1W0YT

Tf7a_3771 complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
188
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Selective Phenylglycine Amide Tissue Factor/Factor Viia Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BLOOD COAGULATION FACTOR VIIA
total genus 43
structure length 188
sequence length 205
ec nomenclature
pdb deposition date 2004-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0yT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1w0yT02
3AM8A 2FD6H 4JLRB 3OSKA 3SGEH 1WAAA 4XAWH 5EB9A 5DK0B 1N59B 1PG7H 4PJXE 1TFHA 3UTSE 4NZJA 5T3XH 1E4XH 3RDTA 1JE6A 1T22A 4L4JA 4NN7B 4O51A 3DVNB 1CXLA 4JVPA 4QF1A 2AVGA 4WHTB 4JFXA 4K3HA 1QBAA 1P2CA 1IM9D 2WM0A 3VGAC 1BFVH 4GW1B 3N50A 2VDPL 1ES0A 4X9GA 1F8TL 2OXHA 3RPKA 5BS0D 1IGCL 2D2OA 4ZAKC 4JR9L 1A0QL 1KCRL 3CVHA 2NTFB 4CJ0A 4CMMA 1VEMA 2Y36H 3REVA 1G7QB 3VXPA 1U8JB 4JFQA 3MCKB 4K23H 4M6ML 5D2NC 2EC8A 5IVZA 3JWOH 1KV3A 2EYTB 4UV7H 5K93A 2ICES 5ESAA 4WJ5A 2YK1H 1I1CA 4HGMA 3PWPB 2AS5M 2VC2H 3N85L 1F4YH 4LIQH 5K9JL 3DX8A 5FOJA 3BZEB 4OZHF 4ODXB 3T4YB 3NTCH 4H25A 2X89A 1X5HA 2Z8RA 1H3WM 3PDOA 1NCCL 5A16A 1T21B 2BX5A 3B8YA 4OCLC 5DQDL 3O6FA 3CX5K 1NGYB 2X1XR 4IOFC 5GS2H 2XWBB 1TVBA 4XNQA 1ZLUK 2VLLA 2HLAA 4OM1H 5HYJD 3M1BB 5FM8A 5FO8A 2B2XH 5JIIA 1FIGL 2YPKB 3FQTA 3H7BB 5JQHC 4EDXA 1U58A 1RULH 4KKAC 4M5YH 4X98A 3UZEA 4I0PB 2E7HA 1NH6A 3FMGL 3RGVB 3QDJE 4KRMB 5CP3H 1TJIL 1N64L 1XEDA 4ZUVA 1FYTB 4LGPB 4HBCH 4PR5A 5E00A 5E8PB 5GGRA 3SHSA 4WHYH 1CU4H 3UTTA 4YJZL 1GPOH 5C8JA 3MJ7B 5FF6A 4NQDD 4L8BB 4ODXA 3T4YA 3VWKC 4OIIH 1J18A 2PTTA 3V4VL 5F7EH 2ATPB 3O4LE 4LLUB 4LRNH 5MI0B 2FECI 2HWZL 3OF6A 5FHAL 1FQ9C 4HIEB 5HY9A 5T3XE 1T2JA 4UIKH 1N0LA 3QHFL 1U8JA 4JPIA 1UVQB 4JY5L 1MRDL 3B2UC 5IHBA 4FQCH 4XNZC 3I3BA 5DQ9A 2R56H 5MERB 3N1GC 3PWPE 4KXZH 2AI0H 3P0VL 3QPQC 1WWBX 4MMXC 4ETYA 4F2MA 3QEUB 4KK5C 4MZ2A 4NFBA 4UQ3B 5SV3A 5MENE 2K7QA 1ES0B 1YNKL 5FDYA 1WTGT 5F9JA 3PWJB 4ODVL 4YDKL 4CAGA 1WEJH 3QNYA 3BD5A 4MLIA 1S7SB 3MJ9L 3SE8L 4J7RA 4OF8A 1O5DT 2CUIA 2R69H 4OKDA 5CILH 5DURD 3FT4B 1FDLH 3WFZA 5DEFA 1A4JB 5FDWB 3QZWA 2XZAH 4OAWA 5E6IB 4HZLA 4M9PA 2NW2B 1MVUA 4GG8A 3S4SA 5F6HI 4R4NC 1HHGB 4Y4KA 5BV7L 1QHPA 1AY1L 4J2XA 1HYRC 4P2RB 1J0IA 4P2QB 4X8JB 2VDQL 2XQYK 3GI9H 3QDME 5MEPA 5IQ7H 3LKOB 3ULVD 1CLZL 3RWDB 1FZJB 4K23L 5ERWB 2BRRH 4Z7OF 4NKOB 1FVCA 5FUOL 1BHGA 5ISZD 4NQCA 2KQMA 1FNSL 3V0VA 4NKIL 2JELL 4H8WL 4KTEL 4XWOD 4YXHH 2VOTA 1FE8L 2Z9TA 3HZKB 2XRAH 3WCYA 1JFQH 3D2UD 2DD8H 1YYML 1P6AB 1T2QH 2MQ3A 4Z0BH 3IT8D 3OJMB 3IU3A 2XTJD 2N56A 1LK3H 4MXVE 4N1HB 3SDCD 4DWHA 5JA9A 1HEZB 1UJ3A 3CMOH 3GSRB 1I9EA 1MNUH 