1W0YT

Tf7a_3771 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
188
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Selective Phenylglycine Amide Tissue Factor/Factor Viia Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BLOOD COAGULATION FACTOR VIIA
total genus 43
structure length 188
sequence length 205
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0yT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0yT02
1IL1B 4WI4A 2FL5B 4GT7A 5BVPH 3IS1X 1CFTA 1BREA 1AJ7H 3GGWA 5HGHA 4QRSA 4Z7VA 4NYLB 3ARUA 1JV5A 4IRZH 4XVJL 4GRMB 1A3RH 2VDPH 3QXTA 1A6TA 3NFSH 4F7PB 4ZFOA 3KPSD 3V0VB 2D7QA 3IKKA 3HAEA 3O3DA 2ATKA 1YN7A 3OV6A 4MNGE 4U1KB 5CAYB 3BN3B 3GFUA 3LEXA 3JWOC 5D7SL 3CSBA 2XQYG 4TSAH 4ZMAT 5FECB 1YDPB 1LMKA 4X4XB 5A2IH 1I8KB 1UZ8B 1UM6L 4HUMB 4WU7A 5EU6E 2BERA 4PJ8B 4KDTA 3TJEH 4N5ED 4R4ND 1YEKH 4MB3A 2GITA 5E56A 5J57B 4KVNL 1TVHB 3RGVA 4Q9QH 4QYOB 2XY2A 4CVWA 1HH9A 2YD4A 3C60D 4M1CC 4ODXB 3B83A 1NC4B 5JW5A 1EDQA 1U95A 1UZ6F 1YY9D 4O02H 4P9HH 4JQIL 2H3NB 4QTHB 4N5UA 5E2VH 3BDXA 4LPYA 4UAOB 3I6KB 5D5MA 3HAEG 4DGVL 5EN2A 1N2RA 2X4UB 4LAJH 2YA0A 3VGHA 4LLVA 1YYML 2PR4L 2WUBL 3GSVB 1YEHL 3KNBB 1QD0A 3MJ8A 5I8EA 4PRPE 4WWKB 3VFRA 3O11A 3ILQC 4C54A 3LDBC 4TVSa 3B2VL 4RNRA 5ECJE 2H26B 3HZYA 1I7RA 1LO5B 1VKXA 4MCYA 3RI5F 2A1WL 1NFIB 4MX7A 2CUIA 2V5SA 3VXPB 2VRAA 3MO1B 4OCWH 3ROOA 1YNLL 3FJTA 2V7NB 3REWA 4RCAA 5FK9A 4HUVB 1U8JA 4NQUA 2Z8RA 3RZWA 5F9JB 1IM9A 5M95B 3O6LL 5E5MA 4JFOA 1P7KB 3LKNB 4P3DB 4MAYB 4CJ0A 1MAKA 4OZGA 4XAWH 2V9QA 4MSWB 4P4KD 2BHZA 4Z7VE 4ZS6C 1RHHA 5IFJB 4JLRB 3SDDB 5C0CE 4LSTL 1BQLH 3T3MF 3M17A 1Q9LB 1QSEE 1GZQB 1HINL 5E5RB 3H9SD 4JKKA 5KTEH 1PG7W 4M93B 4PJ5B 3QPQC 2V5TA 4FMFA 1S7VB 4WTWA 2R1YA 3OAUH 4RFNC 1B6DA 3OKNB 1R5WA 2NY1C 2NY2D 2P43B 4LQ1A 3SDDC 5JHLL 2APFA 3V6ZA 3VWJC 4AEFA 3NIGE 5LGJA 5JZ7D 1YN7B 4X98A 1AXSB 1F4HA 5ESVB 4UU9A 5KSVB 2APVA 4EI6B 2AGJL 3Q0HA 4LF3B 3VWKB 1K9TA 4K3GA 3SQOH 4OFPA 3TBSB 3HMXH 1G9NH 1KYOJ 2YD9A 4D0DB 1DBMH 5E4IA 1EH9A 4F15C 3BO8B 1CE1H 4O00A 2JJSC 4JRXB 2X4TB 2Z8VC 3QQ9C 4U2YA 4GQPH 1FLTX 3DXAA 3T0XA 1CDYA 3O4OB 4JRXE 2ZUYA 2Y23A 4S1SH 4XHJD 4F9PC 1RURL 5CP3H 3ILPB 3RNQB 4QHMB 1WZ1L 3SGKA 4HPYL 2BVUA 4ZOCA 3QCTH 4UNUA 1SJHA 4P2RA 2BXYA 5DXWA 1CLYH 3WIFB 3OJ2C 3LQAL 2V9RA 2XY1A 1ORSA 3NIGF 1KLUB 4ZOBA 1XGQB 4X6DB 3IDYB 3I6LD 3TESA 4QRQB 3AREB 3FHAA 1BJ1H 4Z95H 1LO0L 1NGQL 3HZYB 3MRJA 4XCCL 1UGNA 4MA8H 4Z7VB 4FQ1H 1WBYB 1FL3B 4QKXB 3RWFB 4F7CB 4K71B 5HGBB 3L95A 2MOVA 4XH2B 5HPMB 3Q1SH 2EYSB 2GT9A 3BPLB 1QHPA 3Q6FB 2O5YH 5CHNA 1BZ7A 3KPNB 5CD3A 1DBBL 4H25A 3D69A 3X11B 3ARFD 4H1LG 2XRAL 5C92A 5IESL 1TQCB 3DVNB 1JMZA 4XPTL 1OARL 5FM5O 4XNZC 2DQHL 3LKQA 2QBWA 3EJZC 4G6AD 5LQBH 5HHME 3CZFB 4YLQT 4NNXB 1WUNT 1X5YA 2H45A 4ZUTA 4XMKL 4K7PY 3OAUL 3WFEL 4DGVH 1I8IB 3QUXB 1E6JL 1T0NB 1MELA 4QGTA 3KLHC 4ONHB 1NMCC 2FEDD 5ITBL 4U6YA 3RVWC 1NGPH 1JPSH 3MNZB 2BJMH 4RRPA 4DVRL 1DL7H 4Y5VC 2Y5TB 4FQ2L 2FIRT 4ZO7A 4HKJA 7FABL 1IFHL 2X44D 2ZOLB 3DMMB 3L7EA 3K2UL 1TJIH 2CIKB 3OAYH 5FKAB 2EH7H 3EDJA 3LMJL 3NTCH 1UM5L 3QDAA 2C7UA 5JHDD 4G9FB 2DQTL 2X4QA 3QEQA 1N3NA 3QWRA 3QI9B 1IMHC 2E5EA 2UVEA 4WFEE 4CVUA 2BNRD 3NVQA 5DDHA 5I76A 1WEJL 1MY5A 2CIIA 4YFLF 2MHAA 1EZVY 5C6WH 4PLJC 4UTBL 2VC2H 3QPXL 4PD4K 3RWGB 1IQWH 1H3VA 3PDGA 3JZ7A 5C7XH 1KEGH 3ZDXF 4JPKH 4X6FA 3S88L 3P4MA 3WIHA 3IFPA 2UUDK 4G8GD 4P4RA 2VZ1A 1XF5B 5TJWK 1Y18B 2HT3D 3KPPA 5FGSA 4QT5A 5GIRA 5ETUA 5B8CC 1ZHLA 4PGEA 3BXNA 4G6FB 3T1FB 3ARBC 5ALCL 4DW2H 5BZWB 3E6FB 2Y6SC 4LOUD 2O5XH 1FORH 2UWEE 4L8SB 4GMTH 1JI1A 2ARJQ 1PYWB 2LVEA 3GGWB 5JNYB 5HTSA 1Z9MA 3JV6B 4PRID 4FQLL 5D7IB 7FABH 3PQYB 2YUXA 2J6EA 2VR5A 5C0JB 5F6IC 3UPRA 4B5EA 4JKMA 3WKMH 4GAJH 1KLFA 3HFML 4LSPL 2HG5B 1KTDA 5L0QC 1DFBH 1RUQL 1HXYA 3UZEA 1FL5A 2BNRA 4KI5E 4K94L 4NHUA 1BP3B 3UO1L 3LH2L 3P4OA 3UTPD 4I13B 5J11C 4HIJB 3OKYA 3O8XC 4AY0A 3QHZL 3WXWH 2Q6WB 3LKQB 5ESVA 2BNQE 3EDFA 1ZT7A 3LN5A 3DETD 2DIJA 1YY9C 3E3QC 2YZ1A 1ZE3C 1ZV5A 1QA9A 4K3HA 4BZYA 1MI5B 5DMGC 4XXDB 5CUSL 3SO3C 4EI5A 1WCQA 4M43L 3D6GA 2G75B 1A0QL 2WIIA 2QADD 2NY2C 1KCRH 3B9EA 1BD2B 4PJ7A 4YAQB 5HVGB 2YEZA 3QIBC 3ZKNC 4HKXA 4X6CF 5I1IH 4EKXA 2C1PB 2VLRB 4HUWA 4TTGA 4G42B 5BS0A 5ITFB 1MIEH 5GGVL 4H5SB 2FEEL 4MB4A 4KXZH 5E6IA 2IALB 3VRIB 4KGLA 1RUPL 5F7KC 4P5KA 1FYHB 4LVOC 4PB9L 3RZCB 4YQXL 4JM2D 3QFDB 4NRZB 1FP5A 4PJBA 4GSDH 1A7OL 4KK6C 3HAEB 5IW1B 4OCRH 4XNMB 2DDQH 5C09E 5HPMA 3TIEB 1MCWM 4HT1L 3UX9B 2VWEC 3EHBC 2VZUA 4MAYC 2OP4H 4WEUD 4WWKD 3IDXL 5DYOB 1X6LA 3KPPB 3VXNB 5JHLH 4TN9A 5C0RL 4FXKA 3VFNA 3DHMA 5JW4M 2V2TA 1NLBH 4WEBH 3UJIH 4M62H 4Z7UB 4OGAC 4PG9B 4ZTPL 4JFYB 2XZAL 2YA2A 2BSRB 3IFLH 4FZ8H 4WNQB 3AVEA 2LU4A 5FXCH 1BQLL 2Y5TA 2H6PB 1VGKB 2R1WA 4RWHA 5I71B 3PQYA 5HY9B 1I9IL 3MODL 3REVB 5SV4A 4I5BB 5HD8C 3EYVA 4KUCF 4X5XB 2R9HC 5J3HD 5I19H 5CKGA 4U1KA 5ADOL 32C2A 1I9JL 4NC1C 4OJFH 4HFUH 5K93A 4Q6IA 5F7FA 1HZHH 3OPZH 1LILA 3LB6D 1DN0A 1BWWA 2C3GA 4C57C 5B22A 3GSWA 3KLHD 1OSZA 4NKMA 5DRXB 3Q3GB 2HLFC 2HFGL 4MVBD 4CMHC 5FHAH 1DQML 3BPOC 1G7JA 3U7WH 4LPVA 2Z92A 4G9FD 5F88A 5A3ID 