 3QWOB 1ZHNB 4Z7UB 3W0WD 5M7QA 4NHCH 2DQTH 3SY0B 2VLLB 3V0VB 1FJ1A 1QSVA 4M8QA 5DT1H 2WANA 3W0WA 4PJHA 1FP5A 2XTJC 3VXMD 4DGVL 3FRPG 4EI5C 1J9CT 4O4YH 3OR7B 3CFDA 4NQCB 4JKLA 4FFWC 5EUKB 2P5EA 5IVXE 2NLJB 2AERT 1FSKB 2X4UA 2GJ6D 4M7JL 4O2EA 5C0ND 3WCYA 4WI8A 3THMH 4NYLA 3GB7A 1VEMA 5D7IE 2V2TB 4P4KB 3H6JA 5FYLL 1KPUB 5I15L 2X40A 2ATKA 3WHXB 1R24B 3LQMA 5E08H 3PGDA 4CMHB 4IMKA 3BN9D 3EO1A 4JQXC 3G08A 3DI2B 5DC4B 2VZTA 1A5FL 1TZHA 1DE4A 1CGSH 3CAFA 3PQYD 5DZNA 5IG7B 2VISA 1T2JA 2VDLL 2E9BA 3QG7L 2N1KA 3L7EA 5F7EH 4C4KT 2B2XH 2FHBA 3QDGB 4ZUUB 5CSBA 3WD5H 3QWOA 1QBBA 1ZHNA 1CXFA 2NY1C 1HHJB 5CBAA 2VLLA 3V0VA 4OQTL 1PFCA 2OR9H 4PY8I 1SEBA 4Y5XC 4ZD3H 3IRPX 3PWPD 1I7TA 1PW3A 2Y5EA 4YHKL 5EO9A 3GMNB 3OR7A 3V8OA 1Q1JL 1P69B 2H26A 2NLJA 4KPHH 2V17L 4YDKL 1XFPA 4BFEA 3X12B 3JWDH 1GC1L 4X5XA 1WAAF 3CZFB 4IDJL 5JTWA 3EYOB 3U4EA 5IW6B 5HDLA 5IESH 3LIZH 4HBCH 1KEML 3UPRB 4CU7A 5EOCL 1J1XL 2ADJA 3RVTD 3QI9A 1UWXK 5GGSA 4NC1E 1TQCC 4XPAH 3PGCA 3RPIB 1M71B 1IMHC 1NCBH 32C2B 4JREB 3BPLC 4RMQA 1BFOA 2NYYC 4J12A 5CEZL 4OCMC 3SDXF 1GPOH 4PBVC 1OSPL 1CLYL 1HHJA 4S11A 3RVXC 3UJIL 4IJ3B 1XGPA 3QNXB 4OLXH 1A0QL 3NIDF 5DO2C 3RWFB 1EEQA 1OD9A 2AXJA 4OLYL 3GBML 4ODVL 3QH3B 5DEZA 1NC4A 5CINL 1QNZL 3S88H 3SDCA 3ILQC 4KMQA 3U1SH 3X12A 3O4OB 3FB8A 4KAQH 1MAKA 2NNAB 1KYOK 3LSOA 2ESVB 3ARTA 2ZUQC 3EYOA 4PGJA 4PRPD 1HSBA 4DAGH 4I18B 4X8JA 4AH2B 5ADOH 4HC1L 2YWYA 1AY1H 3T0EE 5K33A 4BUGA 2AGJL 4U6YB 3UPRA 2DTML 5T1DL 2DKUA 3FFCE 4M7LT 5K9JH 5EIVA 5FAAA 3MLUL 1C08B 4I0PD 5E5MA 2VYRE 2WSKA 3M8OH 4PJGE 5LWYH 4PD4K 3SN6N 3NGBB 3U6RB 5KTEH 5C0JA 3KPNA 5HHVH 1BJMA 1JWUB 5DHYA 5BXFA 2JB5L 4K7PY 3DVNA 3LKOB 3V0WH 4MSWB 1YNTA 3EOYG 1FZJB 1VHPA 4HFUL 1KJ2H 4G9FA 1BF8A 5HI5C 4Z7VE 2AJZA 3F58L 1NMBH 1YPZB 2PR4L 1NBYA 2Q76B 2VC2H 4NJAL 1U0QA 2VXQH 3CD4A 3C5JB 3VG9B 3RL2A 5GGRB 4HZAA 1R3LB 5D5ME 3TO4B 2CKBL 5HDBF 2R29H 1A14L 4P2RB 4IOIB 3LMJL 5DJ8A 2H45A 1P53A 4HUWB 2ESVA 2XKSA 3VFMA 3I50H 3TC9A 3AROA 1NFDA 4PJAE 5LXGL 4I18A 3MACH 3EO0A 2X1WL 1EO5A 5JXEA 4OFKA 4R8WH 2XQYK 3TJHC 2XRAL 1KT2B 4X9IA 4NRYA 4JZNB 3CLFH 3RVWC 1K5NB 3CVIL 3DHMA 1LO5B 1BFVH 1J8KA 3RUGF 5D6DA 1H3UA 3W0WE 4PJHE 5B3NA 3CDFA 3SDAD 5IGXH 1C16B 1JPGB 1QFOA 5KVDL 3VA2C 4XPHH 3WJLA 3PGFL 3QUZB 2W60A 3B6SB 2DMBA 3LKOA 3NCYS 4DW2L 2P5EE 1JK8B 3DWTA 4QHNB 4XWOD 5E2JA 3HRZB 4JG1H 4WCYL 3NH7L 4GW5B 1RY7B 4PRAB 3DYOA 2J8OA 4HWZB 5GGRA 2NXZC 5HYQB 1E4WL 1DQDL 2HWZH 4RWHA 3BGFC 3ARVA 4ZFFB 4G6JH 3S8WA 4X99A 3QQ3A 1QLFA 3WDIA 5FDWB 2A6KA 2AK4D 2BRRL 1HYRC 1NGZA 3KPQB 1JPSH 2XACC 1T66C 1UEYA 3C6LC 3QSKB 1KT2A 1JZ5A 2VDMH 3G6JF 3GRWL 4JFFD 5F7NC 1MHEB 4YUEL 5KSBF 1CFNB 4OZGE 4KDTA 5H94A 3T0WA 3V4PL 3B9KD 3K3QA 2VABB 4LSRL 4P23D 4F37F 2X9XA 3V9FA 4QHNA 3PWPE 2AXFA 5JA8B 3HRZA 3STBA 4DKFL 1HKLL 3ARYA 1A6UH 4HH8A 4JN1H 2FEEI 4HMDA 2NY3D 3FQTB 1MEXL 2MJWA 2NY2B 1GGIH 2AABH 5H37H 4ODSL 5HYQA 2Z0BA 1QSFD 3MCLL 5BO1H 4WUKL 4ZFFA 1BBDL 1QVOB 4D8PA 3IFNH 3PWLB 4MQ7A 3RZCB 2R0WL 1J7VR 1XIWA 4Y5YC 2P48B 4PV8B 3IU4L 5GS1B 4ZUTB 3ARBA 4NFBA 4N8PA 1DBBH 2I24N 4LCIL 1AFVH 3HMWL 4FXKA 1MHEA 4G6FD 1RFDH 1U8PA 2FJGB 