4QLRA 4HK3J 1JI2A 1YN7A 2A6JA 3MRDB 4FQXC 4HC1H 5A2KH 4U1JA 5I19H 2QSCL 4Y0GA 5EOTB 3LMJH 5CMAB 3KWWB 2VAJA 4DGYH 2CLZB 2P49B 5T1KA 3D3VE 4IIQA 1KTLA 1CGUA 5DRWB 4CJ1A 3P3YA 3U36B 4KUZL 2YR3A 4HKBB 4PJDE 3VFGH 3HC0A 3HE6D 3VI3E 3VJ6A 3FQUB 4I4WB 3QUYC 3BZ4B 3TZVA 2J8HA 4WU5A 5IHUH 1EEQA 3IDUA 1D9KB 4QRTB 1H0DB 3WD5L 1A64A 3OKOA 3VFTB 2ZNWA 3H7LA 4YHLL 4LRNL 4LOUD 5E5MB 4ZS7H 4I0CC 5C09B 1Q0XH 5FA4A 4XZUB 3S3SA 4AL8H 2YEZA 5ISZE 4ZFOA 1RVFL 2ZCLL 1X5AA 2B1AH 4O4YL 5EOQL 1HHJA 1KIRB 3VGHA 4LKCB 1SEQL 5K9QI 1ND0B 4EN3D 4N0UE 4MA1B 4YX2L 4ONFH 4GRWB 1PEWA 3T2QA 3ZMRA 1OTUC 3QCUH 1CQYA 3QNYB 2H6PB 5HYJA 4POZD 1NUGA 5DUPH 3EYQD 1BECA 5EZOL 4I48B 4UT9L 4X7FC 2XXMB 4R4BB 3IDXH 4I0PA 3QUZC 4HIIB 5KANI 3M8OH 3TO4C 2N7AA 4TUOA 5C86A 1JTOA 1F42A 3W0WE 1EHNA 4WWKD 3C8DA 3QIUB 3HG1B 4X6DE 4JGUA 1CN4A 5F1OB 1HI6A 5F70A 3T65A 5E03A 2A6KA 4KK9C 4U6XB 1OTTC 4YHKL 3LQMA 1LK2B 1PYWB 3MOQA 4WCYH 5KSAD 5DQDH 3QDJD 4YH6A 5CMAA 5KZCD 4KUCD 5BS0A 4EIGB 5D2LF 4YPGB 4JKWA 3IDYB 3TA3B 3WNOA 3IDGB 4Z0XB 2OP4L 2GY7B 1I1AA 4PB0H 3BP4B 4HK0A 3I3DA 4MCYB 5J6HA 5FYLL 4YDKH 1UKTA 3WNLA 1F6LL 2ZKHH 4GQ9H 3V6FA 1CGTA 2VDNH 1QD0A 1MHEB 3LCYA 2B0SL 4XT1C 1Q8MA 3PWUA 4JO4H 1MY7A 5EU4B 1TJIH 5FUZL 4KZDL 2QR0A 3FFCD 4RX4A 4ORGB 3EYVA 1YDPB 4GG6B 3KPSD 5E7BA 4W6WB 4K94C 5DVKA 3D39B 1T03L 1CFQB 3PQYD 3BKJL 1RUML 2DKUA 5KVEH 3DUHA 4RMTA 1DEEA 3SDCA 4WENB 1E27A 4HHAA 3V4VH 1WBYB 3S98A 4N0YH 1EAPA 2PTUA 1AKJA 2ED9A 4MZ3A 1ONQB 1P5UA 3KJ6H 4KI5D 4J3WA 4PRNA 1IC5L 4MJ6A 1N59A 1IC5H 5F7UA 3GMOA 1EUUA 3RUGB 2VJXA 3BI9X 3QNZA 4NKMB 1KUMA 4JFPB 2OTUB 2D4DA 1I7TB 3FT3A 3P73A 4DOHB 4ONHB 3TO4B 3UYPA 3BDYH 2RCSH 5A1AA 3MACH 3LD8B 4FQLH 1G7MA 3U9PH 3MRLB 3TO4D 2O5ZL 5EC1A 5I15H 2EDJA 1R5IB 5DRZA 2AK4B 4BSWB 3IFNL 2Q6WA 5FYKE 1W0WA 4UDUB 3B5TA 4NNYB 4MD5B 2NR6C 4RGOL 5T1MB 3ARDC 1FCGA 1JGDB 1T89C 1F5WA 3WNMA 3CSYB 1PSKL 3W39A 1BZQK 5I71C 1I8IA 5I19L 4PUBL 4KJWC 4OCSL 3VXPB 3C8HA 3JZ7A 2F54B 2Z31A 3T0ED 4MAUH 1KPVB 1QLRA 1VSCA 2MOVA 4KDTA 5GRZA 4ZUSA 4L8SA 3MV8A 1LILA 3FQRA 4LPUA 1ZHLB 2VAAB 2DLTA 2P7TA 4P4RB 3SGDH 3ARBA 1IGJB 2L7UA 2WUBH 1DQDH 4ZOAA 5E6YA 1FNGA 5D4QA 3MR9A 3VXSA 3MUHL 4U0QB 3TBTB 4FFVD 5DRNA 5CD5C 4R4FL 1XF4B 3LHPL 4ZOBA 5ISZA 4GAJH 2GYSA 5JPMA 1AQKH 1TQCC 4QF1B 3R06B 5I0ZA 4JY4B 4I18A 1GIGH 2CK2A 2CUHA 5I2IB 5FGSA 4D0BB 4K3EL 1SBSH 2ADFH 3U7WH 4ZYKA 1FL5A 3WFDH 4XBGB 1CGWA 1IC1A 4ZO6A 2GEEA 4PRDB 4Z7UE 4N5ED 3V6OE 4EUPB 4FZ8H 5HYFA 5GRYA 4Y5YB 4NRYA 3BH8B 4R3SA 2HFFB 3ORJA 4F8TA 5SV4A 3WN5C 3BH9B 3CDGA 4OD2A 3T77A 4JFOA 1DCLA 4OV6F 3H9SD 4B50A 4NT6B 4HLZH 3LAFA 2OJZH 3O45A 3OKNA 4UBDD 2H6PA 2BOBA 1BBDH 