3FB6A 1YMMD 1NGWA 4XI5C 4LLYA 2EH8H 5D1XA 4RISL 1ZGLA 3STZB 1HNGA 1MWAH 1QZ1A 2F54A 4N68A 4UV4H 1CTNA 4ZS7H 2R4SH 2DYPD 2WMPA 3QZWB 1ZSDB 3VCLB 5I8EB 2VZTA 3C8DA 1Z5LB 4I18C 4M1DH 3BW9B 2VLJE 2MTPA 5MP6L 5IT2L 1IC4L 3ZKMD 2XZCH 3O6FD 3MR9B 3S5LG 4UZGA 9CGTA 3ULUL 4DJMA 5HHMD 5ACZA 3HPLA 4NT6A 4J1UB 1FE8H 4YDVB 2KDGA 4FQXB 4JFQB 4QRRB 5GRZA 3GZKA 3FQRA 3GIZL 1D5MB 3GMLB 1CD1B 1F4YL 3WN5C 4HT1H 2UYLB 4ZNEE 5SWZB 2WWMC 3LQMA 1XR8A 3L9RB 1G6RA 5LXGL 4LNRB 1FDLH 4XMLL 3WNMA 3RDTD 1CDJA 5K9QG 1A3RL 1MJUL 5BO1L 5EIQA 3BKYL 2GTWB 5DD6A 5EG6C 3OJMB 2VOTA 2YXFA 3QNZB 4Y5XC 3VFSB 2NY3C 2A6KA 3FZUD 1VA9A 3MV8E 2CIKA 3PHSA 1HI6A 4O02L 5KVGH 1Q0YH 3RL2B 3P11H 5C08D 2X40A 3ARDA 5C9JB 3AMKA 4LLVB 3VFTB 5FEBA 2LVCA 1WTLA 4WVRA 4OQTA 4P46A 1OTTC 1QBML 3DBXA 1CGTA 4PJAE 4ZUSA 1IEAA 4RIRA 2VLRA 2JIXB 2YD7A 2BOBA 4NIKB 1F6AA 5ITFA 1DEEB 4M7KL 1BFVH 2FR4B 1QSFD 2QQLH 1F8TH 3G5VA 5CGYC 4ETQA 4XNUL 4NJ9L 1K2DB 1W8NA 4IMLA 3S96B 2WZPD 2X41A 5IMOB 4OLXH 4ODWB 3DGGB 3CUPA 4P0DA 3RVXD 1N5AA 3SJVA 5CCKL 3GSUA 1FBIH 1BZ9B 1N0LA 4KRPD 1FH5L 4JRWA 4NRYA 4FP8H 4UOW1 4XP9H 1GXEA 3QI9D 3L3KB 3MNWB 4N0CD 3TYFA 3L5IA 1K5NA 2ICWJ 1QLEL 1DUZA 1PKQA 5HGHB 3OG6B 5DD0H 5DHYB 3NN8B 3UROR 5FDYA 3KR3H 2R0LH 3EBAA 2F5AH 2PYED 3AREA 4K9EC 2ED7A 2EZ0C 5FOBA 3L5HA 4JPWH 4UINL 2IPTH 1NUFA 2P1YA 4OZHA 4FTVD 3RJDA 2C7UB 2HJLA 2R1YB 1FLRH 1F6FB 3HE6C 5AAMA 3WD5L 3SDCC 3O4LE 3MBED 5I6XB 1INEH 3X13B 2B2XL 4Z0BH 3HE7A 2X2YA 3CPLB 3F7YB 3PWNB 3DLQR 4ZPVA 5DJZB 1Z3GH 5B39G 2IADB 1EZVX 4V2CB 1EHLH 3CFJA 1TVBA 4S2SB 2PF6A 1PG7X 3RWCA 4MB5A 4QY8A 4OCXH 3IFOA 4A2LA 3AM8C 5ITBH 3EFFA 3RTQD 3NA4A 1JNHA 3E6HA 2DIAA 3ULVC 3L3IA 3P0VL 2Q3AA 3SJVE 2P47B 4QRPA 3KS0H 1RSFA 5CINH 3MV9B 1S8DA 4JE4B 4MJIE 4XPGL 3BPOB 12E8H 1CL7L 4N8VB 1U92A 1OP9A 4MNHA 3S35X 3OGCB 1G6VK 3GRWL 3HAEH 4X7SH 2CO6B 2CR3A 5D96B 4PRPB 1DLFH 3SPVA 4J3SA 1SEBA 1BFOB 4UB0L 1JE6A 2H8PB 1R24A 2NY6D 3D39D 1ZLUH 4Z7OE 2CUHA 4PUBL 4LHQB 4HUKB 4PRDB 1VFAA 4J4PC 5AAWA 1HHGB 1KOAA 5D1ZA 1FNFA 1U9KA 1IILE 5DEZA 3GMOB 1CI5A 2DWEA 1DL7L 3PV6B 3CX5K 1LD9B 5I1HH 2EIZB 5L7XL 4FQPA 4GG6A 3RJQB 3F6IA 4YDIL 1MRDH 4BELD 5GIRB 1J0YA 1YDPA 4B53A 1ZTXH 1CF8L 1EEYA 3RWDB 2XRAH 4WFHD 5FGBC 4NNXA 3ARYA 4HK0B 1TCRB 1V5JA 4ONOA 1T0NA 1H0DA 4XP6L 1TTUA 2Z0BA 5C0NC 3VXTA 1PGRB 2A9MH 3BGMB 2CMRH 1U2CA 4XT1C 2C4FU 1KTRL 4I0KA 1JZ4A 1I75A 4NUGL 1ZHNA 1UA6L 1MI5D 5EOTB 2UZIH 4R90L 2AJZB 2A83B 3DOSA 3MA9H 5IKCB 4KZEL 2XWJA 3V6ZB 3K74B 1CFQA 3ZT5A 3GSVA 4LSDA 1J1XH 2JCCF 4GG8B 3SDYH 4NKOB 5C0AD 4ZFGH 4JJ5B 4RA0C 3EOTH 4K3EL 5DF0A 3QT2A 4PJDF 1G0XA 1AXTL 4WHDA 5GSRA 1G6RH 3VXUE 2GK0B 4I3SL 5JOEA 4DGYH 5TF0A 4X6EB 4XMPH 3IU3A 6FABL 2G9HA 1TXKA 5IT2H 4WFED 3MCG1 2YPVH 5C08A 1T5WB 2VDLL 2BRQA 4FN0A 3GSRA 4QHMA 4EXPX 3TH3T 3MV01 4K23L 5KW9L 1W0WB 1BOGA 3S34L 1MUJA 4GUPB 4R2GB 3MLWH 3P0YH 5KS9E 2VXVH 3L1OL 4L29A 5GRVL 4BH7A 2GY5A 5FYJU 3E2HB 1JVKA 4GKNA 2BVPA 5DZOA 4YZFE 5I18L 2FJGA 1Q1JH 4YBLC 2MMXA 4L4JA 3MRJB 5J4MA 3IRZA 4L3CB 5IB3B 3GSNH 3WCYA 5C0EA 4B7IA 1F3JB 2OCFD 2DDQL 1R3IL 2Z4QB 3BVNB 1OTSC 5DHVH 4Z5RB 2ZUXA 3LD8B 4LPXA 3Q6FA 1KB5B 3SGDI 2HH0H 2I07A 3QB7C 4YBQC 1B4JL 1OT1A 1X6NA 1YPZB 3MRCB 2DQTH 4PV8A 1F4WH 4GAGL 4X8XA 3RHWF 4DGIH 4N0CC 5D8JL 2YWYA 3FFCB 2VO5A 5I1HL 2XXMB 3I02A 5CP3A 5E6YA 4PREA 2MKWA 1JL8A 5CJXC 2NY7L 4JGUA 3QXDB 3RA7H 3WKNA 4MD5B 5LG1A 3DI2B 5J13B 4JFDB 4HJ0D 2XWTA 1LVEA 2W9LA 4BK5A 2F74B 3GI8L 1CBVH 2BY0A 3FCTB 4AK1A 3OHXB 4KH2A 2DICA 5DC4B 2Z92B 3MACL 4WGWB 4XXDA 3WJJC 4OD3H 2EDJA 3MBEB 1T3FA 1XGUA 2VQTA 4R7NB 1ZA3B 5D7SH 4KRPB 4HV8A 3IDXH 4HGMA 3ARXA 2F54B 2W07A 5FOJA 3PHOB 4BZ2L 4RMUA 1U36A 3KYOB 3PUCA 1N64L 3DRQB 4JVPA 4GXVL 5BVJB 4XNYH 3I2CH 3OGCA 4O5LL 4LHUG 1MFEH 2IALA 1FAIL 4MA1C 2HFFA 3H9SE 4R0LA 2J3SA 3L5JA 4XB7A 5FA3B 4P5KB 2P5ED 4RAVA 2ZCHL 2FNBA 3QPQD 4TQEH 4GW4B 1RZJH 1EUUA 1IGTA 3HI6H 2AV7B 5EUOE 4G7YH 4X7TB 1OF2B 5GPRA 5C08B 4LNVA 2OR7A 2ZG3A 1MHHA 4HEPG 4OIAA 4ZUTB 4R2GD 5ICZA 1LO3H 1LE5A 4Z76B 3LIZH 4L8SA 5DQ9A 3TVMC 4S1SL 5DSCB 1X3DA 2J6EH 5KSAB 3OSKA 3LEYH 1KJVB 1QFWL 4ZFZA 2GTZB 3AB0C 3TA3B 3O3AB 5F21B 2Q3ZA 1LDSA 3FN9A 3B6SB 2HAZA 4F7EA 3FB5A 3QULB 4XGZB 3AY4C 3JV0A 4M62L 2OZ4H 2XKUA 4G6KL 3TYGH 1A14L 4HS8L 4YHKL 4H0IA 4JRXD 2HN7A 3TT1H 1ZT1B 2GI7A 4R6UA 1QKZH 4XP9L 5E9DB 1A6TB 4XNYL 3AU1A 1BQUA 4E42A 4XNXL 4PJAB 4HIJA 3VD4A 4Z18A 3QCUH 3QFJA 3W2DL 2PNDA 4E41B 2BK8A 1OAUH 1KJ2A 1MF2L 1UJ3A 1P9MA 3SE8L 1GIGL 2DLHA 4APQC 3U0TB 3GNML 2AJVL 4D8PB 1QP1A 2EDXA 3AB0B 3CFJB 4P3WA 5GGVY 5HPOA 1A1MB 1DQLH 2MJWA 3IDGB 5A16A 1OPGL 2JB6B 3JXAA 5K9KB 2J6EL 5F3BB 3CJJA 4Y7MA 4LKXA 1AR2A 3ARGA 2F53E 4MXQD 2Y06H 4NC2B 5FV2A 1A8JH 3L3GA 3HZKB 3T1FA 1HHKA 3ZL4L 1NMAH 4Y4FD 4Y4HC 5KVEL 3PWLA 1WT5C 4AEEA 1ADQA 1EFXD 4R7DA 5E8EB 5IBTH 4MA1B 43C9A 3LN9A 5H94B 2RJMA 5JPNA 1ZS8B 1JNNH 1SJEA 4G6ML 2XTJE 1RK1B 5I1EH 1A4JB 1KNOA 2EO1A 3U7AA 2DWDA 5I30L 3CDGA 3P73A 3HI5L 3ARFA 4MQXC 4ZD3H 1ZGLP 2W59A 1U41A 4L3CA 2BCKA 4R4FH 2VISA 2E3VA 1X5HA 2ED8A 3HUJE 3VI4F 3ZHDA 2R0WH 4LLMA 5E8DH 3C09C 1LHZA 3MXWH 3MGAA 2CJUL 2R23B 1VACB 