4EBQL 4RFOL 5A43C 4NWTL 2CH8A 1MCRA 5BS0B 4OI8A 3P0VH 1WV7T 4X6EB 4A2LA 4RQQA 4KGJA 4LCUA 4M5ZH 3V2AR 3SDDC 1B4JH 4LRNL 3L3JB 5MI0C 4WW2C 3K7UA 5ENWA 3ARFB 5GGTA 4CAGA 4NNPL 4FABH 1D9KA 4ELKA 3B3IB 2AI0H 5B4MC 4ORZC 3VXTB 5IMKB 4I48B 4LDEB 4QRUB 3MNVB 1FO0B 2QQKH 4CVWA 2WLZA 3HRPA 3MYJB 3ZMRA 1DANT 3DGGB 1CFVH 1WF5A 1QVOA 2VJXA 4AJ0A 2CRMA 3B9DA 4KVNH 5A16A 4FQ2H 1IKNC 3K8MA 5DEFA 4O5LL 4Q6YA 4YWGL 4GSDH 1K3ZA 1CS6A 4GXVH 4AG4L 2VITA 4UUJB 3AVEA 1NGQL 1JNLL 4LSUH 4D3CL 1UM4L 3JV6B 1LDSA 4HPYL 5F6IB 3DMMC 3EDDA 5HYFA 2PW1A 5BS0A 4XH2A 1HWGB 2YXMA 1KCRL 1K3IA 1I1AB 1U8JA 2OCFD 2C4FU 4LP5A 2VLKD 3TLRA 4OF5A 4TTDC 4G3YL 4XRCA 4NRXA 4WHCA 3HC3L 1U91A 3L3JA 4GRLC 5T33H 4PGEB 1PD6A 3RWIB 3FO9B 3MRPB 4WI2A 1HH9A 2YPVH 1Z0MA 2VQ1A 1RZJC 1I3RB 3HE6B 1IAIM 4QRUA 1GGTA 1FO0A 1N5YH 2ED8A 5ALCH 2D7MA 1U8QB 3EDJA 1IAIH 2XYCA 1JRHI 3VDCA 4PJCF 4IRJC 4Q97A 2B1HL 3PP4H 1W72H 3GHEL 1FSKC 4OLVH 3L1OL 5DURD 3GJFB 1ZWIB 3MJ7A 5J0BA 1KJMB 3TA3A 3MRHA 3MRBB 1CDIA 1NBZB 4P4KC 3Q6FB 5CHNB 4UUJA 4X9BA 3VD5A 5E4IA 4CMHC 4EEEA 4OCRL 4F9PA 4CMMB 1MSPA 2H6PB 3SEPA 1KTKE 5F6HJ 4OLUH 4JKKA 1T21B 3QQNA 1E27B 4OGYL 2XT1B 3PHOB 2B1AL 3C5ZB 2IMNA 4N8VG 4XTRD 4ZS7H 3IDYB 3ARQA 3V5DB 1FH5L 2DQIL 5FUOH 1FFQA 3BW9B 4PGEA 3FO9A 3MRPA 1YMHA 3T4AB 5EZOL 4PRID 2FB4H 3L5XL 3QXAA 1BQLH 2V9TA 4ZDHB 2IADB 1IGCL 1MJUL 4H88L 3NTCH 3HE6A 4TRPH 2VXSH 3INUL 1UACH 4P5TA 1P5VA 5F7FA 5KZCD 3LKNB 2A74A 4ZFOA 1FBIH 4FZEH 4PJFF 3DETC 5AAWA 1HZHH 4XPBL 1ZVSB 5B3JF 2PTTB 1HHKA 4JFED 4RAUA 1U36A 3TIDB 3MRBA 4NP4L 1YNKH 1A9EB 3NFPB 4JFFE 1TFHA 1JHLL 4U1LB 4KQ3H 5TJWK 3O2WH 1NCTA 3IAGC 4X6DE 4CMMA 2IJ0C 4F57L 4KTEH 2CJUL 3NCBB 1G0DA 4M5YH 4PJBF 1QPPA 5F7UA 1T21A 3C5SB 2EO9A 4AEIL 3ULVL 1MJ7L 3LN5B 5MEOA 4PJ7B 4QHKI 2YOCA 4QTHA 4JREC 3G9VA 3VG0H 1Q9KB 3BKML 1RZKH 2GSGA 5GISL 4WNQA 5B39B 3GSXA 2VAAB 1FL3B 4MXQC 3R4DA 2AJYL 5DC9B 3BVNB 2IADA 3WNPA 3UBXI 3BP7B 1IC5L 1LK3L 4H26A 5T3ZD 2DKMA 3C2AL 1JTOA 4ENEC 4K07A 3D3VB 4NDMB 3FB6B 5TFSH 3OB8A 4APQC 3F7RA 4WW1A 3C9NB 5JXAL 3B5HA 1UG9A 3O4OC 1T1YB 4HGKC 1NFIB 3TIDA 4RMVA 2IANA 1JNHB 3V4VH 1NCWL 4HIEA 3F7QA 3NFPA 5KAQF 5ICZB 5EORH 3ZE0E 5HPOA 4NUJA 2Y9RT 2PETA 2KZWA 3D0VA 1SY6L 1G6RA 4YNYB 3HMXL 4WTXA 4KRLB 2NW2A 3SJVA 4NO3B 5EBLA 5FK9A 2MWCA 3E6FB 3RX5A 1BX2A 5F96H 1NPUA 5I6XB 4PJ7A 2W0LA 1OPGL 5CGMA 3BKJH 1NUFA 3JBG7 3NIGF 2EH7L 1AH1A 5FO7B 3NGBC 1HI6B 4R2GB 5DSCA 3LB6D 1FL3A 3V7AE 4WFHD 5L2KB 4XMKL 4C56A 1VADA 1MRCL 1TETH 3FMGL 5E6ID 1J5OL 1HOCB 3E3QE 4XHJC 4IRSD 4KKBD 1FLTX 1E6JH 2AJ3B 5IBUG 3AC0A 3GKZA 4QT5A 1BGXL 3TN0D 3FKUS 3FB6A 3VG9C 1IC4H 4KQ4L 5D7LB 1RK0A 4RISH 3TO4C 1MCDA 2G5BA 1T1YA 4O2FB 1GVIA 2BHYA 4YHOL 2GSIA 1F4XH 1G7LA 5ICZA 3G5ZB 3TH3T 4U7SA 4J8RB 1YQ2A 3QZWG 4JVPA 3LHPH 3S37L 4YPGB 1Z6JT 3E6FA 3FB5A 2VLKE 2VKWA 1J1OL 4ONFH 5F9WC 1MUJB 3RFZC 2DYPB 5IV2A 4QOKD 1A7RL 4I2XB 3NOIA 4DTGL 1Y18A 3H3PH 2W91A 4MNHB 4IS6B 4ZPVB 3TJEH 5L2KA 1OW0C 3QUZC 4QOKA 1KEGL 5DJCB 3MLTB 3HI6H 3QIWD 4R97B 3UO1L 3D0LA 1KLFA 2BJMH 1GGBL 4ZOCA 4KDVA 2X4PB 3MUZ1 4QHLB 1K9TA 2B7DT 1C7TA 3IRZA 3RY6A 4QGYA 4L4TD 2QSCH 5I1EL 3BAEL 1T04A 