4KRPC 1OAQH 2VLJE 4NSKA 2A73A 2P24B 5FKPB 4NC1E 5D8JH 3HS0A 3V8OA 1YNLL 5IB2A 1FZOB 3CSGA 2R0KL 4IRSD 1MSPA 1ADQH 4M6MH 1P6FA 3LKSA 2Z93A 3HRPA 3LN9A 1LGVA 4NC1C 2HVKB 5SWZA 2IFFH 3QG6A 4MD0B 3EGSB 1BF2A 3BWUC 4HWUA 5I66B 4JAMB 1M7IB 1E27B 5HGDB 4G9DA 5KG9A 2CXKA 5IF0B 5LVEA 5I76A 2ESVE 1ACYL 1E4JA 4F7TB 3DV4A 4N90E 1X5YA 7FABH 5LCVH 2PXYD 4Y8AA 2BVOA 2OTPA 1RFDL 3HPJB 3DTXB 1XF2B 4HKBA 1JPGA 1QSED 5EOCJ 2VDPH 1RZ8B 2APFA 4IIQB 3WIIH 1WFNA 4P3DA 3AAZB 4G6AC 1KJ3H 3V6FB 5ADOH 1PEZA 2CO7B 1IAMA 3QEQD 4NQEB 3L6FB 4MCYA 3BH8A 4EBQH 3B6SB 4EBQL 3NZHH 4RMSA 4IEFB 1JZ5A 5CP7B 4G3YH 3WIHA 3LS4L 5GXBB 1YEDB 3UROR 4RA0C 3SGKC 4XAKE 1A9BA 2DI9A 3L95A 1RIVH 2JJSA 1RK1A 3RY6C 2IFGA 4K3DH 1Q72H 3NCYP 2AK4D 4YE4H 4D2NA 5TPWH 3SDAB 3DUUB 1G6RH 2P5EE 1LEKB 3Q6GH 2OM5A 3LPFA 4PJEF 1T5WB 1DLFL 1T7WA 1MIML 1FZJA 1CDCA 1Z5LB 3U7YH 1FFOB 4PGDB 4P57B 1EMTH 4JCMA 3SKNA 3RZCB 4ZSOA 5JOFA 1KNOB 2YWYA 3HZMA 3EHBD 4H1LB 2FEDC 3AXLA 4QXGH 4F3FB 2DLFH 3RVVC 4IMLB 2CK0L 5A2LH 2WBJB 1I8LC 1DBMH 3RPIB 4X6EA 1KIUA 2VZOA 1FDLL 3G9AB 2Q6WB 4JFOB 4HG4K 2HJKA 1I9RL 4FQJH 2A83B 4UIMA 2VXUH 1AIFA 2YSSB 3KLDA 1TENA 4JFYA 3WJLA 4L29B 1IGFL 2R4SL 1BD2A 3LSOA 1IGFH 1KFAH 2NXYC 5GZNC 3MLSH 4TUKL 1WF5A 3HRZA 5CEYB 1G7PB 1X5LA 4OCWL 4RMRA 4WW2B 5CEXA 3LHPH 1AFVH 5J06A 1BQHB 1KLFA 3H9SA 1QRNB 1G9ML 2QBWA 3PP3K 1ZS8A 2PYEA 2FEEL 1HINL 4XMPH 4ESKA 1SBBA 2Q8BH 2J6EL 1QSFA 3WFCL 3ZKQD 1RZJH 2A9NH 1CLOH 3T0EE 3QEHA 5JDSA 1ZTXH 4Y16C 1EPFA 2ORBL 1IBGL 3EDEA 2DM3A 5INCB 1FYTA 2PO6A 3GSWB 5HD8D 4OLZL 3CAFA 5ENWB 4N8VG 2EEAA 4JM2D 2HAZA 3QI9A 1KCSL 1F8TH 2H32B 4KTDH 4UMGA 1RQ5A 2ITCA 1MJ7H 4F7PA 5HYSA 5GRJL 3V0WH 4JG0L 3HCVB 4M4PA 4JRXA 4KJYA 2H9GA 1L6XA 1FAIH 4XPGH 3F6IA 4RISH 4OTXH 3GZKA 3PDDA 2VXVH 5SWQA 4EVNA 2ZUTA 4KJQC 1HHHA 3I3EA 3QNZB 1G0XA 1NLBH 4O2EB 1U8QA 2VR9A 1ZHKB 2NZ9C 5K9JH 4I1NB 4WNQB 4XMLL 4OCXL 4MDIB 3A67H 1DR9A 4Z7WF 3PWPA 3F12A 5CJXA 5F3HB 3NN8A 3HUJB 1ZLWH 4MNQB 4W4NA 5EBWA 1D5MB 5EPMB 1DQTA 4RSVA 3QUMB 1J88A 2CGRL 3SDDA 1XZ0A 3DOSA 3S4SB 1DBAH 4FNLL 1BREA 2ZSVA 3ALPA 1CFTB 4I3GA 2X70B 5IT2L 1N4XL 4S1SH 4PJEE 1DQQA 3KYMB 4JFFE 1YMME 4NDMB 4OCNC 4ZAKB 2E8ZA 1U8NB 3OGCA 2HH0L 3QXUA 4XNUH 5FUZH 4KZDH 1MCOL 3MRQA 2F53A 1UWXK 1W0YT 5C2BH 3DMMA 3Q5OA 1W8NA 3TVMB 3BESR 5EUOB 1CLCA 2EH7H 3ILQC 2AJVL 4OD1L 4Z7UA 1UZ8A 2JCCA 5MEOB 2Z8WC 2LVEA 3ARZA 4A6YA 5MHSE 4F33A 3X12A 2P8MA 1JF6A 1QSFB 3KXFD 1NGWB 1UB5B 5IW6A 1I1FA 4B7LA 5IGXL 1I1AD 2AJ3A 4ZFZA 2OJEA 5ALCH 5AUMB 4WCYL 2VISB 2X41A 2Z91B 2LTQB 1NUFA 1H5BA 1RMFH 2XIDA 5E4IA 3EYFA 1BEYH 12E8L 1DQMH 3N9GL 5KVFL 3LEXA 5D6DA 3PL6B 1R5WB 4JFDA 4YHOL 3QJHA 5HJ3A 