4HUUA 4K3JL 4XAKD 4CDHA 5I1AA 4ODUA 3MNWA 3S36X 1LP9E 3TBWA 3VFUA 1P7KA 3QSKB 4OLEA 2FIKA 1S9KC 2LTQB 1UM4L 4KQ4H 2NXYC 3PXJA 4XVUC 1A6VH 4UNTA 2FHCA 2ZUTA 5EIVA 4MMZC 4F7MA 1T2JA 5C6PB 2WIIB 4NNPL 3WSQH 3O2DL 3ZTJH 3EYVB 3WD5H 1UWGH 1F02I 1V7MH 1BGXH 3ZLQC 3MV9D 1XGRB 5L2JA 1RZKL 2DLTA 3IETA 1EMTL 1KUMA 3HMXL 4XTRC 3AROA 3QEHA 2VXTH 3WDJA 1N7ML 3SPVB 2IBZX 5FF6B 1F6LL 3SDYL 4FNLL 5I1LB 3GO1H 5LGJB 1B2WH 5DJCA 5FUOL 1VSCA 3IVKA 1P2CA 1LP9F 1JWUA 4NRZA 2NZ9C 4MGXA 1YN6A 3RBGA 4FZEH 3QWRD 3S3PA 3QQ9D 1PZ5A 3MTRA 4PRAB 2ATPB 5FYKD 3QWQB 3VH8G 4P2OC 5I8CB 3NFNB 5C0AB 1WAAA 3QAZC 2ICWA 3SDXE 5JOFB 4JFXA 1IC7H 5CJ8A 3HZKA 3AUVA 5E8PA 5TQ2L 3DECA 1WWWX 1FO0A 4M48H 3GB7A 2W91A 1U8HA 4DKEH 4J3XA 1J87A 1VCAA 5FB8B 4M7KH 1W0VB 1AP2A 3DTXA 1G9ML 3H2WA 3ETBF 4P23B 1OTSD 3BD4A 2BSED 2X1PA 5I9QC 2P24B 1IGCL 4KJQC 5DI8B 3UJJL 4MNQA 5EO1A 4ZFFB 5KSBE 4JPWL 1VFAB 3DUHA 5EOTA 5HHXL 4GAYB 4Q7DA 1QRNB 2APTA 3HB3D 1Q0YL 3B9VA 3O3DB 2CGRH 4KRLB 4ORGB 2ZPKH 1WBYA 3MLRL 3A6OA 2H2SC 2QADB 4NNYA 1U8NA 1T2XA 3MA9L 5SV3A 3WBDA 4LRNH 1S7VA 4J3VA 1X7QB 5B38G 3LKPA 4EUPB 3BZEB 4OCRL 4TOYL 1P4IL 5HSFA 5DD5H 2YBRA 5T1KD 5J89A 3OAYK 5E5UB 1R0AL 1E4XI 1NGXB 2HJKA 1AD0B 2OM5A 3LS5H 5DD6B 3MV8D 4LIQL 3TVMA 4LCCA 5CLTA 3NFPA 2ZNXA 3I6GA 5L2KE 3H3BC 2PXYC 2X70A 1Z0MA 1F5WA 1E27A 1JPFA 1RIHL 3HG1D 4X4MA 4JFZL 5L2KB 3CFKA 3QUKB 5I1KH 4PR5A 1GGIH 1FCGA 1S7RA 1VDGA 2VDOH 5DC9B 5FCUH 3UTTA 1Q94B 1RIVL 4IJ3C 1IGJA 1A0QH 1MJJB 3GIVB 2NY5L 1A6ZA 5MEQB 3BW9A 3CIQA 1QFPA 2PCPB 4MJID 1M71A 2YWZA 5E8DL 3IXAA 1TTFA 3WFDH 5IEHA 3KPQA 4MHHI 1E4XH 5C0EB 1RUAL 2DN7A 4LVEA 4UB0H 5H37H 2CLZA 4FXLA 5F1NB 1CICB 3GSQB 2FYYA 1HILB 2Q87A 4WHYH 3RL1A 3BRDA 2R2CA 2EDYA 3ESVF 5CIPA 5IF0A 2OXGA 1L6ZA 3CMGA 1IEHA 2XYCA 5F7LB 5T3XL 1GHFH 5D7IF 3H7BA 2PW1B 4HUXB 1FAKT 1YEHH 4QRRA 1HSBB 1OB1A 4F33B 1K5NB 3TM6A 2KL6A 1MUJB 3B5TA 4O2CB 4Y5YA 5E7BA 3KWWA 1I9RL 3B9AA 4Q9CA 4GAJL 1OSPH 2W0FB 5DS8A 1FGNH 4ZXBD 2X10A 1M6OA 2PN5A 3CDCA 4XZUA 5FB8A 1K6QL 5C86A 1HZHL 1I1CA 1XFPA 4LCWA 3GJEA 2VJXA 4MJ5B 4I3RH 1RZIB 3QA3B 4Z77A 3DROA 2DQGH 4DGIL 2CDGA 4N8VG 1IM9D 1JZ3A 5FYKH 3NOIA 4PJ9C 2NLJB 3HNSH 1HEZB 2QQNH 2IQAB 2UUDH 1MREH 4RWYH 5FCSH 3EOTL 1S5HB 4JDZB 2FX7H 3K81A 4B0MM 3EJJX 4FQCL 4Y2DB 2Z31B 3O11B 3VWKA 4FG6C 5KVGL 4ENED 3RY6A 4YHIA 3MYZA 5E8OA 4YDKH 1Q72L 1FZJA 2GCYB 2HFTA 4MD4A 5C3LD 5DJCB 4HWEH 3FN0H 1I3VA 3WHE0 3MOBL 3RVUC 4L9DA 4GLRH 5GRYA 2KZ1B 2WANA 3MRNA 3LQZB 4M1CD 3MJGX 1A6AB 4JQVA 4KK9D 3BIBX 5EU4B 3IDUA 3SJVB 5JXEA 5KN5B 3STLB 3H3KA 1HHKB 1E4WL 15C8L 1S7TB 3JVGC 1ZOXA 4FQJH 4DZ8A 2C5DC 2IAMD 4M7LT 1KIUA 5HXMA 1A7OH 5DUBB 4QOKA 3DNKA 3TBTA 3IRPX 2Y72A 4AL8L 3MLSL 3MRQB 2J8UB 2VR9A 4KKNA 4M7JH 2JJTA 1LNUA 1DBKL 5JO5A 1DBAL 5I8OH 2YHGA 3B43A 4GRLA 5CEZL 4AIZA 1JI2A 2NY3D 1A6VL 2VLLB 2FRGP 2UZYB 4KV5E 4P2OD 5EIIB 4YHYC 1KSRA 5D7KD 2IBZY 4HUVA 1KB5A 1GOGA 4ALAH 1T83C 4H25B 1MPAH 4E41E 4XBPB 1IGMH 3R1GL 3HI1B 3V8CA 1KJ2B 1UJ3B 5CIPH 3TIEA 2K3TA 1RZ7L 3GJFB 3HC3L 1KXVC 4XWGH 3DSFL 5HI4C 2BVEA 3VXOA 3CLEH 3P4OB 2XG5A 4ZFZB 4Z7WE 4OLWH 5JHDB 2IF7A 1EHNA 4C55A 3IXTB 1S9YB 4HKZB 3CLFL 4E0RB 4G8GE 3VFGL 1X4YA 1QYGH 3WNPA 4HIHA 4PJEF 4F7TB 1PEWA 4H8WH 1CDGA 1FPTH 2BFVL 5DK0B 4FQIL 1CFSA 2B4CL 1VGKA 2R1WB 4QTHA 1U8PB 5L9DH 5T1KB 2VLKE 3OPZL 3QQ4A 4LCUA 3WKML 3IKCA 2JCCA 3L5XH 5ERWA 1JGUL 2R2EA 4PJ7B 4V2BA 5I8OL 1EFXB 3LKSA 3QEQB 5FYKL 1ORSB 4HEME 2X4OA 1P4BH 1S78C 4JFFE 1RUKH 4OQTL 5H35A 2D7NA 2CRZA 3AFLA 5FA4A 3HG1A 3H9YA 1LEIA 3SKNA 4PY7A 2NY1B 4K8RH 1LO4L 3QO1B 1FFNA 2EIZA 2QSCH 3RKPA 1AQKH 4UBDC 5GRVK 4BJLA 5JW3L 1U8KA 1FQ9C 1NCUA 1H3TA 4CADA 1UH2A 2EXWD 5I8CA 2RCSL 1NBQA 2YC1B 2YD6A 5EU4A 2XFXB 2RAMA 1BLNA 3C8KB 3W2DH 2YRLA 4R9HA 5DD0L 4R96A 4RSVA 4U0RC 3U7WL 1I4FB 4JKPL 1A6WH 3GSNA 1GC1H 4MNGB 1CIDA 4XBEH 4DK3A 3LS4L 4W6YB 2LFGA 1EGJL 1U8MA 3CK0L 1WEJH 3RUGF 3JBG7 3TV3H 1WFNA 4PGBB 4L8DB 4CNIB 3WL9A 5CBEB 4OCSH 3S3SA 2WBWB 1Q9OB 4URTB 1TNNA 5J1TC 3FB5B 2X4RB 3VXQB 5D2LB 4X80L 1NAMA 4D3CH 1JPST 3SDCA 1YMME 3WLWD 2VXQH 3R4DA 4OQTH 2G5BA 2WK2A 1KCVH 4BQ8A 2ZOLA 1OAYL 2DKSA 2ADFH 4O9HH 4ORGA 4AIZB 5IM7B 1V05A 4PJBF 2EKJA 3K1KC 4XP4H 3WNOA 3R0NA 1ZWIA 3D0VA 3VW3L 2IANB 2L7JA 4HDIB 4L3AA 5HHOE 3RY4A 4DVBA 1SMAA 5E00A 1L9MA 4LDOB 4LVHB 1E4WH 5DMIL 1YY8B 4IDJL 3VRJA 1PVHA 3VI3F 5KSAC 1IVLA 5IB1B 4Y2OA 5K59E 3HG1E 4YHIB 4GRWF 5ADPH 3CLEL 2XOTA 4OFYD 4Q9BA 4KVCH 1KIPB 2VN4A 2KZWA 1NH6A 2OR9L 3VWKD 2BVQB 1CD0A 1G7QB 4K7FA 2D0FA 1MRCH 1TJGL 3TT3L 4GKNB 4O58H 1MCCA 3EO1A 5GRUH 3QIUC 4KMTL 1PY9A 4P5MB 1RQ5A 2BSTB 3T2PA 5GGRY 4JR9L 4LHJB 1YC8A 2QQLL 1RAMA 1PYWA 4Z6AT 3CFEA 1WBZB 2H9GB 4I9WE 4P23A 1SEQH 5EULV 2J8UA 1BM3H 2E9IA 3HNTH 3VRIA 1RVFL 3JTTA 1NC4D 4HX1B 5I17A 3SCMB 1BX2A 1HH6A 4AT6A 1I9EA 5EBWA 3M8OL 1A1OB 1WWCA 5KSBB 3D3VE 1LEIB 2I07B 1BM3L 2Y7QB 4JRYE 4JQVC 4GRWE 4YO0B 4JY4A 1P6FA 4G6JH 2NY2B 1A4KA 5HDQL 4QF1B 5SWZE 4P46D 1JN6B 4M48L 1HSBA 4H1LH 5IQ7H 5IWLC 3SE9H 3SOBH 2VXUL 3LKRA 4HQQH 1RK0B 4MA3A 4TUOA 5T3ZH 4G9DB 4OZGB 3TIDA 4XMKH 5DVKA 3QISA 1HHJB 4M6NL 2R0WL 4ELKA 3VI4E 1MJ8H 5DQJA 4EQ3A 