2UZXB 3OKLB 8FABB 4OM1L 3WXWL 4TNVK 2P44B 2DM4A 2XPGA 1AKJD 3B5GA 3BRGC 1JF1B 3JWNC 2N7AA 3QUYA 4JG0H 2J8HA 1YEJH 3MR9A 3P4NB 5IHLB 2OYPA 4YPGA 1HYSD 4UT6L 5HY9B 1JRHH 1GIGL 2DRUA 3O3BA 3EKCA 4KK5C 4DQOL 1NCAH 2OR8A 4PJ8B 1DP0A 2A6DB 1JGLH 3H9SA 5GRZA 1CDHA 4OCXH 1E4XH 2QTEA 1I8KB 4L29A 5KSUA 1WZKA 2R0ZH 3RX7A 4PBXA 1UQSB 4IS6A 3RWJB 4ZOEA 3VH8B 4UT7L 1FL6B 3U0PB 3MLTA 3NCFB 4QLRA 2HJLB 4LVOB 3NPSC 4EI5D 2XTJD 3HE7A 1IGJB 3QCVL 2HLFC 2X4PA 1JI2A 3O3AB 4FFWD 3LKQB 3NIFE 5EBGA 3NCEB 4D9QD 1CL7H 1R3KB 4JFEE 2Q8AH 4QXTB 4RFEB 3K81A 1JGEB 4FQ1H 1BREA 1G9MH 2A6IB 4G8GD 1UM5L 5T1KD 4MB4A 8FABA 1AE6H 1HHIB 5T1LB 1W0WA 1JF1A 2P8PB 1RU9L 3RZCC 3R1GL 2CXKA 1HIMH 1CDBA 1BM3H 4RX4A 5E95B 5GS1C 1Z5LA 5IVXF 5HY9A 4LPXA 1QFWL 3HAEB 3K8LA 1IE5A 1A1OB 5D7IF 3PWNA 6CGTA 3RNKB 1FYHB 2R2EB 2P5WB 4MA8H 1G7IB 4JB9L 3D18A 3P73B 2P1YA 4C55A 1T3FB 2NY1D 3BYYA 3ROOA 5AUMB 4G7YH 4XWGL 4LF3A 3VH8A 3WO3B 1DBJH 1KJVA 1VERA 3MLRL 3SE8H 3WBDA 2EIDA 5BRZD 5T3ZE 3QNYB 3KYMA 2HTLC 3N1MC 4U2YA 2IALB 3ARFC 3TBVB 5JW3L 3QFDB 4Y1AD 1T5XB 3MLYL 5KVGH 4G8FA 1CT8A 1MCNA 3WFEH 4CN4A 4RFEA 1YN7B 5F7KC 2APXA 1I3UA 4Y1AA 3S34L 5CP3H 3SJVE 2EDDA 5IB3A 4B50A 4D0CB 3GBNL 4Z7WA 2OR7A 1MJ8H 4O02H 3KPRB 4U31A 1M6OB 5CSZB 5IEKB 4U6XA 4IIQA 3HAEA 5DHXB 2EYSA 2CK0L 1A1OA 5F6IC 1YECH 1P5UA 3UTTB 2NYYD 2P5WA 4M61A 1YNLH 2VDNH 3H0TB 2YA2A 5BV7H 2HT2C 5TGBA 1I1AC 4PJ9A 3RVXD 3C8KA 4WWKB 4NO0B 1MCCA 5FYJD 3CK0L 2WK2A 4OM0L 2H32B 5IW1B 4YPJA 2R69H 5DO2D 2XV6B 1L6XA 3QNYA 3X14B 5JOEA 1OCWL 1FYTD 2VR5A 5DJ2B 3LKRA 4NM4L 1N64H 1CDJA 1OGAD 2CGRL 2YBRB 3ILQD 2QHRH 3RKDC 4RWYH 1YN7A 1OAKL 4NJ9H 2DIJA 1S5HB 4NQEB 2JCCB 2VH5H 5DQJA 4M1DH 1LE9B 4D0CA 3UC0H 2W38A 5HPMA 1U42A 1XF4A 4JFOB 3FQRB 4WFED 2VXTH 5EU6D 3U4AA 3FTGB 4ACPA 1FNAA 5DWUL 4QOKE 1AR1C 2VERN 1IAOA 1L0YA 1JWSB 4AIZB 4KJYB 2GAZB 1FVEA 2I9TA 3C5ZC 1AQDA 4LLWB 4OCWH 5JDJA 3MA9H 1F97A 2VUOA 2H32A 3IDYC 3H7BA 4KUZH 5HI5D 1CN4A 4HHAB 4G6KH 4JE4B 4K8RC 4PJGF 1TJIH 1WBXB 5I8KL 3HC0A 5FHAL 3VE0B 1WCBA 4BELD 2BNRB 4L4TE 2CMRH 3WJJC 4KZEL 1QA9A 4DEPB 4JFQA 1M7DB 4NKIH 3D39A 4YBLB 3MMEB 1RMFH 4TVPE 1NBVH 4DKEH 2H2SC 4UI2A 4Z7VF 2QADB 4WI3A 4U0RB 3H9SE 5I18H 4JQVA 4U33A 3TBSA 3I6KB 4X7SH 5EOQL 1MCQA 1B2WL 3V4UH 1HQ4B 4OZFH 3TJHD 3GI9L 5D5MF 5EN2B 3FTGA 2JJSA 3MJGX 2AEQH 3CC5A 4WU7B 1YMMB 3RVWD 1KB5B 2VDOL 3OGCB 1XF3B 3EFDH 4PJAF 4F9LC 1KC5L 3GIVA 2FD6L 3ZLQC 1RUQL 5I19L 5E9DD 3GSNH 2OQJA 4CW1A 4R4BA 3MRGB 2XTJE 1GZPB 2HN7A 5GJTL 4BQ9A 4JZJA 2Q87A 1PQZA 5KAQG 5T3XD 4YC2B 1F11B 4U4BA 5IW3A 3VDBA 1BQHG 1DLFL 1CFQA 2O5YH 2CIIB 2C5DC 4NQSA 1L7IL 2BNRA 4PJHF 2NXZD 1DUYA 4G8GE 1S7VA 3BXNB 4EZMA 4JCMA 1YJDH 3NABL 5INCB 3W9EA 3W2DH 4LSSH 1OTSC 4LSQH 4DJMA 3S98A 1IBGL 3K2MC 3SKUD 5MEQB 2ZJSL 3I6KA 4L4VA 2R2BB 4JY4B 1C5CL 1T66D 1HQ4A 2F5AH 3C6LD 5F88A 4Q6IC 3R06A 2K7PA 3NFNB 1U3HA 4QXUL 5JORA 3TM6A 1YC7A 5F9JB 2O5ZH 3B9EA 1CE6B 3LH2L 4ETYA 1FL5B 5IEHB 5DD3L 1FZOA 5SV3A 1LO3L 4G6MH 5I6XC 2HJKA 5AG9A 5BRZE 3MRGA 1K4CB 4XCEA 2KL6A 4LLUA 4M6OH 1F11A 4M00A 3O9WB 4QEGA 4Y1AE 4R2GC 2MCPH 4OZGF 1RUKL 1UFUA 1EHLH 1JPST 3VWKB 1MVFA 3BXNA 