3GM8A 4LFHG 2DQDH 3QDJA 4LRIA 5ESVA 3QI9B 1NPUA 3KPRD 3S5LB 1UEYA 1GC1C 1WIOA 5D7IA 2XKNA 4G8GD 4UBDC 4C56E 1EX0A 4WGWB 5JOFB 4F7MA 1NAMH 3HE6B 1BZ7A 4MB5A 5DD6B 3FQTB 5JXEC 2DYPB 2ESVB 2HTLC 3CFBB 4RAVB 3FN3A 1GOGA 3FTGB 7CGTA 4IRJB 1OP9A 3FQNA 5E2JA 4O2EA 1I85C 2BHYA 1HWGB 3MZTA 1Q94B 3FB6A 2QSVA 3GEWB 1S7XB 3WS6A 4TVPD 4JRWA 1S7WA 4Y5VA 5C92A 1GXEA 1I1FB 4U0RB 1UM6H 3PJSA 1IFHL 1A7RL 4YDIL 3FFDB 3RUGE 1CE1H 2EYRA 2ZUXA 3N1QC 5I16B 4Y4HA 5JUEH 1MREH 5DVOA 5EOQH 5CEXB 4QGTA 3ZSTA 3UMTA 3KYKH 2WUCL 3QCVL 4KMTL 3FB5A 2Q8AL 3GNMH 5C0AA 2DB8A 1KJ2L 3L5HA 4G80B 3MLUH 2IAMD 3ARFA 3L7EA 2FCBA 2W9DH 1MCLA 3U4BH 3KYMA 3S34H 2V5MA 1J05A 3U36A 2IPUG 2AXHA 1TZHB 1OAKH 1CDJA 3J8F7 3O3BB 2GHWB 3MXWH 5BRZB 1EV2E 2ZOLA 2F5AH 3QFJA 1AJ7L 2FYYB 1M4KA 3GIZL 5D5MA 1XT5A 3SDDB 1AGBB 4EQ2A 4GJTB 3L1OH 2OZ4L 4K2UH 2GTWB 5M94B 1A7QH 3OKEA 4KTDL 3EGSA 1IZKA 3GB7B 3WIFA 4P2RD 4MB3A 1AE6H 5JMOC 3R8BB 1JNNH 2B5IC 4PRIA 4TSAH 3HZKA 2VUYA 3IFLL 4PJDA 1FLTX 3PNWA 3Q3GB 3NPZB 3BZ4A 3P30L 3ESVF 4F7TA 2WUCH 4ZOCA 2VQ1A 1FE8H 2AK1L 1GHFH 5J1SC 4HUVB 4LLYB 2Q8BL 4PB0L 4P46C 4JRXD 3G04B 3KWWA 4M93C 4IMLA 2HG5B 4GQ9L 3VFUB 3D0VA 2ARJA 3TIEA 2CDGA 5LXGH 5E2UH 1MCWM 3KLAB 3JBG7 4XGZA 3MPCA 1MEXH 4OZGA 3IF1B 1PSKH 3MRBA 5GISL 4YO0B 2FHBA 3C60C 4MXWL 4MDJB 5L9DH 4HWBH 2DIJA 4PBXA 4UT7L 1FGNH 2HRPL 3MRKA 1MUJA 3DGGA 5C0CE 3GMPB 1EO8H 1JK8A 2A74B 4QWWC 1PG7W 1D5ZA 4MCZB 3RI5K 1A9EB 2BNUA 1FZKA 3OG6B 4D8PB 1DSFH 5JOPE 4NFDA 2E9WA 3OTTA 1DSFL 1Z6JT 2DQFB 3PF2A 4WI2A 3QUML 4FHBD 4JO1H 4FFYH 4R4FH 1MCCA 1C7TA 1YPZA 3RIAK 3DHMA 1X5ZA 2VXVL 4I3SH 5EORH 1UYWL 3WSQH 4I3RH 3EDJA 4NZUH 3CFIC 1TVHB 4Q9QH 2NY5H 1F90H 2R15A 3GKZA 4OGXL 1HNGA 1HIML 4HULB 4LIQE 5IVZB 1JFQL 3SO5A 4Y5XA 5JO5B 2BDNH 5JW4R 3MBEA 4U1KA 3BUYB 5DEZA 4XC3H 3P4NA 4L4TB 5FGBC 2BSTB 4JM2A 5DC4B 1SEQH 3MJ8A 1BIIB 2DQCH 3AM8C 5HI5D 2FYYA 2NYYD 4ONFL 1JL8A 3ULSA 5C0DB 1A6VL 1P4BH 2PNDA 4XC1H 2C5DC 5DMKB 4BSVA 1BX2B 1NBVL 4D0DA 1BIHA 2VN7A 1B3JA 2VAAA 4YWGH 4N90D 3RL1B 3VH8B 4OZGF 5E1AA 5I1AA 3C5SA 4TUJA 3DUSA 5DC0A 2XFXB 2F5AL 2V5SA 4GS7C 2ERJC 1MAKA 4NKMA 3JWDH 4NQDA 1A14L 2YKLH 4ZXBD 3W39B 1CU4L 1C12B 4GXUN 1EVTC 5TDOB 1T5WA 3ZZ1A 5KSBA 2JJTA 4XP6L 4AIXA 1XCQA 2O5YL 3DROB 5GS0H 4OCXH 4NQED 5DS8B 5IW3A 4L8CA 3MRLA 2X1WL 2CRZA 2P4AB 4NQSA 3WFEL 3DX8B 3BZEA 3BDXA 3MROA 3WJJA 3V4UH 2I9LA 3TBSA 4RWYH 4GH7B 3SY0A 1WV7T 1B6DA 4W6YB 1CICB 4UNTA 3TP4A 2CRMA 1BQLH 4P5KB 1ORQB 4YBQD 1Q9LB 2QQLL 4DJMA 2IANA 5E1AB 3O6FC 5B38G 2QADB 1VFMA 5I1DA 2HJFA 1S78C 4KKCD 2HLFC 4ELMF 4KKLC 3FT2A 2E6PA 4YK4C 1A7PH 5DLML 3FB8A 4PJ9A 4UU9A 5I74B 3SKMB 1FCCA 4HBCL 5J11B 2G5RA 2NY3B 