5DQDH 3K0WA 4P2OA 5F6HJ 1HXMB 3D1MC 1P4IH 3G6JF 2LQRA 5L8KB 3WLBA 1M7IA 1K4DA 4QHUB 4AEHH 3MJ7A 3Q1SL 5D6CB 5BVPL 1OD9A 3QIBA 1MCOL 5EA0L 5E1AB 3LDBB 3U83A 3RWEA 4YFEA 4Y88A 2NYYC 2O5ZH 3NZHH 3SKJL 3KPRD 4HH8A 4IOSD 5TE4H 2Z93B 1XH3B 2MNUA 4EVNA 2C26A 2DIBA 4S1QH 1ZVYA 3IDIB 2UZXB 3X13A 2XACC 4PJXB 4FQLH 4GAFB 5ENWB 3GUTB 3DBXB 3EHBD 1JGVL 1NGXA 4NC1E 3NPSB 1PLGH 2D7TL 3ZSTA 5JIKA 5J1AA 2W9EL 2J7LA 4JGMA 4WEMB 5AWNH 5GGQH 2IEPA 1F11A 2NQCA 5F70A 4Z8FL 2X70B 3C09B 5E6ZA 1U3ZA 2ERJC 1ZHKB 4MWFB 5ESQB 3V4PL 1NDGB 3QUYD 4PYHA 5TGBB 2VR4A 3SQOL 5A2KH 1NEZG 1OP3H 1HKLL 3BP6A 3VCLA 1R3LA 2FSEB 2WAHA 1HQRA 3SDXF 2DLIA 1M71B 1DUZB 1PKQB 1AR1D 2GSIB 4PJFB 3RWFA 4F7CA 4WTZA 5HYJD 3PWPE 5IVZB 2MPAL 4LLDB 3FAXA 4LP5A 1I1AB 4X7CC 1X5AA 4NO3A 5F71A 1DQJB 2HTLD 2YUZA 5IGXH 5GS2H 2HG5A 1NQBA 3FT2A 4GKSB 2E27L 3DI3B 5GS0D 1H15A 5EZOL 3PL6D 4NGHH 3D39A 4RZCA 4WW1A 4Y19A 3D39E 1JHKL 1NFDB 2PW2B 3IDGA 4NQDE 3LQAC 4DVBB 4M4RA 2A6JA 4QRTA 2X4TA 1J8HA 3AS0A 1S9YA 4OLVL 1WV7T 3MXVH 4P2OB 3R8BB 2X6MA 4ODBD 5E2UL 3RQ3A 3GSOB 3PWPA 3QNZA 5I2IA 4Z7WA 3WFBH 1JK8A 3BGMA 2IAND 2QJDA 1MF2H 3UMTA 5E1AA 4KTDH 1UJ3C 2I9LB 2WBJB 1F4YH 3QIWB 2D0HA 3J7HA 4BK4A 4BSVB 1F4AA 2KPNA 4Y4KA 4AM0A 1JNJA 4DCQB 5EBLA 3HR6A 3ESUF 2V7HA 4I3GA 2FHFA 1QTYT 2QHLA 3MXVL 2OMNA 5HGDA 5I76B 5FYKE 3TA3C 4M7LH 5E8NA 2D9QB 2AEIT 1G7HA 4K9EH 1V7NL 5DRZB 4Z7NE 3BDYL 3V4PH 5B3JF 4P9HL 1WWBX 4GW1A 3MV8A 4M5ZH 4U1LA 5BJTB 1DDHA 1WIPA 1YNTB 4NQSA 5DK2A 1IBGL 1PLGL 4H1LB 4YPGA 1YEKL 5C0AE 4AL8H 2C9AA 4BSWA 5F9AC 3H9HA 3DV4A 3GB7B 1JNLL 3ARDD 4XAWL 1X5IA 4ONGL 5TDNA 4L5FH 3QO0A 3UYPA 3N06B 1KPVB 3A6CL 4KDVA 1QNZH 1CFNA 4UIKH 1B4JH 5JHDE 1NDMB 4DEPC 1MWAL 3MV7A 4I1NB 1OT2A 1PAMA 3D18A 1G6RB 4LSVL 4XRCB 2ZCHH 5E2TH 2I60H 1XCQB 4UQ2A 3RTQA 2K9UA 2FZ3B 2NNAB 3T0EE 5EORL 4BQ9A 3MA7A 2P44B 3GHEL 4ZSOE 4ZAKA 1K4DB 3KPRA 2ICWI 1BIHA 5EZIL 1XAUA 4NO0D 3FO9A 1U8IB 2A1WH 3QCVL 2BNRB 1AKJB 1N64H 4XC1H 2DL9A 4HS8H 4J23A 2AK1H 5HHNA 1IZJA 4PJHF 1NFKA 3IDJA 2IBBA 1D9KC 1XF3A 1JP5A 4CN4A 1VGEH 4NQCA 3QEQE 3CPLA 5DJ6A 3T08A 1OLLA 5K9QI 5D7JA 1YUHB 1J9CT 3MZTA 4NZRL 4LLWA 2EYTA 3WJJA 1L7IL 3LIZL 1IGFH 2Z8WC 3ARBA 1RUKL 1GYAA 2WBKA 2NYYD 2OTUA 3FFCD 2YD3A 1AO7A 3M8OH 4L9LB 3S37X 4DVRH 1S7RB 3GDBA 4ZNCD 1JRHH 3BP4A 5CEXB 4TSCH 1T5WA 4PRIB 4LLYB 5DK0A 1FO0B 2W92A 1EXUA 4HFWB 4PRHA 4F57H 4HUWB 3HR5A 1FPTL 3MOQA 5EZIH 1E4KA 2EDNA 3FKUS 1ZT4A 2I9LA 2RGSA 3MRQA 5FYLH 2NY3B 5BV7B 2R15A 1MEXL 2H8PA 4DCQA 4QXGL 2BP3A 2ICEB 4BYHA 1EBAA 4XWOC 4X9BA 4WWKA 3CCHA 1NCBL 3L7FB 4MQ7A 2ZCKH 2FJFA 1O0VA 4G6MH 3W39A 3T2NL 5DFWH 4JN1L 2JJSA 2M26A 4NN5C 1CTOA 2KUTA 3MR9A 3WN5B 4P5TC 1KELH 1U3HB 5JDJA 4JPVL 4U1HB 2X7LA 4GW5A 4WI3A 1HWHB 1JYNA 4RX4D 3TIDB 3EDEA 3BESR 2P8MB 3OKEA 4M7ZC 2X9WA 2FO4A 3UCRA 5K9JH 1HIMH 1NEZB 1AD9B 3KJ6H 4KI5F 1CFNB 1FSKC 1IARB 1GJIA 5H8DA 4MSWA 5EU6D 4TNWF 3BDBA 4RMQA 4DGYL 3MOAL 2NX5B 5BOZG 4Z7WF 4ETYA 3L5WA 1XGTB 5DD3H 4PR5B 1PDKA 5IESH 5TF1L 4HG4J 3V4VH 4G80A 3S9DB 4PP2A 1OAUL 5EU3B 1JPTL 3PL6C 2HTLC 2N7BA 1A9BA 1NSNH 3LCYA 5I1DA 3UTSE 2I25N 5F89A 5C09D 3DYOA 5F7HA 1A6UH 3MLVL 3CXHJ 4GH7B 4LRIA 3U6RB 1GZPA 4P2YA 5ADPL 4D94A 3MRGB 5DHVA 4HJJL 3W81A 5IBUG 2BZDA 4KRNA 5DRXA 1RIUL 1UFUA 4QEGA 1T04A 2VIRB 4JFFD 4PJ7E 1CQKA 5FO8B 3NACH 3H7BB 4G5ZL 4EUPH 4YO0A 2B8OT 1FFNB 1CU4H 4K23H 3F58H 4LL9A 2FX7L 4LSRH 1FNEA 1IGIL 3DGGA 5E99H 1ZTXL 3CXDH 1YNTA 1J05A 4Z0BL 1G0DA 4KMQA 1WZKA 3P30H 4L3EB 2QKIA 4ZUUB 1F3DH 1B88A 2WWKO 4XPBL 3K4DA 1L9NA 1XCTA 1M6OB 1P5VA 1T1XB 1P53A 1BD2D 4U4BA 5GISL 4JFYA 4S11A 4NO5A 3VU2A 4K3EH 1WIUA 3JWOL 5DLMH 5D4QA 2P8PB 4X0KA 5AUMB 4JN2A 2XKSA 4ZAKD 4FA8A 4RGMC 3HS0A 3ZYIA 1OGTB 1BEYH 4KJWC 4NO0A 1TLKA 5FUOH 2IH3A 3VXUD 1KGCE 5I66A 2XN9A 2PETA 3HTLX 5ACLA 5CP7B 4W68A 3KPRB 1IAKB 4GKZA 2XA8H 3OJDA 5CGMA 2YSSB 1H8OA 5F96L 3VXMA 4O51B 3TN0D 1J86A 1MRFH 5GS0H 1MQ8A 43CAA 1EBPA 5CZXD 3PE9A 5E00B 4RGMB 3GEWB 4LNRA 4BQ6A 4L5FL 2VLJB 1EVTC 4TPRL 2P5EE 1HNFA 3H9SA 4HK0A 2P5WE 3GSWB 1I1RA 4RGOH 4X6EA 5ICXB 4L9LC 5JMOC 4KKBC 2YPVL 1AD9A 1OOAA 4X6DE 5CSZA 2IANE 4KJPD 3T3PE 4EIZC 1CICD 5H37G 1HHIA 1U3YA 3C2AL 4MWFA 3BSZH 1JPSL 1QSEB 2HKFH 3MRLA 5DT1L 4WFHE 5FGCE 2ZZUT 2B2XH 1ZK9A 5DRWA 3BN9C 1K3IA 1AQDA 4JFZH 1FRGL 1RZ8B 4DKAA 3BGAA 4PFEA 5EB9A 2ITDA 1NUNB 3ARBD 3D85A 1KCRL 3RX7A 2A77L 3UBXB 4O58L 3V6OA 2Q20A 1BFOA 4JRYA 2RQ8A 3A6BL 2QSTA 1WZLA 4K8RC 4CGTA 3THML 5DURD 2B20A 3NFSL 3MCLH 1F00I 1ZA6A 3I3BA 2A73A 3FRPG 1LO2H 3NAAL 2LAAA 4JFHD 2P7TA 3THMH 1NL0L 3NIFE 3GSUB 2JJVA 3S35H 5HGBA 2VXUH 4HQQL 4BSWB 1FZKB 2CH8A 1YQVL 4JM4L 2OK0H 3D39B 1WFOA 2P45B 3WYRA 3DO7A 4HG4K 3VXRD 1A6PA 2F58L 4NKDA 3OL2A 4NWUH 1TCMA 2QQKL 4YDIH 2IWGA 3PWJA 3Q48A 4F8TA 5D7LD 2CKBH 2FD6H 4OF7A 1WIOA 4RWYL 1Q9WB 3TBYA 1W72H 3I9GH 5HDOA 2DYPB 1GZQA 5DWUL 4NOBA 2AERT 3UPCA 3G6JE 1U95B 3E2HC 1UB5A 3N85L 1NJ9B 3EFDL 1AKJA 2HYMA 3MRIB 1A7BA 3NCJL 3QCUL 5IMKB 4BFIB 4ODVL 4ZUVB 2O5ZL 1JGEB 4NO2A 5IVXB 1N4XH 4PV8B 4HIXH 2DLFL 3OJDB 3B5HA 3H0TB 2FB4L 4WGVB 4RNRB 4HC1H 1A02N 4G6AC 5JXED 5MEPA 1DQDL 5CBAA 1INDH 3GMPA 5C6TL 