4Z7WE 4UOW1 5T3ZH 4ONHB 4L3EA 4RAVB 5E2TL 1U8IA 1OGTB 5DRXB 5T5FH 1KCUH 2QBWA 5FF6B 3D85B 2R1XB 5C0AA 2R2BA 5SWZB 4L8CB 4EN3B 3N9GL 5D96C 2BHUA 1EGJL 3IFLH 1AHWA 3KJ4B 5DYOA 3P0YL 3MZGB 1YEHL 4JO3H 1GJIA 2X9WA 4YXHH 4OF8A 3D1MC 4LLMA 5FYJE 1IM9A 4GBXB 2GCYB 2XWJB 1YEDB 2DTSA 3SDDD 4GUPB 1FYTE 1KPRA 1IQDA 3EOBA 3ORJA 5IB5B 4FTVA 2ICWB 1SMOA 5LBSL 4XMPH 2Y4SA 2E7LA 3IDUA 1WICA 2K1MA 3A6BH 4E42B 5D2NB 4HJGA 1SYVB 1IZKA 2QQLL 4PGBA 4ZSOA 5B4MD 3PL6B 4R97C 1IEAA 5KS9A 1C8PA 2A1WH 5DLMH 1ES0B 4H5SB 5AEAA 4B5EA 3MRRB 4CJ1A 1CG9A 3EDKA 5DRXA 1ZGLB 4ONGL 1MFDH 1BOYA 1UYWL 4UIMA 5FF6A 1PG7X 2GITB 3BH8B 1WT5A 3Q48A 4UTBH 2XXMB 4FXLA 5L8KB 2BY0A 3H9ZA 2OL3L 3ARGB 4WFEE 5EU6E 1XR9A 1BQUA 5IB4B 2ZG2A 3QIUA 3DJ9A 1AP2B 1RVFL 1DEDA 3DMMD 4PS4H 3RQ3A 5F7HA 1NSNH 3HA0A 4QCIA 2AK1L 4JRXA 3PABA 3QHFL 3OX8B 43C9B 4W4OA 4F7MB 4GBXA 2GCYA 2XWJA 4PJ8C 5AZ2L 4ZUVB 4TTDD 3ARDB 4XAWH 4YX2L 1ZTXL 3OKMA 1PKQB 2E9JA 3KXFA 4LHJB 3LPFA 4GRLD 4HGMA 4WEBH 3KWWA 5F6HI 3D39E 3MBEA 5HHXH 1S9WB 5HVFB 3WFZA 5D2NA 2D9QB 1SYVA 3EYSL 5I1KL 1ACZA 4LVOC 3UXFA 4BM7A 5DD0H 2FECL 3PUCA 2GFBA 4H5SA 5HHOD 4UAOC 4MWFB 4KJPC 1TJHL 3MRRA 4IRJD 4NQCD 5J6HB 5DVOA 1ZGLA 1N4XL 5SV4A 2CKBB 1N5AB 1LP9B 4GG8A 4QRTB 4HT1L 3QPXH 5EOTA 4BH8B 1NKOA 1VPOH 1EK3A 1U8NB 3B43A 2Z92A 3ARGA 3BO8B 2YMXL 3MV9B 3RTQB 4P4KD 3KYKH 4LKCB 1OQXA 4L5FL 2ED7A 4KC3B 4TPRH 1ZLUK 1A7PH 4TVPH 1J8HB 1ND0B 1AP2A 1XGUB 3C2SA 4DZ8A 2F58L 4M93B 1EIBA 2D7OA 3VXOB 5E9DE 43C9A 3RU8L 1FAIL 4M1GL 4F7MA 1MNUL 3IETB 3NA9L 4P9MH 1BOGB 3QDHA 4YGVB 2DIAA 3AS3A 4K71C 3KPSA 5T3XE 1FNEB 4NQDD 1F2XK 3CVHL 3QDGD 3FAXA 4RAHA 1NGYB 5FB8B 1OP5H 1S9WA 3TWCH 3H42L 3FO0L 3GSQB 4X4YB 4GMSH 4MX7B 1FZMB 4XPTL 3OXSB 5J8OA 3CMGA 1E4KC 4JRYD 5L6YH 3F7YB 4L4VE 3QNZA 2IH3A 1UGNA 5DVKA 3DETD 2HFTA 5EZIH 5LGHL 2ORBL 2CKBA 2JE8A 4JRYA 1DN2A 1I7RB 4BH8A 1U8NA 2AW2A 3ULSA 3Q1SL 2AJUL 3RTQA 3CPLB 4RGOL 4HKZA 4ERSL 1E4JA 1IGIL 2FH6A 3DYMA 1VFAA 3FHQA 2H3NB 3C08L 2PYFA 3MLWL 3X3FH 5L8JB 1LQSR 1I1YA 3NACH 1TJGL 4Z5RA 3CXHJ 5ISZB 3IETA 3NZHL 2VDRH 4YGVA 4AZ8A 1FNEA 4ODWB 5I17A 1EJOH 4DVBB 1MI5A 1AD9B 3BQUA 4CADA 5I1DB 4H8WL 4X6DF 5CILH 5FB8A 3MV8A 2NY5C 4WFGD 4MXQD 4NOBA 3HPJA 4L3EE 4WWKC 2J3SA 2IAMB 3GSQA 4R4NC 2HT4C 5FDYA 5JHDA 1CDUA 4PJXE 4I1NB 5C0AE 2VLJA 1JYXA 3F7YA 2Z35A 1CXIA 4KRMB 4K23L 1B0RA 4ENED 5DRZB 5F7LB 1UWGH 4NHCL 2DQTL 4MCYB 4APQD 1HCFX 1DEEA 1PYWB 5DT1L 5HD8C 4J6RH 4XT1C 4TULH 4PR5A 5KVMC 2EEAA 4O4YL 3VXUD 3X17A 4EOWH 5T5NG 1NAKH 3THML 1S7QB 3GRWA 4GXUN 5AG8A 5E08L 4ODWA 4ZSOE 2DLTA 3ZE0F 4OAWB 3DX9B 3QJHB 1AD9A 2BCKA 5I1DA 1NCUA 4NZRL 1CGSL 2F9BT 5GXBB 2IAMA 5FYJH 5C0GA 2J5LB 1LE5A 3WFDH 3P11H 4XHJD 5HBBA 2Q20A 1FFRA 5F3BB 3D87B 5EO0B 1I1RA 3QDMB 3MLPA 5F7EL 2B2XL 4JQIH 5FUCC 5DRZA 5C9KA 3K0WA 3WD5L 1OD7A 2DD8L 4P0DA 3TO4D 5HVWA 3NCCB 2OR9L 1ETZB 4P2RD 2WIIA 4DEPC 1H3GA 3JVGC 4YBLC 1PX3A 3RWGB 4ZD3L 4UTAH 3OGOE 4JRXE 1DBKH 5D9SA 3SOBH 2QADC 3NFSH 4U0RC 5HVHC 1MPAL 4JDZB 1J87A 4KPHL 3KXFE 1QQDB 1WTGT 3MRKA 4YAQA 1ORQA 3G9AB 2GY7B 3QXWA 3IAPA 5IROA 4MB3A 4QRRA 5KJRL 4CVZB 1RUAH 3RI5F 3NAAL 3MJ9H 4Z7UE 5IESL 4OAWA 