3BKML 3C5ZC 1NC2B 5B4MC 5DEGB 4MJ5B 2X4PA 1KEGH 1QYGH 1XF4A 4PTTA 3H42H 1ZXQA 4U1KB 2ADGB 4U1NA 5F7FA 1LNUB 5DHYB 5LAXB 4ONHA 5IHZA 2P8PA 4PY7B 3GFUA 3PDGA 3AS2A 2EO9A 1AGCB 5DJ6B 5BZWB 3KPPB 2H26B 4X6DA 3MLXL 5LBSL 1JWSA 3GHBL 2YD5A 3HUJE 5D7IE 4JZOB 4QHMA 5JNYA 3KXFA 5CEZE 3CSYA 4KC3B 4HIXH 3RL1A 2QL1A 4FXLA 4YXLL 1CL7L 5IEKB 1D5BA 2MJWA 1BVZA 2P24A 5FKPA 4D0DB 4ZUTA 5IR1B 1A47A 1CFNB 5BVJA 4LMQE 1JYWA 2VL5A 4OZFH 1JZ7A 3QXDB 1YJDC 1H15A 5DHVH 1TNNA 5F9WC 1AO7E 5EUKB 4E41B 4PJ8B 4HIIA 4EI5C 2W07A 5I73C 3L7FA 2KPNA 3UZQA 4TNVK 3L3OA 1SJHA 5FGCE 4U1MB 1ZWIB 4Z78B 1A6TA 1J5OH 2XPGB 3VH8A 1IE5A 1FIEA 4PJBE 1MJ7L 1EGJA 4PY7A 1VEPA 3OXSA 5B22A 3QQNA 4S1RL 1OD7A 5GS3A 4QHKJ 1D6VH 2D7TH 2WW8A 4M7ZC 1KLGA 2AJSH 4V1DE 2AQ1A 3RGVC 5F1NB 4LHQB 3P0GB 1LHZA 2F54D 3T0EB 1IAKB 4JM2B 4C55A 4PLJD 5H37H 4LKCA 1BVLB 4LEOA 3V8CA 4EVNB 5DRNB 5HGHB 3WS3A 4KV5E 3A67L 1MF2L 5DJZA 1JZ4A 3M17A 4G9FB 3QUXC 4M8QA 3LVEA 5C0JB 3D3VA 4G7VL 1YUHA 5C3LD 4G6FB 5LCVL 1BZ9A 4K3GA 3UJTH 4K8RC 5HVWA 1K3IA 3QFJB 5AYQA 4AEIL 4ZQKB 2JIXA 3HLAB 3K2MC 3FN0H 2KZWA 4I4WA 4Q97A 1LO2H 3HNVH 32C2A 2H2SC 4XCYB 3PWNB 1XGTA 5DRZB 4LPXA 5IEHA 3BO8B 5T1KB 5GZND 4C59B 4GUPA 1JNLL 4JKKA 1IKNA 5DZLA 1BMGA 5A43C 1AHWA 1YEKH 4LPWA 2AQ2A 3ZDYE 3VWKB 5F9WB 2EH7L 3BE1H 4OFIA 3QXAA 2DLIA 2N7BA 5FYJH 2D03H 5JZ7C 4PJ5E 4HS3A 1DVFA 5FHAH 4LCCC 1P84K 4X5XA 5E5UB 4OKVB 4F15C 3DECA 1I8MA 4YGVB 1Q9OB 5D1ZD 5B39A 3MLVL 4XCEB 2Z31D 4LPVA 3T0EA 1KYOJ 3QDGA 1YDPA 1DBAL 4GG6A 2X05A 1KENL 5CCKL 2VLRA 1S8DB 3D3VD 3LV3A 3MRHB 1A6ZA 3ZO0A 5F9OL 4K7FB 1E6JL 5D9SB 5LWYH 1XR8A 3TNMB 4F80A 5J12B 3CVHH 1SMAA 1SEBB 1CIDA 2QQQA 3SJVD 1EO8L 4MA3A 2DTML 1JPFA 4P4KC 4NWTL 1PLGL 1U9KA 2FX9H 2CDFB 3B4NA 3A6CL 3BP4A 4HK0B 3ROLA 5JHDA 1BAFL 3RIAF 4CU6A 4Q58C 1TLKA 4TPRH 5FYJU 4MAYC 4JN2B 1V3KA 3VXQB 3WKMH 4FMFA 4C56D 4G8GE 1BFTA 2RFXB 2I60H 3PHQA 4X9BA 2C1PA 3BSZL 4K8RD 2GJ6B 5CJ5A 1N7ML 2BVQB 3QUZA 4XP1H 4ZNEA 1DN0B 2ZUSA 3PV6B 5SX4H 3QJFB 1F13A 1SM3H 4Z8FL 1IC4L 4IHOB 1DLFH 3GK8H 4BQ8A 4JCLA 5GGSB 4PJBF 4KY1H 5C0AE 5C0EB 5BW7A 1EMTL 2NX5D 4Y88A 4KY1L 3RY4A 3KPPA 4RGMB 2NNAB 2HFEA 5BJTA 1S7QA 5FKAB 4N0CC 3IVKA 2LU7A 3X3FH 1FJ1A 2QQLH 1JPFB 1BQLL 3RGVD 4NDMA 2ADJA 3R8QA 3NACH 1LE5B 1WCQA 5F1KC 5DJZB 3VGDA 1EFXD 4DAGH 4P5MA 2B1HL 1RZIA 4NJ9L 5C8JB 2XKUA 4OZFA 1AP2A 4AEIH 4L4TE 2ZZUT 1TZGL 5C07B 4JFZH 2Y25A 1H15B 2BVOB 3KXFE 3LPGA 5HDBE 3LS4H 2E6JA 5MHSD 3OR6A 4H1LH 1WZ1L 3PL6C 3FHAA 4LGRB 4BUGA 4PJHA 3N85H 4D94A 4NZDA 2ZNXA 5CJQL 3F12B 3UBXG 5E6ZA 4G5ZH 3MOAL 4PS4H 3DNKA 2EH8H 1OAXH 1QFPA 3ALWA 1MQ8A 4FQHB 4PJIB 3ZYJA 3BUTA 4ODUA 3SDCC 2WMPA 2NR6D 4E41D 