1MLBB 2V5MA 2B0SL 3L3IB 5EUKB 5CCKH 3VXRA 5FIEA 2VWEE 4KKLD 1BVKB 3CVHH 3DVIA 1QBAA 3C08H 3SE9L 3HE7C 1PSKL 2A77H 2CLVA 4I9WD 5MEND 2NY0B 4Z76A 5T5FH 2GJ6E 5T1LD 1J05B 2APBA 1YEDA 1BD2A 3HC4H 5H94A 5EC1A 3RVTD 4RAUA 5SX5K 4AJ0A 3TZVA 1BAFL 2R29L 1K8DA 5I1CL 5F8QC 3RY6C 4LQFH 2BNUB 4RDQF 2ICES 5F97E 3GHBL 4KROC 4LPWA 3KG5A 1NGPL 4YFDB 3X12B 1I1AA 4RAVB 2JE8A 1D5IL 4PRBB 5C70A 1GC1L 1IGYB 2AEPH 2IC2A 4MJIB 4ZFOB 3WNKA 2PXYA 2A9NL 5GXBB 1XEDA 4WWID 4DKFH 3BIAX 2NXZC 4LKCB 3X3GL 3RIAF 5LQBL 2Q86A 5DFVC 3DSFH 1IAKA 4RMVA 3HA0A 4CN6A 4Y4KD 4K3DL 3ZT7A 1V3JA 3DUSB 5D7LB 1A1NB 4M03A 4DFIA 2WINA 4Y4HA 4WHTB 4KZDH 2IH1A 4XVTH 3O3AA 3EFFB 4TTDD 2P8LB 3WS3B 5HDQH 2Y36L 4KI5C 5F44A 4MZ3A 5CSZB 4W81A 2OJEB 35C8H 3S97C 1NC4A 4PP2B 4XPFH 3T2OA 1FV1B 4JAMB 4QNPF 5DUMH 4HFWA 4P9MH 2XZCL 5CGTA 4RGND 4WO4D 2D3VA 4H8WL 3IDIA 1J88A 1IAMA 2YD2A 2Z35A 1OQXA 5MP6H 5I73C 4NQCB 1I1YB 1QFWM 2CQVA 2DD8H 1SBSL 4X98B 4NC0B 1TJGH 3IVKB 3WJLA 3UTSA 3MRPA 3MLUH 4KTEH 3LD8C 1A4JA 3TBSA 5AZEH 3WO4C 2CIIB 3KLDA 4O2EA 3CSPA 2XKNA 5C0IA 4Z7OF 1AC0A 4PIRF 4RISH 3KR3L 1W2KT 3GM0A 3G5XB 4NM8H 4S1DD 1OP5K 3QIWC 4U31A 2Z31D 3IFPB 2PTUA 3CVIH 2C4XA 3QUXD 5JDSB 4CMMA 1MFBL 3HE6B 5BXFA 4P2RD 3VD9A 1MSPA 3ISWA 4NZJA 3C2SA 5HYSA 1EK3A 1RUQH 3CH8A 5HYJE 1RZGB 2VLJD 3BZDA 4OZ4A 1V3LA 1ND0B 4TVPE 3B9KC 4ZO8A 1T03L 2R4RL 4DK6A 43C9B 4BA8A 5DR5L 4QHKI 1RHHB 4UQ2B 3VXRE 3ULUF 3AXLB 3GMNB 4UT6H 4NQVB 4CVZB 5JO5B 4JFDE 5D7LE 4LSTH 3V5DB 1S7SA 1IGFL 1NUGA 1G7LB 5MERA 2CRMA 1QO3A 4UI2A 3WFCL 4U1NB 5CSBA 2C1OB 4Y2DD 5IHLB 1NCDH 4JM4H 2OK0L 1VACA 3QUYA 2DQUH 4KDWA 3DRTA 3RP1A 2CDFA 2PYFA 1UA6H 1D5MA 5C0RH 1HDMA 1IQWL 4QOKE 4X7EC 3UBXI 1UEMA 4PJDE 4D0DA 1XR9A 2ZJSL 4TSBL 4ERSH 3HUJF 4KK8D 1B2WL 1KBGH 2WUCL 1HK6A 2F5BH 2UWEF 1MCBA 3E0GA 3V6OE 2CKBB 3QNXB 4R7NA 1MFAH 4WW2C 4G3YL 1I7ZB 2MWCA 3E3QE 2EIBA 3TN0B 3U79A 2WV3A 1A6AA 4N0UE 3QIWA 5F72S 5J7CC 4K94H 3MROA 4PY8J 5HJ3B 4JHAH 4DTGL 3G9AB 5IB2A 5D1QA 4UTAH 3QYCA 2PO6D 3MLXH 4OI9A 1UXWA 4GMSL 2R56H 2R69H 1HYSC 4MD0A 1YEDB 1L0XA 4YWGH 3VFTA 1PG7H 5CWSB 4JFHE 3EGSB 1IC5H 3VE0A 5I0ZA 2LTQC 4ZOEA 3IU4H 1JPGA 1ORQB 1RY7B 3PDOA 4KFZC 2OL3H 1BBJA 4LBEA 3O0RL 1PZUB 4MQ7B 5C0JA 4WI9A 4NQEB 3ECBA 5D8JH 5KOVC 2J88L 3IS0X 4UTAL 3F7VB 5EBGA 4TSAL 3P4MB 4TULH 1CR9H 2DQHH 1R3JA 4G8FA 4OZFB 2YOCA 3HE6D 4DAGL 4V1DA 4LLUA 1GIGH 2ID5A 2NW2B 1YECH 1C1EH 5GGSY 3K7UA 1DBBH 4EJ1C 4A2MA 2WWKT 5TPWL 4HMDA 5DD1H 2OR9H 1I4FA 1RJYB 5GHWL 2F5BL 1CL7I 2Q8AL 3OMZA 4ODTH 3UO1H 3NA9L 2GHWB 3DXAE 2HT4C 3TO4B 3D0LA 3V7MA 5IIEB 1ITCA 3RKDD 1I1FB 5EO1B 1DFBL 1A64A 2XA3A 5HY9A 2LV4A 3DUUB 3KYMB 3C5ZC 3ALWA 1Q94A 4PLKC 2NZ9D 5IVXA 5DJ6B 1QO3B 1S5HA 3PNWB 1VFMA 5INDB 4NQTA 4QCIB 4ONFL 1MQKH 3ARFC 5BS0B 5BQ7B 3D0VB 1BVLA 4RFNB 6FABH 4OLYH 2A0LD 5F1IB 3U9PL 3BKCL 1QR4A 4EOWH 4DW2L 1QSFA 5A43C 3PWNA 1CYGA 4LKXB 1FYTD 1RULL 5DJYB 4JDVB 1ZLWK 4NBXB 5HHQB 4XCEA 3HC0B 1RIUH 1N6QL 3W5MA 2V2XA 4GO6B 5IW1A 4P59H 4KI5D 1KXQE 3IJSB 4X6CA 1OB1B 4XPTH 4LARL 3UPAA 2H32B 3OR7B 2A38A 4R0LC 4XCYB 2AXJA 4AYFA 2FWOB 1FN4A 1ZLSH 4JB9H 3MSPA 1GPOH 5ILTL 3BH9A 2OZ4L 3Q6GH 4XC3H 3RVVD 3SDAA 2QSVA 4OZGF 1SY6H 4E5XB 1Q9LA 4UIMB 2X4SA 3OTTA 5GGTH 5JNYA 2FGZA 3NCCB 2VSDA 4NKIH 1QSVA 1G9MH 2ZKHL 4JN2B 2DMKA 4TVPD 4APQB 3MBXL 2P46B 1FVEA 5D1ZC 3W0WE 5EBWB 1WC7B 1QQDB 3IDJB 2OL3L 2MFNA 1FZMB 3ZO0A 3W0WB 3MFFA 1RIHH 4JFDD 4N8CL 3NCMA 4NZUH 3CC5B 4H8WC 4NFDA 4F33A 2HKFL 4UUJB 4JVUA 3DO7B 1HSAB 4WW2F 1H8NA 1EVUA 4HXAH 4HZLB 1PQZA 1FZJB 1KCSH 2X9XA 3X3FL 4L8BB 1UKQA 2E7HA 1CN4A 4N1CA 4KZDL 4YXHL 3I2CL 1H0DB 3IJYA 3IDMB 3QHTC 5T3XH 5GZOC 1BQHG 4D9LL 4JFEB 5CLWA 1DZBA 4PRHB 2YPKB 3T3PF 2IG2H 4POZD 1IM3A 2AJ3B 1JNHB 3E6HB 5D9SA 4NFBA 3BPNC 1G84A 1P84J 1Q8MA 4BFIA 5I18H 2XZQH 1JGEA 3B9KB 1U3JA 32C2B 3BQUA 5JOPE 4DEPB 5IQ7L 1J11A 3EOAB 5HHVL 1G7MA 4YBHA 3B9DA 4PV9A 4RX4A 4PLJD 4JRYB 4HJGA 1DEEA 1CLYL 5HHPA 2YKLL 1QRND 3G6DL 4HPYH 4MDIA 1WFUA 1FNEB 3AGVA 3MUY1 3F12B 1NMBH 3D3VD 3MPCA 3PL6B 3BMVA 1DE4B 2Q7YA 4WO4B 2R23A 4HUUB 4XPHH 1QR1B 2IAMC 4M9OA 2E7BA 4IRSB 2BY1A 4ZYKA 2HKHL 5FYJD 1DBML 3ABZA 4ZOAA 3OWEA 3H3PH 1EO7A 3RGVC 5LWYL 5TE4L 5IJKA 1A1NA 3MRDB 2X1QA 3ZE2E 2AJSL 1J1XL 2DQFA 2ZOKA 4R26L 4J12A 1YNLH 2XTLA 4FQHA 3BT2L 1T6WA 1HQRB 5J13C 4NQED 5SX5H 3BH8B 1OAXH 2VQ1B 4JPIB 4OFYA 4XP5H 3TO2B 3WUWB 4J3TA 2VL5A 4UT9H 4G80B 5DFTA 1AGFA 3QUZC 1P5UA 3C6LC 5EO0B 1A2YA 1TQBB 3PWUB 3KPOB 1SVCP 5IB4B 3VXMB 4PRBA 1EAPA 5GGUB 1ONQA 1DSFH 4HS6A 3WO4B 3DX7A 3VFPA 1QFHA 1QQDA 3O2DH 2ADJA 1P7HL 5ANME 3V4VL 2B1AL 2ZP0T 1OW0C 2AVGA 1S7UA 3CFBB 1VEPA 1OP3K 4ZPVB 5DJZA 3QUMH 3FQRB 4W70A 4C4KO 5IWLA 4UUJA 5E2JA 2BOBB 4ZNEA 4I48B 3LZFL 3OKKB 2VITB 4KV5F 4PY7B 2NXZB 4KHXH 2MQCA 5CBAB 2YD1A 1Y0LB 3GNMH 4JHZA 1NGZA 5EFIA 2GITB 2V2WA 2XZQL 1FL6A 3IDMA 4YAQA 1AC6A 4M8QB 4CAGA 1TZHB 3IFNH 3I3EA 4N0YH 2PO6C 3W9DB 5IUSA 4KMTH 4J4PA 4ELME 2BHYA 1CE6B 4O4YH 1YNKL 4EXKA 3RWHA 3T2QA 1KACB 3WE6A 4NN6B 1FIEA 3DXAD 2K7PA 3GRWA 4GLRI 4BUHA 1IAIL 4ELMB 5D93B 4R4NC 5I30H 3HRZA 4QHLB 5DD3L 5IEKB 3MZGB 4FMKA 3C60C 3L3DB 1BJ1J 2WUBH 1IL1A 