3QJHA 4GRWB 1EEUA 2WMPA 5ELIA 1RI8A 4OLZH 3QUZD 3PV7A 4NSKB 4UDUA 5HHOE 4XPAL 4J1UB 5ANMB 4L1DA 4NQCE 4YC2C 4XB8A 2CSPA 2HVKA 1GPOL 3IB4A 5D93B 2YK1H 1H5BB 4OLXL 1KLUB 3AFLA 3RWGA 7FABH 1DUZA 4GKSA 1JF5A 2JB6A 3Q5OA 2VDPH 2XKNB 3LKPB 4R4FH 3LDBB 3EZ8A 3DUUB 2A0LC 4BSVA 3S88L 3PWVB 5FGBC 3U1SL 3BP5B 4KK5D 4W6XB 1QKZH 3VRIA 3S35H 5TF0A 43CAA 1J0KA 2APWA 4NQDE 3QDGE 1UKQA 4DAGL 3TZVA 5ADOL 5DRNB 4WJ5A 1CF8H 1PZUB 2RHEA 5F72S 3P4OB 3UZVB 1XGTB 5MEPA 5H2BB 2AAVA 5K9JL 4JRYE 1MOEA 4ZUWB 5T3XH 3TNNA 5LWYL 3O9WC 1KF9B 2HLFD 4KK6C 5DUPH 1DLHB 2MOVA 5KTEL 1RJZA 2GI7A 3EYUH 3PV6B 3FQNA 4K2UH 2P24B 2IGFH 1EEYB 3VWKC 1Y0LB 1A7OH 5EDXA 1C1EL 3P4MB 2H41A 3S36H 1BWMA 3UTOA 5HYJA 1KJ2L 3DROB 1NMBL 4Z0BH 4PRNB 1BVKA 1ED3A 1DVFC 1KN4H 2VC2L 4ODUA 3RZCD 1IZJA 3T2QA 1ZANH 5E0QA 1DQML 3DUUA 1GC1C 3NIFF 2MKLC 3QEQA 4EN3C 2R29L 2D03H 4OLWH 4YXLH 4DGIH 5CJXC 1S3KL 5F89B 1CGXA 3I50L 1ZHBA 3UTSA 3QRGH 3FN0H 4XXDA 4Y4KA 4YHLH 3MACL 5DRNA 4WFGE 4J3UA 1GOHA 1KTLB 2AEPH 2F8VA 1WIOA 5F9AC 4M6MH 2HKHH 4R8WL 3P4OA 5C07A 1FV1B 2CLVA 1X7QB 2DL2A 2HTLD 3B9AA 5EC2B 1NC2B 5HI4C 3O2DH 1BFVL 1RUMH 3ARFD 1JMZA 5DZOA 4MA1C 1YY9C 2EICA 4WHTB 3HI5H 3PV6A 5IGXL 4GH7B 2P24A 5F7YC 3OKEA 4XPHL 3PL6C 4I13B 5FV2A 5J11B 4XZUB 3N1QC 4JG1L 3VXUE 1H15B 4YFEA 4KV5E 5J13C 3BJ91 4UV7L 4PB9L 1JHTA 1Q0YL 5F70A 3W11C 2HWZL 4HXAH 3KYOB 2EDEA 3P40A 4UIKH 1TDQA 2E3VA 5F89A 5DFVC 4F37K 3VXSD 2X4QA 5MENB 4G6JL 4KTYA 1U41A 1QSEB 5LQBL 5D1QB 4MCZB 2R0KH 1JYVA 2HT2D 3MODL 1DL7H 1I1AD 1KTLA 2YUXA 4POUB 2ARJB 2QQQA 5ESVA 3D9AH 3ARDC 3UPAA 2VDML 4HKBA 5FKPB 1YPZE 1MCBA 2FHCA 1SJHA 5E2WH 3TPUB 1IRAY 3RKDD 3IAQA 4JM2C 4P2RE 3GKWL 4RCAA 5I9QC 3J8F7 1I1FB 4DKDC 5L88H 3MRDB 4XZUA 2DN7A 3FT2B 4X4XB 3PHQB 4JN1L 5LGJA 1J0YA 4QRRE 1IC7H 1Z2KA 3EOAB 1GGIL 2AABL 1AGEB 5CGTA 3RWHA 1DDHB 5E8DL 5IMLA 1CBVH 4U1JB 5MENA 1G0YR 1TVDA 2UY7A 3HMXA 1AR1D 1L6ZA 1QSEA 5C6TH 1D5XB 1LMKA 4MCZA 5LAXA 4M93C 3QQ4A 1WBZA 3MRFB 2PNDA 2H8PA 4Z77B 3C5ZD 4LEXH 1S9VA 2ARJA 2Q3AA 1DBBL 2HFGL 3BEVB 4IHOA 1AFVL 4MNGB 4NFCA 2JK5A 4N90D 3MRIA 2I9LB 1AJ7H 3BT2H 1FVDA 1S7SB 4K7PX 4K8RD 2Z9TA 4M6NH 4R7NB 2WLYA 1U3YA 3U36B 4HV8A 3P0VL 5DC0A 1EX0A 3SKJH 4NT6B 4M5ZL 2C7UB 5DMGC 1B4JL 3LVEA 3SPVA 1L0XA 4MAUH 2BY1A 4NGHH 4L4JA 2H2SD 5TDOB 4X4XA 3K1DA 1R3IH 5JMRA 1ZVYA 4PG2A 4FABL 3HLAB 1FNGA 1QRNB 2AI0L 1AGEA 1DDHA 5AD0A 2QQKL 1NDMB 3EO9L 1CFVL 3BRDA 4QRPB 2WUCL 2X7LA 1RK1A 4K3HA 4KFZC 3O11A 3IDXH 1DQJB 3MRFA 4RFNB 1RV6X 4GSDL 4GXVL 1RPQA 4V1DD 4DGYL 3O41A 2V9RA 5CKAA 5GZOC 3PXJA 4MNGA 4AQ1B 5HYJE 3LQAC 2XY2A 3LV3A 3CCHB 4FQCH 1FZKB 5DA0B 5IFAH 4R7NA 4WDIA 3OB0H 3MTRA 3SQBA 4XVJH 4FRWA 3UBXG 1FFNB 25C8H 3VW3L 4JJ5A 2YD4A 3IKKA 1UZ8B 4O51B 2LQRA 4OBRA 3AS2A 3QEQE 1OTSD 4FQIL 3D3VD 4ELME 2I5YH 2JF1A 2YPVL 4PJIA 5A3IC 5FO8B 1QRNA 4Y7MA 3T2OA 3UTSE 5IR1B 4XVTH 2NTFB 4BKLA 1NDMA 5ALCL 3I6LD 4BSJA 1LEKA 5EIIB 3WIHH 3AMKA 3F5WB 5EBMB 4N0CC 5C07E 5KG9A 1XZ0A 2VE6A 3X13A 3QFJB 5E00B 4DZBA 1W72L 4OLVL 4UOW0 5EU4B 3GSUB 3V95A 3BPOB 3MV7A 4R0LB 1G1YA 4IOSD 3VRJB 1YY8B 3V7AG 4L3CA 1JVKA 4V2CB 5JLZA 3D2UB 2WNGA 2BXZA 1GCFA 2CIKA 4D2NA 