4K7PX 1ZLVH 3TV3H 4MX7A 3TZVB 1YJDL 3TJHC 1P5VA 5DEFB 2BVUA 2CKBL 2B8OT 2P8LA 3DYOA 5FDWA 5IW1B 4AT6A 5J13C 3FO0H 4V2CB 2UYLA 3D69B 1A3QA 3W5NA 4NO0A 2EZ0C 3OKNB 5GS1A 2OK0L 2BVPB 3C6LA 5MI0C 4Y16B 2DQCL 5HVHB 3VD5A 3ULUE 2XTLA 3RDTD 4QCIB 4TOYL 4HWEH 4YFEA 2KL6A 4ZDHA 3ROOA 2YXFA 2YRLA 3RNQB 2GIYA 2IMMA 1DQJB 3ARDA 1AGCA 4Y2DC 3TC9A 1NC4B 1J0KA 4KK6D 5E95B 2CDEA 4PJEA 1OWWA 4UTAL 1T1WB 3RVWC 4G43B 2FZ3B 4Z76B 4KDTC 1EJOH 4MNGA 1T21A 1MWAB 2FH8A 4HUMB 2X4SB 1VADA 1SVZA 2R8SH 3T0WA 4I3RL 5GGRB 2BCKB 3DVGA 5KSVA 3ESUF 4OLUL 5GSVA 4GG6E 3SOBL 3SQOL 2ZUWA 4HUWB 3P2TA 1AGFA 1VACA 4YHKH 3O2VH 3GMMA 4H26B 1J8HE 2W9DL 2EXWC 5EU3A 3FOLA 3NGBB 5C0FA 3ES6B 2NCMA 5LGJA 1DLHA 1MEXL 4PRPA 1A6VH 3DI3B 3CVHB 3NZ8B 1QFWI 4MNGE 3VMNA 5L9DL 1P53A 2MKWA 3SKJH 1K2DA 4KKAD 3QYCA 1LE5A 2GJZB 5IT2H 5DMKA 2YD4A 5E2WL 5FFLA 2BXYA 4UNUA 5ETUA 3REWB 3X12B 3E2HC 1FV1A 1XF5A 2IANB 5I1HL 1DBJH 1XGQB 3NCBB 4MX7B 1CTNA 1W72A 3QUYB 1G6VK 4BK4A 3RDTB 4Z7VF 1N0XH 1RIUH 1KCKA 1MAJA 3HZYA 4M7LH 3TCLB 4DUXA 4NJAH 1LO4H 2EICA 2VZTA 1KCVL 1UGNA 2DWEA 1G7QA 3VG9C 4Z18A 3NA9L 4QRPB 1DN0A 1OTUD 3VA6A 2OQJA 3IAPA 4KJQD 4PJAB 3PHSA 4L8CB 3ILQD 3MCG1 3P11L 1UCBH 4KROB 1D6EB 1ZT1A 3GJFA 3KYKL 4Y4KD 1WITA 4MXVF 4NGHH 1GOHA 1IAII 1EEUA 4X6EB 2QR0B 3BN9C 3PXJA 5L7XL 3G6DL 2GJ6E 1ZLSH 4OCYL 1JMZA 4H88H 3CLFH 4R9HA 1CG9B 5L8JB 5IFAL 1BQHG 4NWTH 5E2WH 4L29A 1Q9LA 3VFGL 3EZ8A 1SJXA 3A6BH 8CGTA 1AXIB 1G7IB 4XGZB 1IT9H 1QQDA 4QHKI 3M8OL 2BOCA 2VLME 4JPKL 3BKMH 1CS6A 4G7YL 1QSFE 3WN5B 1CD8A 4CVZA 35C8L 3HAEB 4MJID 5A16B 5CEZH 2B4CC 3MREA 3F6LA 1VESA 3GUTB 1D9KC 1JNNL 3SKNB 2VLKE 3EYSH 2VZSA 5AZEL 1OAZL 4G8IB 3SGKA 1PY9A 2YBRB 3TBYA 3KDMA 4OV5A 1BQUA 1MIMH 2RB8A 3F5WB 1YMMB 3MRGB 3MOBH 5BXFB 3S35X 3KPNB 1FNFA 4LASL 5CAYB 4ODVH 5I8OH 1FFPB 3ARFD 1A7OH 4NZRL 4GKZB 5T33L 5IJVA 1A7OL 2XTJB 4NZRH 3GSNH 4NO2B 3QULA 5DHVB 5D96C 2MCG1 2D0FA 4D8PA 3BRDA 4Y2OA 4M02A 5DUBA 4FQXD 3RWGB 1K8DA 2X42A 3M07A 4J4PC 5HHME 3IRZA 4UZGA 3KPSB 3E3QE 4N1EA 4LLVA 3RTQA 3ZLQC 4Y4HD 4F57L 1PVHA 3JTSB 3O6FD 43CAB 1Z2KA 1BPVA 1QKZL 1V05A 4G42A 5HVGB 1IQDA 4JQVA 2VITA 3O4OC 3BZDA 4X9FA 3P9MB 1AR2A 5F7NC 4NRXB 4HT1L 1F11A 2EE6A 3GBLA 1F02I 1MCEA 1H3VA 1UB6A 4FRWA 1LO4L 3ARPA 5F1NA 3CFCL 5TQ0L 2ICWB 4MQ7B 4OZHB 4JFFB 1QRNE 1HQRA 1YEEH 4TVPE 5GGQH 4M03A 3FQXA 5KW9H 3TN0C 3MBXL 2HFTA 3QULB 1K2DB 3V0AC 3GDBA 3CH8A 2R0WL 3DJ9A 3HB3C 5EU6E 1JK8B 3GMPA 3EOAB 4L8SB 2Y6SC 1MRCH 5DFWH 3IFPA 4D9LH 3SDAC 3LEYH 4L4VD 1MJ8H 4BSJA 4K9EC 1S7RA 1MCPL 4MNQE 43C9A 3KLAA 3C9NB 5C9JB 3V6OA 5SX5H 4C57C 1I7ZB 1VFUA 2GJZA 5LG1A 4HFUH 4DN4L 1A6PA 3F7YA 4FFWD 2YPVL 1OARL 4HLZG 