3QFDA 1LWRA 3P0VH 3ME0A 3F62A 3I75A 4U1JB 1KPRB 2NY6B 3MRKB 3V6FB 1LO3L 4L4VD 5A2FA 3DO3A 5J12B 1JN6A 4HK3N 5LCVH 4L3ED 2QHRL 4FFYL 5JPMB 2EC8A 1OP5H 1RMFH 2VMFA 4NQDB 1FZMA 1Z3GL 3EJYC 3KLSA 5JQ6H 1XF2A 3H9HB 5C09B 3ZDZE 4WU5A 3HNTL 5C0CD 4IOIB 5C0ND 1KPUB 1AD0A 5J6HB 4WW1B 4Y19B 3ES6B 2CJUH 4P3DA 4I77L 1A47A 3DUSA 4APQD 1RFDH 3X17A 2DYPA 4I8DA 2R2BB 2VAJA 2AEQH 2HMID 4OV5B 4MXVF 2NY4C 2E7LC 1S7XA 4FQHB 2V17L 1EGJA 2X4RA 1ZHNB 2DLEA 4L8BA 3VXQA 4OCSL 1C5BH 3T1WA 2ARJB 2HVKA 2CK0L 2HJFA 3SHSA 2MQ0A 2F5AL 4JZJC 2VDPL 1XH3A 2WQRA 1ZT1A 4Z7QE 5EUOB 3QH3B 4RFOH 4EN3B 2PYEB 1ED3B 4XB8A 4MNHB 2RHEA 3P4NB 4HKBB 3S36L 2EEAA 1BPVA 3B5GA 3OKNA 4JDTL 5BQ7A 5E8OB 2WP3O 4AEIL 1VPOL 1NCDL 1O7VA 1RULH 2CO7B 3KDMA 2FYYB 3MRPB 1FFOB 1T4KB 3TZVC 5SWSB 5T3ZE 5FGRA 3VXSD 1J8KA 5D1QC 2Y07L 3LSOA 3LPFA 1NPUA 5FYKU 3QXVA 1I9JH 4OJFL 2YRPA 4CVXA 3MV8B 5T3XE 3REWB 1W0WA 1X5ZA 5FAAA 3ARGB 3NMEA 2G2RB 1A7RH 4TUKL 3O6ML 4OSUL 3PGCA 1OF2A 2IPTL 3EUUA 4K55A 5HJ3A 1IGIH 1MCQA 5HGAA 3ILPA 1J1OL 3KPLA 4JO1L 5HYSB 1Z5LA 5D2NC 4XC1L 4Z7UA 2Q76A 1VFBB 1EA9C 1JGDB 1X4XA 4U1SB 4FZ8L 5HI3C 1MWAB 1NFDE 5HYFA 4D0CA 4G8GB 2VC2L 4QRSB 2K7QA 5IB3A 5C07A 5JUEH 2VKXA 3SGEH 3BPCB 3FTGB 2DQIH 3TNMB 3C5SB 5LJYH 1KCUH 1N26A 1MCNA 3MCLL 3PGDB 5CZKA 5CS7A 3KPOA 1IKFL 1U8IA 3BI9X 4C56A 1C5BL 2DQEH 3FO0H 1QG3A 3FOMA 2GAZB 1NGYA 1NAML 3MRFA 3HE7B 5MEPB 1NFDA 1FNSH 2AI0L 1HHJA 5HD8D 1EEYB 3RWDA 1VEMA 2NY1D 1A7RL 4TUKH 1FRGH 1BFVL 2VUOA 3IU4L 1S7QA 4E9LA 3OXRA 1L7TH 3VFUB 3IU3B 1Q0XH 4UILH 1AO7E 1XGPA 3NCYS 3D0LB 5LKNA 4YGVA 2XNAA 4YZFF 1UKTA 4JAMA 4YEEA 5KVFH 3ARQA 3U7YL 3NZ8B 3VG0L 1CK0L 1U8PA 4NWUL 4N5EC 3VFVA 4QWWC 4QOKB 1FGNL 1FNSL 2AI0H 4HKJB 5DRNA 3BIKA 5C2BH 3NCFB 1MCDA 4HWNA 1DJSA 2VKWA 1U93B 1NAKH 2GKIA 5IB2B 5ISZB 5DEFB 4NQCE 2GW5A 3BZ4A 3ORJA 2FL5A 4BZ2H 2HFEA 4Z7UE 2JLLA 1HYRC 2ZJSH 3O4LD 5EOCL 4IRZL 1ROWA 5JPNB 4NSKB 4OZIA 1KN4H 3VXPA 2JELH 4MXWH 2A9NH 3U0WH 4OD3L 2ZG1A 5B8CB 1IGML 2PXYB 3R1GH 4F2MA 4PJDA 3T65B 2AKRA 1RUAH 4H20H 3P0YL 4XBPA 1S9VA 5I75B 1CFBA 4MJ6B 1FVDA 1ZHKA 3QEQD 5CJBA 2Q8BH 4XBGA 5BW7C 3H3PL 2DJUA 4G8FB 4YDLC 1UCBL 1RK0A 3ULUH 1BQHB 1ERNA 5DSCA 5F9DC 4NQEE 5HHOB 1U2HA 4KMLB 3T3ME 5I1KL 2IGFH 4PJ5E 4U3HA 3SDDA 2IAMA 3MLSH 1UENA 3VD7A 4JO3H 5T1DH 3VGDA 1NCWL 4KJWD 3MA7B 5A3IC 2YKLH 1NEUA 4X5LA 4BFGA 1OPGH 1AGFB 1C08B 1CG9B 1V8HA 4P4KC 2BVOA 3BPCA 4MZ2A 4UDTB 3VGFA 4YIQB 3SDCD 4ZS7L 2D2OA 2P48B 2D03L 5CGYD 3V52L 1OSPL 3VFPB 4JANA 5JIIA 4Y4KB 3O2WL 4W4OA 4U7KA 3GBML 1CVRA 3ARGC 3OKMA 5BVJA 4MCZA 3MV7D 3SCMC 4UT7L 1HDMB 4OD1H 1JZ5A 2ZUUA 4HIXL 4AQOA 1VKXB 4WI6A 4O2EB 4QY8B 4I18A 5D2NB 2XN9D 3QXDA 3TP4A 2E8ZA 3QI9A 5AWNL 4YHKH 1KCKA 1JFQL 1T66C 2Z91A 4N1HB 4M9PA 5E2TL 5LGKA 1VADB 3X14A 4GXUM 5EWIL 5F3HA 4CADB 2R29H 5D7JC 2FH6A 1OAQH 4HBCH 5D6DA 3HC0A 1S5IH 5KANI 1KIRA 1FL6B 2E7LA 1MRDL 1S9XB 4FG6D 1RUPH 3IJSA 5IQ9A 1JHLL 1DCLA 5D1QB 4IRSA 4ZYKB 3QRFM 3LKNA 1T20B 1GGCL 2APXA 4NDMA 2ITCA 3TPUB 1OAKL 4WJ5A 3Q2CA 3CFEB 4KUZL 4AM0B 2B4CH 3MJ9L 1I3GH 4CW1B 3OGOE 2WLYA 4Y4FB 3P11L 5GGTA 1L0QA 4PRDA 3SGDH 3RWJA 5ANMA 5JMRA 1RZJL 3MBXH 4N9GB 5IMLA 3S5LB 1LK3H 4DOHE 5A2JH 1I3UA 5FA3A 3TZVD 4HWZB 3MGTB 2Z4QA 2Y9RT 3KJ4B 1MJUH 2R2HA 4PJBB 1RJZA 3UPRB 2F19H 1ZLSL 1UACL 3BWUC 1AGBA 4OLXL 1MEXH 1XF2B 4IOFD 1IAOA 4O51A 2B39A 3HMWL 5B3JE 1HSAA 4LMQI 2HT2C 5HHOD 3BZFB 3U48A 4OLVH 3WEXB 5C3TA 1ZHBA 1M7DB 4JLRA 1Y0LA 4HXBL 4LEOB 3K80A 3VXSB 4S0TD 2FBJL 1EEQA 3FCTA 5FGBA 3TVMB 1HOCB 4AQ1B 4DUXA 1FC1A 1HHHA 5IROA 4FFYH 4XX1E 4OZFG 1X5KA 2FEDC 4OIIH 4YX2H 3RAJH 4YGVB 1CWVA 1HHIB 3JSSA 4KUZH 3PNWA 5EZOH 3TNNB 4UDUB 2XTJB 3QQ3A 3PWLB 2DTML 1RV6X 1E27B 1JPFB 1RI8A 1EIBA 3LHPH 4JZNA 4HKBA 3P4NA 4H26B 4LCYA 1KT2B 5DJXB 1Q38A 3AAZB 4KROB 3UTZB 5C0FA 5E4EC 3LRSA 2VLRE 5EZJA 3DRQA 1MAJA 4QHLA 1FFQA 3ARRA 5GSVA 2J8HA 4HBCL 3L3DA 4U6XA 1E28A 5DEGB 3UZQA 2LU7A 5DZLA 5IR1A 1UXSA 4JPKL 3S88H 5ID1B 3O9WA 4QXGH 5DTFA 4EZMA 4PJFE 4AMKL 3G04B 5FM4A 4EDXA 4PP1C 1W72A 5JUEL 4KKLC 1BBDL 2GT9B 2HP4A 1EERB 1KJ2H 5CIPB 5FUCC 1A6WL 3RIFF 2VUYA 1D5XA 1EV2E 5DQJB 1N6VA 5DT1H 5GRJH 1CE6A 2EC9U 5LGHH 1LP9A 4ONHA 3TPUA 3SE3C 4KY1H 4WWKC 4XPAL 3RGHA 2VXQL 5IVZA 2ZNWA 3QUML 4AIXA 5JIPA 2FEEI 2A6IA 2Y4SA 4FTVA 3RWEB 4F7MB 1YEGH 1F4XH 3ZKXB 4KY1L 3VD5A 1H3UA 2X4NB 3INUH 1DQLL 1IC5L 3FONB 4N0RA 1QFWI 3P9MA 5CJQL 3UAJD 5ELIA 4NWTL 1MCWW 3IDYC 4GMSH 2YSSA 1U3HA 3PP4L 3Q6GL 1EJ6A 1NCAL 4NBYB 3WFEH 3QEHB 5B3NA 5E2WL 1CGUA 3SE4A 2JK5B 3IF1B 4LKCA 4ORZC 5AG9A 1PQZB 2GJJA 1KJ2L 3GMMB 1GZPB 1MCPH 3P77A 3QR2A 1G1YA 1UVQA 2MQ3A 5EA0H 2OX5A 4Y2DA 4WFGE 5JLZB 4JDVA 1SYSA 2UZIL 4R90H 4WCYL 3TA3D 2R2BA 4JGJA 4PJEE 5EBMB 2EXYD 2P42B 4BKLA 5D7KE 1J8HD 5TGBA 3P2TA 1INQB 1H3WM 1LO0H 4KJYB 5D5MB 3KS0J 3PWPD 4L9LA 1MFDL 4U1GC 4GRLC 4L29B 4OCYL 3S6CA 2NY5H 5DRWB 1SBSH 2DBJA 4L3EA 1U93A 3BQUB 1U91A 3HR5B 2CLVB 3E6FA 1HI6B 5FCUL 5KZCD 1SYVB 1D7FA 1N5YL 5BOPA 4OBRA 4Q9QL 2R2EB 5FV1L 3I50L 3MO1A 4P46B 3KDMB 3RPKA 3S37H 4WFFD 4NCDA 1T4KA 1E6JH 1KB5H 1KTKE 1UQSA 4HF5L 2PO6A 4JZOA 4LIQH 1S3KH 4XNZB 3OB8A 5I66B 2ATKB 3EYSL 4YHMH 