4R7DB 4OGAC 1KIQB 5MHSD 4R2GD 3RDTB 3H9YA 4YHNA 4G80A 4OLUL 1HK6A 1N0XH 1RJYB 2A6JA 3MFFA 5GS0L 5MERB 2NQCA 2V7HB 4U2ZA 2Q7YA 4ZS7L 5SX4I 1AGDA 2C1OA 1UZ8A 4O51A 1VGEH 2HA1A 4QRSA 2YD2A 2GTZB 1BBJA 2VQTA 5DGQA 5FUOL 2AV7B 4OUUB 4JANA 3CXDH 4Z18A 5D7LD 2FB4L 1N2RA 2AQ3A 2VSDA 1CD8A 1F58H 2NTFA 3IS0X 3Q5YA 3VXSE 1UACL 3WL9A 1OARH 4Z7WF 5EIIA 2X89D 1FBIL 3F5WA 2O5XH 2PO6A 4FZEL 4PRHB 3MRNB 4RRPA 1HZHL 4KI1A 2R8SH 5E4EB 4ZOAA 3O45B 3MLXH 1UJ3B 4NKOB 3MOBL 1YNKL 1YY8A 4G42B 2PUQT 3ZHKA 3D2UA 5GRYA 2DYPD 2GK0A 4PTUB 4KQ3L 4X7TB 2XZCL 4E41B 1KIQA 4W81A 1EFQA 1K6QH 4UINH 4KTEL 3O6MH 3UTZA 4M5YL 4JR9H 4CRPA 5AWNH 2ADGB 4PJDE 4RDQF 5D7JB 4XMLL 5CIPB 5JW4N 3WDJA 2ZSWB 4LL9A 4XVSH 1HHGA 1RZKL 3BX7C 3RHWF 1EMTH 3A0OA 4X98B 1EHNA 4CBPA 2C26A 3O4LA 4OF0A 5E8NB 2LV4A 1RZ7H 2CLZB 1R5IB 2DM3A 3OG6B 5D93C 4PGDA 4HLZH 1H5BC 4OFPA 3HUJA 1MRFL 3ZTJG 4MXWH 3JV5A 3HS0B 4K7PH 3VJ6B 2OTWB 3E8UH 4N0FA 3MA7B 4N8VB 3LDBC 2R2HB 1INDH 5TFSL 3DIFB 1T1ZB 1OM3H 1A6PA 5E8OB 3JTTB 3T8XB 2CRIA 4HS8H 3DUSA 4PJ8D 4G42A 3V4VL 1N3NB 5ITFB 4G7VH 5ETUA 5FGRA 3L95A 4N90E 4N8CH 3ARUA 4E41A 4MAYC 2J8UA 1GAFH 5HYSA 3QHZH 1H3TA 3DHJA 3AS1A 5DJZB 2GTWA 2BXYA 5C2UB 2ADGA 5D7JA 1QHPA 1FORL 5F96L 2R4RH 1INQA 1DBMH 2DM2A 4KJPD 4JVWA 4ZYKB 1MHCA 3NCMA 1BZ7B 1WJ3A 2OZ4H 1NCDH 1WWAX 4ZXBA 5E8NA 3WFHB 1QLEH 1R5IA 1VFBA 2WUBH 4NZDA 2BVEA 1TETL 4AT6A 5T1LD 4PB0H 2JJTA 1E6JL 3QEUB 3O6LH 2XA3A 3SBWA 5FO9B 2ZUVA 3MA7A 1XCTB 1TCMA 1WAAA 5DK0B 2V2WB 1IC4L 4RISL 3RWCB 4YR6B 4S1DC 3U48A 2QL1A 4H0IA 4V1DE 5KSAB 4NHUB 4RSVA 5F21B 2AP2A 4MD5B 1N3NA 1F4XL 1A6VH 5F71A 4KK8C 1K2DA 5CBEB 3QYCA 4KRNA 4JFZH 5LJYH 3ULVC 4HUVB 2VLME 3QCUH 4HDIA 4P57B 4OZ4B 4QHMB 3WS6A 2X4NB 2QR0B 2VB5A 3DNKA 3K80A 3SDXA 1D6EA 3O0RH 4ONFL 4NQXB 3QQ9C 2WAHA 3T0AA 5HHMB 4TSCL 3QCTH 2F53A 3WNKA 3H3PL 2DQCH 2DBJA 4LAQH 1ZKAA 3K4ZA 3OR6B 5KSVB 1FFPA 4QHUA 3L3HB 2CRZA 4KTDH 1ADQA 2F5BH 3UJJH 1JN6A 3HI6L 3SKOA 1JTTA 5J11C 2BJML 2XG5A 3QEUA 5SWSB 4RIRA 4EVNB 5FO9A 2B20A 1ZXQA 4IOFC 3KPRD 2LU4A 2V2WA 3IKCA 2PYEA 2RGSA 3B8SA 3P30H 2QSCL 3BWAB 4WU5A 3SGKC 2IG2H 4NHUA 3J7HA 2DQEH 3KLSA 3QPQC 4W6YB 2BVOB 4JG0L 5D1QC 3UTTD 1KTDA 5MHSE 4F2MB 4EQ2A 1CU4H 1YEJL 5DEGB 1KCLA 3RPKA 2BZDA 1IKFH 4P57A 1BVLA 1CQYA 4WWKD 5CCKH 3DLQR 2F15A 4QHMA 1JRHL 4FFZH 4NO0D 5IBUB 2HT4D 2Z91A 2X4NA 1NCAL 5HGBA 3T2NH 3SO3B 3RWDA 4AL8L 3MNZB 2GJJA 4M43H 4OCXL 1UXWA 5F7DA 4Y4HB 1T0NB 1IGYB 2R0ZL 4J7RA 1EPFA 3FONA 5KW9H 1QFWI 1DTUA 2E7CA 3DXAD 3L3HA 4YHZH 5HD8D 1MCKA 1VEOA 5IMMA 2X4RA 5IK3B 2RCSL 3QZWB 4TYUA 5F9OH 2EDJA 1K8IA 4NQED 3KYNB 2M1KA 4PJXF 4QY8B 4YO0B 1QD0A 3FAWA 2BC4B 4JDVA 4PRDB 4BZ1H 3GMRA 3D6GA 1NJ9A 4UT9H 2Q8AL 5SX4H 1P84K 3C8HA 4K3EL 4RMWA 5C7XH 1N6UA 1TZIB 5E94A 1PEWA 3L3KB 4OI7A 3NCYP 1GL4B 2NXYB 1ZS8A 2Z8RA 4I2XE 4N0UB 5DMIL 4YQXH 4F2MA 1T83C 1EZVY 1HIML 5IQ7H 1BM3L 4J4PC 3U0TA 5ITBL 5KSBB 4I0KA 3IJYB 3RUGA 1ZSDA 3O4LE 1MCLA 1ZMYA 3VXQB 1ONQB 2B4CC 4MJ5B 1A1MB 2F8XC 3P9MB 3T0BA 4X5LA 3HUJE 1T0NA 2CO7B 4MA8L 4WW2F 3ARPA 3PWJA 4G9DB 4MMXC 1DBJL 3IGAB 2V2XB 4ZFGL 1VACB 5IK3A 3QZWA 1JF6A 3KLAB 3WNMA 3BHBB 5GSVA 5IB2B 5L9DH 