2FX7H 2MCPH 2DI8A 4AIZA 5EU6B 4YGAB 4RFOH 4CVZB 3VXNA 3LQAC 4LU5L 1KCLA 4PB9H 3MGOB 5BZDA 4R3SB 3BAEL 4GAGH 3UAJD 1IM9B 2BJML 1YY9C 1HHKB 1ZVYA 4KAQH 3ALXA 3C5ZB 3SDXB 4IRZL 2XG4A 1EK3A 3MRRB 3G6AA 2V7HB 4Y7MA 2X6MA 1M6OA 4ZYKB 1XGPB 4WTWA 1CF8L 3GMLB 1C1EH 1HHGA 3U7YL 3IB4A 5E94B 2LAAA 5GIRB 4FN0A 4HIHA 5GISH 3VFRA 4RQQA 5CJXC 4KRNA 2O5XH 4GOSA 1LE9A 1OOAA 1INEH 1D6EA 3GJFB 3BHBA 5K9QG 1A02N 3FTGA 4O02L 3PWPD 3EO1A 1VGEL 2PYEE 3F65A 1DEDA 1PLGH 2UWEF 3TPUA 3IRPX 4LLMB 5DD3H 4PJFF 2BSSA 1WBXA 3ES6A 1HILA 4O9HL 4EOWH 1KOAA 4PD4K 3QG6B 3TN0D 3MXVH 2F74A 3S5LA 2V17H 4MYWB 4L4VB 5E99L 3WD5H 4BH7B 4NN5C 4KVNL 2IPTH 3KHOA 3TBSB 3QR2A 2Y07H 3BYTA 3DVGB 1QBMH 2AEQL 4WWID 5KSVB 3D1MC 4GT7A 2GT9A 3BD4A 1FVEB 1N6VA 4GW4B 4OCWH 5ETUB 2P8LB 1U3HB 2ADGA 1EEZB 1T0NB 3ARWA 5SWSB 1T83A 4RBPK 2AV1A 4L8BA 4OZIE 5ILTH 3QEQB 3MODL 1CGSH 4N9GA 1LP9A 4QXTA 4MVBD 4M7KH 5HHMB 1WIPA 1QFWL 4FTVD 3UYOD 2V2XB 3NZ8A 5IB4B 4AENA 3GRWL 3MV7A 3P77B 4U6HA 3VD9A 4JG1H 4P5TD 2E27L 3DX9B 4NBZB 4Z9KB 1EXUA 5GJSL 1ZTXL 1IGCH 1JHKL 1TJHH 1TXKA 5GS1B 3WIHL 1INQA 5E8DH 4PBWD 4UQ2B 4DFHA 2RHEA 3QQ3A 4LHUB 5KS9B 4JPKH 3KPSA 4HLJA 3GO1L 1LK2A 4OZFB 5BZDB 5IMOA 1MWAA 4MNGB 1YEIL 2DOCA 1E4KA 5D7LD 1CICC 4PRAB 4Y4FC 5IQ7L 1RIVL 1KJ2B 3F7YB 3UTTE 1A3LH 4U7SA 4APQA 4PREA 4ZPVB 1MCKA 1SM3L 3G5XB 4HBQA 4GMSL 4MAYD 4TQEH 2OBGA 1KNOA 3A0OA 5TE4L 5BVPL 4DVRL 3KYNB 5EZIL 4XHQA 4CRPA 1CT8A 4HGKC 2AEIT 4BH7A 5AWNH 5GGSY 4NCC2 2FO4A 1RUKL 2VQUA 5A3ID 1YPZB 2PO6B 1FRGL 3GSWA 3QQ9D 5FYJE 2FECL 5SWQB 1FNAA 3T0BA 1WBXB 1WK0A 1B0GB 3ZKND 4DZ8A 4NC2B 4UIMB 1GCFA 1U3YA 4YC2B 1XGTB 3AS0A 3PWNA 4U3HA 1NAKH 4OJFL 3MMEB 2PCPA 4QXGL 4R2GD 1Q38A 4GLRH 5ADOL 4YR6A 1OP5K 3KR3L 3B5GA 3HE7B 4M5ZL 3P0YH 3L5WA 1KJVB 2BOCB 4MXWH 3S36X 5E2VH 5IM7A 3O6KH 5SWZE 1BIIA 1D5IH 1BM3H 1S7RB 1IGTB 1J12A 1BQHA 1RZKH 1QHOA 4J12A 2J88H 1WCBA 3SE4A 2WUBL 1NGZA 2P1YA 3MSPA 2Y36L 3BZFB 2I07A 2NLJA 1RV6X 1FSKC 4EI5D 2FBJL 4OFKA 4WNQA 4YDVB 1B4RA 1A6UH 4WRLA 1NGQL 5DD1L 4JFHD 4NOBA 1U2CA 5EU6A 4NKOA 3T2PA 2EDEA 3ILPB 5FYLE 4N0FA 2VWEC 4KZEH 3IDYC 3TA3C 4L9LC 4JQIL 2NY4B 4JFHE 4DGVH 1HE7A 5E5MA 4HS3B 4F9PC 5L6YL 2H32A 2DQIL 5E4EB 3MRKB 1N26A 3KLHC 1K3ZA 1V8HA 4PG2A 12E8H 3N9GH 4PJGB 2XWJB 5BRZD 5KVFH 4OLXH 4AH2A 2HA1A 3DO3A 2B1HH 1JPTH 1W72B 5GQBA 1V7NH 1UJ3B 2AJZA 1OB1A 4XWGL 1WISA 3QIWC 4OT1H 2AGJH 1NFIA 2VLRB 4RNRA 4J3UA 1A3RL 1RZKC 3NIFF 4BM7A 1UWEL 4XNZB 3L3HB 2FIRT 4RGMC 2X4RA 5EO9A 1I8KA 5GRJH 2VIRA 3NIDF 2EC9U 4GRLA 3BPOB 3U1SL 2W65A 3V0VB 3BIBX 1GGUA 2WWMD 1S7UB 5TE6L 2FSEA 1QFOA 1O7SA 1KCVH 1TVDA 5HGDA 2YD3A 3GSRA 4QRQB 4JN2A 2VLRD 1L0QA 1Q9KA 3K8LA 4DKDC 