5T5NF 1FVDB 5C0BD 1BFSA 3MGOB 1U8QB 4KK9C 4GW5B 4N90E 2E7CA 5EH1A 1TDQA 1T80A 1NCTA 4NT6B 3WHXA 3HI1A 2A0LC 3SY0B 3VFNB 4NRYB 2BMKB 2PYEE 3QULA 2D4FA 2VQ1A 1U8LA 1TZIA 3GMLA 2WBJD 5KANG 4V1DE 4X9HA 1XGPB 5D71L 1RUML 5AZ2L 2NCMA 3QG6B 3TH4T 4P3CL 2BVOB 3NZ8A 1RZIA 3QA3A 4P2RE 4FFZH 3VFVB 3U4EB 4M61A 1T7VA 4OFIA 4ACPA 2DBLL 1YEGL 3O6FB 1G7LA 3QDGA 4JZJB 3V8OA 1WITA 1I9IH 3MODH 2R56L 4WUKL 4XVSH 1VENA 1D6EA 3MREB 4C58B 4C56B 1A7QL 5I74C 2MKLC 4IDLA 5T1KA 1U6AH 2Z8SA 3ZTNL 3K8MA 1T66D 2DL2A 4UV4L 4ZTPH 2IPUG 1T1YB 1YEIH 4HCRH 3RVUD 3TVMD 4U3XA 3EYQD 1P2CB 3K3QA 3O8XA 2G5RA 1GPOL 1TQBC 4GW4A 3LN5B 3ZYZA 2ICCA 3LKOB 3E1F1 3SKJH 5IB1A 4XVUD 4ZDHA 4MNQD 2AK4A 2MHAB 5DMGD 5CEZD 3JVGA 5HDBF 3SE4C 3O9WB 4KK5D 3FB6B 4I0CC 1NGWB 4ZO9A 5D1XB 4EI5B 4PJ8C 1I9RH 4GXVH 4QHKJ 1FYTA 3RWHB 1MAMH 5DD1L 1NBVL 1CGYA 3QEUA 1DN2A 1ZVSB 2VXTL 4X9IA 4Y5YB 4YNYB 5DUPH 4ESKA 3QG7H 4LSVH 1NDMA 3P0GB 3MV9A 1MREL 2B7DT 1CT8B 4OSUH 2F53B 4XI5D 5IFJA 2O61A 5DEFA 2HLAB 4JG0H 2HRLA 1P7QB 5TDOA 1HYSD 3B6SA 1RZJC 3RNKB 5BS0E 5L2KD 2IAMB 3LV3A 5KVMC 1CDIA 4ONGH 3MACH 2NX5E 2DD8L 1HQ4A 5ICYA 3MNVB 5I15L 1MIEL 2A2QT 4LDLB 2P8PA 5CBEA 2I26N 4M1GH 4DQOL 5B8CA 2OQJB 2IBGA 2YZ8A 4NQVA 1BIIB 4W4NA 4I3SH 1VGEL 2QQQA 2Y7QA 4W4OC 2G5BB 5AZ2H 3FQWA 4TQEL 3T77B 4JDTH 2FD6L 5EC2A 3TWCL 4GG6B 5KSVA 4MCZB 3NZHL 1A7NL 4LFHD 1BQHA 4WIQA 2KQNA 2ZCKL 5C9KA 2AXFA 3BUTA 2EE2A 5EORH 3MNZA 5I1GH 4FXKB 4YHOH 4JQXC 3TT3H 5JHDA 1K3ZA 3NIFF 3EYFA 3QHZH 1RJYA 1D6VH 3FOLA 3VDAA 3JV4B 1Q9KB 5CEYA 5IG7A 1F58H 4L4TA 4C59B 3BP7B 4M8QA 4HWBL 1P4LA 3IFOB 5EU3A 5HVHC 3A6CH 3L3HA 3V0AC 3HPJA 3RDTC 4CDGC 1YMMB 4JY5L 4G9FA 3QDJA 1NAKL 3ARSA 5F89B 2FB4H 1ZLWH 3IKCB 1E4JA 3MLYL 2N56A 4QRPB 1TETL 5T33L 2DTMH 4Y5XA 5L8LB 2H2SD 2AXGB 4IJ3B 4Z7VF 4ODVH 4LQFL 1R3HB 3BAEL 3WDHA 3U0PA 1YMHA 2FBJH 1T22A 2QR0B 2AS5M 4PJGB 2GK0A 3UBXG 4CVXB 3BYTA 4OUUA 1JPGB 1ORQA 4ODSL 3NFNA 5C0AA 4NFCA 1XF5A 5F7DB 3CH1B 3N0PB 2YS4A 4XNMA 1UZ6E 3C8KA 1MFCL 4TOYH 4WENB 4UAOC 1R3IH 3DYMA 4OQ1A 3TCLB 4KKCC 1JGDA 1RHFA 4WDIA 2W0LA 2P5WB 1FGVL 3MRRA 1R3JB 2D9CA 3ZMRA 5DA0B 2HWZH 3D87B 3TFKD 3FQXA 4GBXC 3GBLA 3C60A 1WJ3A 2R1XB 1CLOL 1WQVT 2GSGB 1AGDB 3C5ZA 2NX5A 2XV6B 4PRPD 1Z6JT 3Q5YA 2BVPB 5ANMB 3SDAB 2HMIC 2HFGH 3P3YA 3C5SA 3NABH 5JZ7C 3RY5A 5KBNC 4NYLA 2EEBA 1KTDB 3O3BA 5JA8B 4XXCC 1LEGA 4OM1H 1CZ8L 4OIBA 4OTXH 3RWIB 3SO3B 2AJYL 3LEVH 3PWVA 4TRPL 3QQ4B 4LCUB 1T5XA 1T21B 4PJ9B 4DN3H 1GGUA 3T0DA 4J1UA 4YDVA 4I0PC 4HIIB 4MS8C 3PJSB 4Y4KC 1Z9OA 2DKMA 1A7PL 4KHTH 5D93C 4P9ML 3WNNA 1IEAB 4RIRB 3VRJB 4LPCA 1QFOA 1JTTA 3GK8H 2ZG2A 1WISA 3M07A 3FL7A 4I18B 1YEJL 2FLRT 5D2NA 4OM1L 4JO2L 4WV1B 4PUBH 5EZLB 5EU7E 3G6AA 4IHOB 3CNKA 3MYJA 3F5WA 4PJCB 3ZYJA 4POZC 3HE6A 5AEAA 3GBMH 4S0SD 4JY6B 4BZ1L 2Q76B 5ESAB 2X9YA 3V5HA 3BEVA 3QDJB 4H26A 1M1SA 3PGFL 4YNYA 4YE4L 1JF1B 1BGXL 4HLZG 4Z95L 25C8H 4RAUB 1OM3L 3PHOA 5EZJB 3EYQC 3HI5H 3RWJB 3QP3A 5F6IB 1IEBA 3N85H 2BNUA 4GAYA 5DJ2B 1JNNL 4ZFOL 2X1OA 3QWOB 4IBLT 3D25A 4U1MA 3P9MB 2QR0A 3NIDF 3C6SB 2NXYB 5IVXE 2WM0A 4MDIB 5K59F 2HJLB 3PL6A 4OAWB 4C83A 2RFXB 2WW8A 5F7DA 3ULVF 2YBRB 3AS3A 4FQIH 2RB8A 1IM9B 1D9KB 2Y6SD 4LOUC 3SKOB 1S7QB 1Q9WA 3P77B 4RBPK 1PKQE 3FFCA 5BRZD 2W60B 5F7UA 1G0YR 4LCCB 1ZANL 5J6GA 3NPZB 4NKQB 1MH5A 3DARA 3C60B 3TO4A 1CGSH 4WO4C 2NW3A 2XTJD 4PRHD 1FO0H 4HKZA 1ZMYA 4M8VA 1INQA 5M94B 1Q9KA 1ZVHA 3GKWL 1Y6NR 3ULSA 1H3XA 5TE6H 4F7TA 5E2WH 1VFUA 5T3ZL 4FABL 4JFEA 2DQUL 5KSUB 2MCPH 1D6EB 3MREA 2X1WL 4GQ9H 4ZUWB 5IV2A 2CGRL 5E9DA 3BMWA 4PTTB 5GGSA 4E41D 1MFCH 5HHXH 1NCWH 2OZ4A 5KVFL 3MRBA 3EGSA 3VE0B 5CEZH 5I17B 2IADA 5DO2D 4L4VB 2JTDA 3UJTH 5KS9B 4FQQA 1G7HB 4RDQG 4Q74A 4O9HL 5A16B 1E4KC 3UYRH 2PTTA 3DGCR 1B3JA 4X80H 4D3CL 1FFPA 5SWQB 1NBYA 1JF6A 2CKBL 3ALPA 3WJLC 3TJHD 5K9JL 2FX8L 1BQSA 5I8KH 5IHUH 1EGJH 5E5MB 4FRWA 3PHQB 3BH9B 5TDPA 4OZ4B 3C5ZD 4PRPA 5D96C 3HHRB 3NN8A 4AENA 1NL0H 5FYJH 3WL9B 1KEGL 1CLZH 4G7VH 3BKJL 2DM3A 2QEJA 4KAQL 4Y4HD 2BRRL 2AXHA 3P73B 4F80A 4JANB 4PJXE 3HZVA 4JO1H 1YECL 4IRSC 5L0QB 1ADQL 2DQJL 5EC2B 4NQCD 3W5NA 1RFDL 4XPHL 1KTLB 2CR6A 4MA3B 2CD0A 5DJDB 3VGBA 3H8NA 3CGTA 1BVLB 4WI8A 4JREB 5GSRB 3ZTJG 4YBLB 3GUTA 4ODHL 3SKOA 3HUJA 1YUHA 5J0BA 2LU3A 4PY8I 3T8XA 3FQNB 4M02A 4YJZL 4M6AA 2EYTB 1KIRB 4FFZL 3D3VA 3R06B 1I1AC 1FIGL 2EDBA 3EW3B 2F15A 4S1RL 4EBQL 1M7IB 3QFJE 4Q2ZB 3DIFA 3ARBB 1R3KA 3RVVC 1QACA 5D71H 5F9WC 3ZE0F 1IM3B 1MRCL 4Q97A 4F3FA 2O93L 1H5BB 1VERA 2B5IC 1XIWA 1BF8A 2EKSB 3VFOB 2V7HB 4Y5VB 1CR9L 4XCFL 5DMYA 5I1DB 3KLAA 4FFWD 4NOFA 4MQSB 4N9GA 3SDAD 4GOSA 4LGPB 5I1GL 4GSDL 4KPHH 4Q6YA 1FC2D 5EIIA 2ZPKL 3EYSH 4U1GB 4AT6B 2VZSA 5DJYA 2EDQA 5F7NC 5IVOA 1GOHA 1KB5L 3ARPA 4HF5H 1OAKH 4MJ4A 1NC2D 3L1OH 4P2CG 4IRJD 1X5XA 1FZOB 3DV4B 3JWNC 1MHHB 4NUJA 5MI0C 4NN6C 3IAQA 1DBKH 1AFVH 4GUPA 4QTIL 5E24E 1U8MB 1CGXA 2ZUVA 1JNLH 1ZXQA 4YEFA 5JA9A 2FWOA 4WUKH 4XVSL 4OM0H 5I15H 5JORB 2R1XA 3V4UH 2DQJH 3VFGH 3OAZK 2FO4B 1KEMH 4X9FA 3VG9C 3CVHL 1N8ZA 1JZ6A 4X7DC 4HIHB 3ZKMC 5FYLE 5T1LA 4A6YH 4U6YB 1KENH 1SY6L 5DA4A 3BDYH 1P4LB 3W11C 5C07B 2IMMA 1NCBH 4X0KB 5AUMA 