3VXPB 3KYNA 4QY8A 4FQXC 1MF2H 2HFEB 4YO0A 2WV3A 3SGEI 4PRDA 2QADD 4ODBD 1V3MA 5TE7H 2OL3B 4HUUA 4HD9A 3FOMB 3VFPB 3WFEL 5HGHA 2E9IA 2J8UE 2EDLA 4JEGB 1TZIA 4FXGB 5IF0A 4JZOA 1YMMD 2X70B 2VRAA 4UU9B 1MCEA 4N0UA 3U83A 3S3PA 4WI7A 3BSZH 3QEHB 3W9DB 4HIHA 1OTTC 3MOAH 4RFNC 1GSMA 2VR4A 3MGTB 4O02L 5HHPB 5JDSB 3AM8A 2J88L 4RGNB 3G6JA 5FKAB 3DO7B 1X4XA 1OVZA 4FNLH 1UCBH 2NX5D 2EH8L 2YD6A 2IQAA 3L3GA 5C0CB 3VXQA 1G84A 1ONQA 2OSLB 4MJ5A 1A1MA 1SYSB 3DRTB 3P9MA 5I16B 2V7NA 3KPMB 1EO8H 1YNLL 2VDNL 1U8KA 1XAUA 4I5BA 1T22B 4Z7UF 1Q9WA 3UDWC 4PTTB 2A77L 2KBGA 3IGAA 3WKNA 2Q8BL 5GGTL 5JW5A 3HPLA 2YEZA 3IYLW 5ICYB 2ATPB 3GMMB 3VXPA 3TO2A 2HFEA 5HDOA 2WBKA 1N64L 2X9YA 2OL3A 2A0LD 3AAZB 2QHRL 5FYLD 4RWYL 1XCQB 3FOMA 3OPZH 1EEZA 3B4NA 4OUOA 5JW4Q 1EHAA 4KY1H 4NJ9L 4ZAKA 2XQYG 5CEXA 2X70A 2FWOB 4X6FB 1NCCL 2VH5L 3KYAA 4M1DL 4KMLB 3WIFA 3UC0L 2D0GA 3L3OA 3QEHA 1D5BB 2JJWA 4LCCA 5HHPA 5JDSA 3BPOC 4R0LC 1S8DB 4YZFE 1T03H 4K94L 5J1SC 5FKAA 1MFEH 2HRPH 2F53E 1QO3B 2VXTL 5D71L 3VXRA 2KQNA 5C0CA 1Q9OA 2OSLA 3CFBB 1L4IA 1SYSA 3O9WD 3RDTC 4KK6D 1PLGH 3VWKD 5GRJH 3WLBA 3MA9L 3QO1B 4P48A 1HXYB 2PYEE 4KUZL 4RGMB 4M7LH 4G6KL 3EIFA 1NLDH 4XC1L 4MNQA 3TBTB 1MIMH 5DUBA 1DVFD 1TJIL 1H0DB 1WSST 3D85D 3KPRE 4OB5H 5I75B 1YC8A 2V5YA 2DIBA 2CMRL 5D1ZB 5EU3A 5SWZD 1XCQA 3MCKA 1TIUA 3QWRD 4EN3D 5JQ6H 3CMOH 4BJLA 1KCKA 5ECJE 2KPNA 2XG4A 2HLAB 1XGYL 1Z9LA 5E2UH 1FN4B 1IL1B 1RMFL 4MYWB 4EI6A 3UTTE 2BY2A 4DKEL 3QAZC 1KGCD 5E4EC 1QBLH 3U4BH 1P4LB 5I18L 5JW4M 1Z9OA 1UJ3C 4MLIA 3TGXA 4X7SL 1FIGL 3BPNC 1BD2A 4NQVA 2FJFB 1Q8MA 2DI7A 2X4SA 1ZLUH 3ZO0A 2AEQL 4FP8H 3CVHA 5CEZD 3TH4T 4X7DC 4JY5L 5HI4D 1RIUH 3VFVA 4KRPB 3OL2A 1YY9D 3AB0B 2N7BA 2R1WA 3DXAE 5GRWA 5DK2A 2Q86A 3GEWB 3PL6D 5TE4H 5HJ3A 1VGKB 4H1LH 1F4WL 4DK6A 2EE6A 4I0CC 4GG6A 2FJHA 2VDKH 3TBTA 4OD2A 12E8H 2O5YL 1RZGB 5FUZL 5TE6H 1IEBB 2VQUA 1BFSA 5D1ZA 4WO4B 4PJCA 4PJFB 4KKCC 2ARWA 1OP3H 3W11D 4D0BB 4R9HA 4HEPG 1YJDL 1AO7D 1H3XA 5DFVD 2G60H 4LSSL 3W2DL 4E9LA 5FA3A 3DRQB 1RUPH 2VLRB 1KCVH 4LVNC 1P4LA 4KV5F 4LHQB 4POZC 3UTPD 2YC1B 4HIXH 4CVUA 1U8LA 2F5AL 3VFUB 3ARDD 2CXGA 1FRGH 1P7QB 4ZTOH 1V05A 2LVCA 5FUCE 5A2JH 5DHVB 2PTUA 4Y8AA 3SE4A 5JO5A 4HMEA 2O5ZL 4ZUSA 2CDFA 2E7BA 1RZIB 3ARSA 3MRLA 4JM2D 3V6OA 5DK3A 3DVGB 2ICES 4G6ML 3QUMH 5EFIB 1P7KB 4U3CA 2HVJA 3VFWB 4NQTA 4U1GC 4M6OL 1T89C 1YPZF 4D94A 2MCPL 2H1PL 1IEBA 1H8NA 5DJ0A 1EHLL 3MV9D 1M7IB 1TZGH 4FQLH 2OJEB 4PJFA 1HKFA 1WWWX 1YMME 2DLEA 1J8HD 3HFMH 4M7KH 1WWBX 4PP2B 4YBQC 2Y5TB 3DRQA 5DJDB 4JPIB 3GMQB 2VLRA 1W0VB 4I3GA 1CGYA 5KSAC 3MJ8B 4U3XA 1G6RL 2NX5E 3GSRB 1WBYB 4XXCA 3VFUA 3VI3E 4XPGH 1BQHB 2XNAB 1P7QA 4PJBA 1I3VA 3WN5B 1EFXB 3IFLL 4K3JH 3I6GB 3VXNB 1R5VA 3CH1B 4U1IA 3O6KH 2HP4A 4UILH 2DOCA 4D9RD 4YXHL 1RZIA 2UYLB 1FFOB 3IJHB 1IAKA 2NY4B 4JN2A 1DQTA 1TVBA 5DJAB 5DMGD 4EDWH 1F45A 1BZ9A 5D1XB 3HNTH 4XMPL 2IQ9H 5C0BB 1KB9K 4OSUH 3ZKMC 3A6BL 4M62L 4XC3H 5DTFB 3I2CL 5FYLE 4PJ5B 4Y19A 4AENA 3DVFA 5D7SH 5DZLA 1IFHL 2A1WL 3I02B 1QG3A 2JIXB 5DLML 4E0RB 2ADFH 2PXYB 5DJDA 2EDTA 1MFDL 5IFJB 3GMQA 3OZ9H 1DANU 1W0VA 1P4IH 5ISZD 4U1KB 1AD0B 1T7VA 3QXVA 3CGTA 1JPFB 2PTVA 3OSKA 4BQ6A 4UQ2A 2A38A 3MRJA 1JZ6A 5GZOD 2EKSA 3I6GA 5E2VH 3VXNA 2EC8A 2KQMA 2XN9A 2YPLA 4PS4L 1EUUA 1NSNL 2FO4B 1UB5A 2WINB 1CLOH 4JRWA 2UYLA 3HZKB 3P9LB 4OV6F 4XVUC 3FQWA 3IJHA 3HZMB 1FDLL 2BNQA 3KS0J 4XAWL 2VZ3A 3SO3C 3ZKXB 1CFSA 5C0EA 5DJAA 4LGPB 4OCSH 2IH1B 5D1XA 4I77H 4WEBL 5BMFL 4Y4HC 4OZIE 1ADQH 4KROC 5HHXL 5C0BA 5BZDB 3X3GH 3ZKNC 3ZDZE 5A3ID 2ITCA 4F3FB 2FSEA 1F6FB 1KJ2B 3QUXB 3JV4B 1KNOA 5DD0L 3VFTB 4P2OC 2JIXA 4JAMB 3G5YB 5I71B 2D7TL 4RZCA 3IXTB 4N0CD 4IEFB 3D25B 5K9OB 1KGCE 2F19H 4ELMF 1F4YL 3QPXL 1VPOL 1LEIB 1AD0A 3KYKL 2P4AB 3MLVL 3EFFB 4J3VA 1MCPL 4PLJC 2C1PA 2NXYC 1A7PL 4TVPL 4OGAD 4WUUD 1HSAB 5EZLA 4IM8A 4B7IA 2H9GA 4N9OB 2NY5H 3JTSA 4ZQKA 2ZUTA 1YEGL 2WZPD 1A4JB 4M3KB 5FGCE 4ORGA 4GG6E 4MD0A 1KB9J 2OJZH 3DX7B 3TVMB 4B7LA 3S3SA 5E24E 3QDMD 5C3TA 35C8H 5IT2H 4ZODA 2IH1A 5TF1L 1YEIH 3AREA 1FGNH 2OK0H 5F1IB 3BGMB 4HG4K 1CFTB 3TWCL 1QACA 1K4DA 1UXSB 1K8DA 4GMSL 4S1QH 1KJ2A 1F42A 1AO7E 3QULA 3B2VL 3BE1H 3VFTA 2R23B 3IU3B 3G5YA 4N1HB 3R0MA 4PV9A 4LSTH 3FOLA 4UZGA 5EA0H 1I85C 4L9LA 2P49B 4Q58C 5D72H 4Q9QH 2K7QA 1LO2H 2YR3A 3QDJD 4Z7OE 3KR3H 1PKQE 5CMAB 4BZ2L 3ECBB 2VZVA 1A7NH 4ODHH 3T1FA 1HSAA 2FL5B 3FRUA 4JFPA 3NACL 4RGNC 5CEYB 1A4JA 3MGAA 5D7IB 1X6NA 4GLRH 3DX7A 3TVMA 1RJLA 4X9GA 1RHHB 4N0RA 3MNWB 1A1NB 3REVA 4YIQA 2LTQB 4OTXL 2EIZA 3DPBA 4Z78A 1LP9E 4N5UA 3PG2A 5CILL 4GKOA 3FO2A 3ZZ1A 3QHTC 4FQJH 5I8OL 4U1HB 1J8HE 4PJDF 1O7SA 4NO5A 5C08D 2X09A 4UOJA 3ETBF 1UWGL 2CLRA 1TCRA 1T0PB 3NVQA 5IJKA 4HZLB 4YEFA 3FQUB 2Z93A 1TNMA 4LNRB 1EXUA 2DJUA 2ZUXA 5CMAA 1IGFH 4L8DB 3GO1H 1KB5H 5CD5C 4WGWB 3EJJX 5GGUB 5IVXA 1U95B 3LEYH 3T1WA 1D3CA 4MAYD 4R26H 2FL5A 5JR1H 3RA7H 4TSAH 5D4QA 5CEYA 2E27L 4HG4J 3LS5H 5JPMA 4JO1H 2HG5A 4QYOA 1J0IA 1ZVHA 2ICEA 1AC0A 3FB7B 3T08A 3AUVA 4KHTL 4X80H 5D7KD 1S7WA 3RWEB 3MNWA 1A1NA 1LNUB 4Y19E 5H35B 2DQUL 5CGYC 4D0DA 4L3AA 3GJEB 2X10A 5BJTB 3O8XA 3P11L 3KNBB 3LCYA 1GHFH 1KIUA 1YN6B 4AQOA 4JQIL 4LQ1A 3RI5K 1UADC 2LE9A 3S4SG 4HZLA 5FYLH 4S1DD 5GIRB 2R56H 3U2SB 1Q94A 3KHQA 2XN9E 2YPLE 3BUYA 3P77A 3PIQA 2CUIA 4UTAL 4LLDA 2BDNH 1DBKL 4KK8D 5CJQH 5IHUL 5GGUA 3SOBL 1BPVA 2Z8SA 3NFSL 4PG9B 3ULVD 3OXRB 5IVOA 4DFIA 1NGWA 5J12B 1GZQB 5DI8B 1ZT4A 3SGJC 5D70H 1ZT1B 2CDEB 3ZTNH 4XNYL 3FB7A 4NN7B 2XQBH 1CGUA 1NC2D 2EECA 1RUAL 3CIQA 1D5IH 3QQ9D 1ZGLP 2CR6A 3N50A 3T0EB 1G7QB 4KRPC 5H35A 2ZCHH 4HEME 4JDTL 3AB0C 4ZO6A 4P3WA 4QTIH 4OLZL 5BJTA 3LD8B 4YHKH 4BYHA 3MRQB 5IKCB 1U8MB 4PJGB 3MPCA 3JWOH 5FA4B 1CFBA 4BSWA 1MFAL 4LHUD 3UZEA 2ITDB 4IOFD 4MJIB 1MY7A 1NGPH 4JFDB 1J05B 2Z31B 4WO4C 1JUFB 2YK1L 1N59A 4OQ1A 4Z7VB 5DMKB 1VFOA 3QPQD 4GW4A 3BIKB 1W72B 3VWJB 4WUUE 5MP6H 5D1QD 2VDPL 2DWEB 4R4FL 1J1XH 4P2YA 1V7NL 3KAAA 1HXMB 2WBJA 3MLSL 3TBYA 3HKFA 4YFDB 1DN0A 4Y4FB 5DDHA 1QKZL 1QTYT 1ZT1A 3CFJB 3JZ7A 3S35L 3QDME 4HLZG 4PJAB 3U7WH 2JJVA 3C60A 3UJIH 3ARZA 3T0EA 4PREA 4WV1A 3JUZA 1CF8L 4L8BB 1AQKH 1YDPB 5EO1A 3FFCA 1S9YB 3TCXA 1U8MA 1FJ1B 1MAJA 1ZGLM 2NY7L 4M8QB 1FC2D 4PJGA 1I7ZA 5T3XL 3W0WB 1C12A 1MJJA 4PJHB 4P9HH 4WENB 3LRHA 4N1CA 5B8CB 3CFDB 3EYUL 4OCYH 4OZHA 2IGFL 2HKFH 2Z31A 4HCRH 1YEEH