3W9EA 4JKPH 2D31A 3KPSB 5FYJL 1NBVH 1W8OA 5EU7C 3WXVH 3MRHB 4F7PA 3AY4A 3SGKC 3I84A 2IH3B 2H2PD 2QLVB 3AAZA 5FHAL 3T0BA 4MA7L 5HYJB 5KG9B 4KZEH 2D03H 1YJDH 2IJ0C 3S34H 4KTDL 1U8NB 2B1HL 5JQHC 1LO4H 1KB9K 3RDTB 4LPTA 1KLGA 3MUHL 5F1IA 5ENWA 2JJTC 2EIEA 1DUYB 1OCWH 3QUYC 2UVFA 4PJGE 3TN0C 1JWSA 4KU1A 1UJTA 2J5LC 2GJ6A 5FYLD 4S10A 1A21A 2D7TH 5CD5D 1JGUH 3DWTA 3EYOA 2A74A 1QBLH 1C7TA 2OS7A 5F9JA 2XNAB 1NCCL 5GZNC 1K6QH 1OAZL 3V6OC 3EO1B 5MI0B 1DR9A 5BRZE 1NBYB 1UKSA 2COQA 3SDXB 1DSFL 4G7YL 1Y18A 4NQXB 3FT3A 2HT2D 4U1IA 5EPMB 2MCPL 5BRZB 3MLYH 1MFBH 3CLFH 1QSZA 2EKSA 2XXCB 1RD6A 2LAGB 3MJ9A 4M6ML 1AKJD 2GSIA 4YGAB 4HWBH 4G8GA 4P5TA 2NZIA 4NQEA 5J8OA 1C12A 1FSKB 3L95B 3ROOB 5LXGH 1CGSL 1MJ7L 3MGOA 5F1NA 1GRWA 1C16A 3L6FA 2Z9TA 4ZD3L 1YNKH 2FDBP 2VLKB 3CH1A 5JOPD 3GIZH 3D69B 3X11A 3V4UL 1V3KA 1QR1A 4B50A 4N0YL 4JQXA 3QEGL 3U4BL 1VESA 4LEXL 1KV3A 4UNVA 4NNYB 4HXAL 3TCLA 1UM5H 3TWCH 3ES6A 5DJDA 3VXUA 2CKNA 3GI8H 1DTUA 5CJQH 3LB6C 2ADIA 1SQ2N 3BAEH 4OIIL 4WV1A 1LGVA 4PJCE 3HUJB 4QRUA 4NZDA 4KRMB 1L7IH 3CD4A 3QJHA 3KPRE 1G7QA 4K7FB 1HN1A 3FMGH 1Z2KA 2YA1A 5IB4A 3L3HB 5HVHB 5EOQL 4YFLI 2R4SL 4L8CA 4HLZH 4IMKA 3V0WH 3REVA 1CDHA 1ZEAL 2AJVH 5BCAA 4EIGB 1MCRA 1XIWB 5FKPA 5J1SC 3UDWA 3OKOA 5HYSG 4P9HC 4DKFL 3VXME 2CRIA 4PG2C 4Y5VA 3OKMB 1G7MB 3LKOA 1DQMH 5JXAH 4MDJA 1D5IH 5IW3A 2QSQA 1NKRA 3WFBL 1JGLL 1OTUC 4X99A 1WF5A 4MD4B 5FM8A 2H41A 1EHLL 2FGWL 3WNLA 1OSZB 4NKMB 1TZGL 2NXYD 3ZE1F 4U2ZA 4XCYA 2RFXA 4IDJH 3EYOB 2P8MA 1A7PH 3OKEB 2DQGL 5IQ9B 3LMJH 3LEYL 4RAHA 4DZ8B 2IFFH 1TZIB 4MAYA 1T1XA 3VWJB 4I4WB 3JWDL 2B1AH 1KLUA 4PBWD 4M6OH 1FORL 2W9DL 4OGZA 4APQA 2OYPA 1AY1L 3MBEC 4MMXC 5CZVH 1F3DJ 5L8JB 1IE5A 3L7FA 3HI6L 4IRSD 2YUVA 4XZUB 1J0IA 3BPNB 1CD9B 4G7VL 3VDCA 1A9EA 2Z93A 3FAWA 4I0PA 1AIFB 4WNQA 3MRKA 3V6FA 1JFQH 5ID0B 4GKZB 4PJ7F 3MFGB 1JWMB 1JGLH 3FO1A 3PWVB 3ZE1E 2X4QB 1BBDH 4HPOH 4MLSA 3BWAB 5JXAL 5AYQA 4BFBD 3DVNA 4MHHG 1JPTH 1C7SA 1AGBB 3K4AA 4EI6A 4Q6IB 2GUOB 2F74A 2YR3A 1ZT7B 5JIHA 3MX0A 1CD1A 4XCCH 3HMXA 4L4VE 4ZXBB 4A6YA 2OJZL 3D3VB 3DX6A 3R06A 4M3KB 1UWGL 1MIML 4U33A 5JW5B 3AS1A 4BSJA 1I3RB 1XGUB 4YUEH 1TJIL 5HYEA 2YRZA 3UEZA 1O5DT 3VXSA 2KBGA 3OF6D 1RIVH 3O0RH 2IFFL 3DMMA 4KJQD 5ETUB 1HHHB 3UTTB 2OJEA 2VH5L 2DOCA 3BJ91 5IHZB 5LCVL 1IJ9A 2EECA 3KYKH 5L7XH 1FNGB 2BOCA 4G42A 1X9QA 1RUMH 4W6XB 3R8QA 4UIMA 5E8NB 1JF1A 3SDDD 3TLRA 4ELMA 2C3XA 4PTTA 5GGSB 3EZJB 5DRZA 3VFWA 1EHAA 5FUZH 2VN7A 4LLDA 3MRGA 5DHVB 1NBZB 1P6AB 4U1LB 5BJTA 1YEFL 5DVLA 2DMBA 4NO3B 4H20L 2W0KA 5DEGA 5AYUL 1JZ7A 5GZND 5ID1A 2GK2A 3K2MC 2BVTA 2L4OA 1RJCA 2P5EB 2JCCE 4KQ3L 1C1EL 3UXFA 5D5ME 5IROC 1U8KB 2E6QA 1F42A 2WSKA 3RX8A 43CAB 4YHML 4Y2DC 3LKPB 3BZEA 5IVXF 3PGCB 1J1PL 4CMMB 2DQFB 3ZKQD 3SOBL 1J8HB 5INCA 3CSYB 4WV1C 4IIQA 1F13A 3C2AH 1TJHL 4OI7A 3VG0H 4B7LA 1ZHBB 4Z9KB 1LEGB 3BQUC 1R3KB 3UP1A 1IC4H 2APWA 3G6JA 1ZA3A 3B4NA 4OGYH 4CVZA 1QSEA 4PD4J 4I5BA 3DX7B 5AD0B 5CILL 2X4NA 1S7SB 1P69B 2NY0C 4HIIA 2ORBL 1MHEA 1WCBB 1B0GB 3ELAT 5F8RC 5FHBH 4HKXB 2G60L 2F8OA 2YPLE 1BZQK 1ED3A 5D5MF 3RZCC 5E99L 1BHGA 1D5ZB 1ADQH 2JIXD 1YC7A 3FB7A 5F96H 3HNVL 5MEOB 1KC5L 2YPLB 4UT9L 3NBNA 4KTYA 2DMCA 3SEPA 1VEOA 2A6DA 5DMKB 1NLDL 5ALBL 1HCVA 3QUMA 4OCLC 1QKZL 3ZKSD 1J0ZA 5E1HB 4XHJC 3VXRB 4OV6F 4LGSB 4ENEC 5BZDA 2VZVA 3NCBB 2J8UF 5C0IB 2ENSA 2ERJB 3T0ED 1OLZA 3O8XD 5HYIA 1SJHB 4NBZB 4D9RD 3B2UD 4IIQC 4HFUL 3CUPB 1B0RA 2I27N 4MAYD 4JFED 5EOQH 4WY7H 5E8PB 4HHAA 4KKCD 1AQDB 2VLME 3D18B 3D48R 2J4WL 2GTZA 3WFCH 5JORA 5ISZA 3LHPL 3V2AR 2DI9A 4G43B 1X5LA 4Y16A 3HCVA 4BFEA 3SBWA 3D2UB 5C0GA 1LNUB 5HI5D 4YBQD 2BSSA 1W0VA 2NY5C 2WLZA 5IBLC 4HULB 4P49A 4BH8A 3LOWA 3VMPA 1R24B 1UEYA 4CNIA 3DX9A 3QDMA 3WMSA 1UM6H 4LCWD 4HGWA 1C16B 3L6FB 1T5XB 4EN3D 4LP4A 5BV7L 5HHNB 4E42B 1KFAL 1S9VB 2E6PA 5FOBB 3U4BH 3PGDA 4F15B 1XGYH 3QFJB 4R2GC 1NAMH 4OUOA 2P5EA 1RZFH 3H0TA 4PJXF 1GVIA 2HT3C 1KTLA 3DETC 2K1MA 3RU8H 1UACH 3QIUA 5IB5B 2OI9B 5DYOA 2VABA 3VXNA 3T2NH 3O9WD 4J2XA 4P2QD 5MENB 3MRNB 5TE7L 3A6BH 5J12C 4D9QD 3DIFB 2ZSWA 4JFFB 4PJ9D 4ONFH 5TH2B 2CDGB 2GIYA 5HBBA 3EYUL 1JHKH 2DI8A 3RAJL 1CK0H 4HAFA 4M61B 2Y06L 2OTWB 2M8XA 2XIDA 1KIQB 4R97C 1NCCH 3ZE0E 4JZJA 1JRHL 4JDZA 4MLIA 1L4IA 4EVNB 3L5XL 4CW1A 1U91B 2OTPA 4LHUA 3EIFA 3U82B 5ACMA 4MD0B 3N9GL 3QIWD 3ULVH 1T1ZA 3G04A 3T0VA 1PSKH 4XC3L 2GJZA 3T04D 3Q3GA 4JG1H 1RU9H 3LQZA 3KXFA 5E94A 5HHQA 3FB8B 5BZDB 4LAQH 5BXFB 5FYLL 1M7XA 1BZ9A 4KVCL 1TPXB 2AJXH 3QDHA 3BEWB 4R96B 4U6VL 1VFBA 2EH8L 2RIKA 3VJ6B 4LSSL 2R8SL 4HC1L 3VGEA 4CMHB 1NCAH 4V1DB 1MH5B 4WHTA 3R0MA 2DLFH 4PJEA 4WI2A 5DJ0A 4RGNE 4Y4FA 1C5DA 3CVHA 3IDNA 2D4DA 3WHE1 1I3GL 5FO9A 5IK3B 4OZIF 1QFWH 2HJFB 3GJFH 5T1LB 3V6BR 2XQYK 1EX0A 1QLRB 5J3HC 3LRGA 3SCMD 4P4KA 1AHWC 2GJ6D 4UDTA 5IM7A 4F8QA 4U1NA 3MLTB 3QXAA 3OR6A 1OAYH 3PF2A 2GYSA 3DUUA 5EUOF 3HPLB 5DJXA 2Z35B 2W65B 2KQMA 5FO7B 5L9DL 4ZUSB 3I6LE 3WV0A 2NTFB 4ZSOB 1CU4L 2X09A 3ZDYF 5C7XL 5IB5A 4CKVX 5IFAH 1J7VR 5EBMA 5C0CB 2Y5EA 1DQDH 4OCNC 4OZIE 4TVPH 5C0BA 3D9AL 2I60L 4U6VH 5F93C 1A6UL 2ZUQB 3O4OC 3ULUE 4FP8L 3GSOA 2XFXA 1S8DB 3U9UA 4X7FC