3SDYH 4PJCB 3IU3B 4XP1L 2EIZA 4LLDA 4YE4L 5GGUA 4CVUA 1T20B 1XGRB 5J9PA 4QRRA 3VRIB 1YYMH 3PJSB 4PJIE 1MJUH 4U1NB 2KBGA 1S7XA 1G9NC 1RZ8A 1FG9C 4YFDB 3JV0A 5T3XD 1OCWH 3VMOA 3ZE1F 5I8CB 1R6VA 4OIBA 4RGOH 4OLXL 1CIUA 4NSKB 4M6AA 4XVSH 4Y5XC 3GJFH 1GGIL 4I77L 1A4KA 3FO2B 1U92A 2MWCA 1NCDL 1NAKL 4OJFH 2YUWA 3LN5A 4U05A 2PR4H 2ZUVA 5DA4A 5ESVB 3V7AE 4KQ3L 4M48H 1IAIH 4NWUH 3BPCB 5CP3A 2EKSB 3ULUH 5J3HD 4QCIA 5GS0D 4LVNB 3B3IB 5DJ6A 5BZWA 2OR8A 1EJ6A 2J5LB 2Z91A 2YA1A 2VISA 4OZIA 5T3ZE 4KMQA 4WFFD 1WT5C 2MQCA 1KPUB 5E9DD 4XPTH 4ZUTB 4CW1B 4AT6B 1S9WB 1MCJA 5JLZA 1VPOL 3F62A 3RVTC 3TBVA 1YECH 3MREB 3HMXA 3O3AA 2VDLH 3L3DA 1FGVL 5HHOE 4NO3B 2EYSB 2O26U 3E3QC 4K7PL 4HJ0C 1KENH 4OGAC 5DTFA 1UXSA 3HC3L 4PRNB 1YMMD 4JFFD 1ONQA 1VCAA 2GJJA 1MAMH 5IVNA 1UWGH 4CMMB 3QAZC 1RZJL 3ET9F 2ZJSL 3U2SA 1NCWH 4HW6A 3IS0X 2OK0H 2D3VA 3RVXC 1A7BA 3BT2L 4WI7A 3TT3H 1RUQL 5FK9A 5HHNB 2XZAL 3FN9A 5IR1A 3PWLA 4F57H 3NGBC 1Y0LB 1QSEE 2VZ3A 3B43A 1XZ0B 2X4SA 4X9IA 3PWUB 1O0VA 1JZ8A 4DUVA 4OSUL 4P4KD 4HMEA 2Q3AA 4Y4FB 5DK2B 1PZ5A 3MLSL 5EUOE 4QRPA 4PJ9C 2W9LA 3MOAH 4PS4L 3PHOA 5CINL 5J7CC 5TE4H 1I1AB 3IDGA 5F89B 4P2QA 1T1XB 2XPGA 4L3CB 1V3LA 3UP1A 4ZUSB 5IB1A 4JFDE 4KROD 5E7FA 2EDTA 4LARH 2HLFD 3EDDA 5LBSH 1ERNA 2Q8AH 3B9KA 1G7HB 3PGCA 5IB5A 1Q0YH 3R06A 3CU7A 1HYSD 1QFHA 3X11A 1IZJA 4H25B 5D7SH 5EN2A 1YQ2A 2IGFH 3WHXA 4KKBD 4GBXD 2R2EA 3T1WA 3C8KA 4PUBH 1G7JB 2NZIA 3O6KL 4TTDD 4U1IB 2WZPD 3DRQA 4PRBB 2V9RA 3D25A 2IH1A 3JV4B 4NRYB 3GMOB 4KRPD 4EXPX 4X7SH 4BZ1H 5TDNB 3ARRA 5KJRL 3GI9L 2VDQH 4HFUL 1F3JA 1Z0MA 4PP2A 1EO5A 3IDMB 1UA6L 5EC1B 5MP6L 2VQ1B 1NLBL 3MJ7A 4HKZB 2OXGA 2IJ0C 1UYWH 1ETZA 1S5IH 3HAEH 1VB9A 5AWNL 3U30C 2Z4QA 4XI5C 5KSBB 3OX8A 4PJDB 4P2RE 1FL3A 5HGBB 4DUWA 3H9ZA 3VFOA 1FNGB 3C60D 4HX1A 1KTKE 5CBEA 5C6TL 4JANA 3RGVA 1T20A 4XAWL 2GK0B 2XA8H 4H20L 5F21B 5L6YH 3BPOC 3WHE0 3DYMA 3IGAB 2IG2L 4G6MH 2OSLB 4UTBH 4G8EA 4EN3A 1HWHB 3C08L 3WNKA 2O5XL 4M1CC 5E2TH 3QUXA 1MJJA 3C60B 4DK6A 2QTEA 3HB3D 1F2QA 1F97A 1MLBB 5B39G 2WLZA 4Q6IA 2X4TB 2UYLB 3SDAD 5I71B 3SKOA 5E24E 4WO4B 2IF7A 4HD9A 4N0RA 3H9HB 4MQTB 3KG5A 4KI5F 2DMBA 2IQAA 3PP3H 1NSNH 3AREA 3MRGA 1GPOL 4XBEH 5TF0A 5IJKA 5F96H 4ODUB 4PRHA 3B3IA 4LF3B 2YRPA 3SEPA 4NQDB 2ED7A 9CGTA 5F3BA 1NGXA 4Q6YA 4QOKB 3VG9B 4AY0A 4AL8L 1AHWC 4RFEA 4FABL 4APQB 5FIEA 4JPVL 4JHAL 3TEUA 1NCAH 4R90L 1T66D 3BGMB 3H3PL 1A9BB 3L95B 3UTQB 2XT1B 1L7TL 2GJ6A 3VI3F 1AO7B 3K46A 5JA8B 4WVRA 2X4NB 3G6DH 1Z0NA 2NY6B 2PXYB 3P4MB 1G7IA 3PP4L 2Q20A 2DYPA 2ESVA 3RU8H 1CXFA 4O51B 1WEJL 3J7HA 1KIRA 5DUPL 1QSEB 1XIWA 3ARVA 3OGOE 2R69L 2K1MA 4PLNC 5HTSA 2ZUYA 1ZVHA 3Q6FA 1CZ8H 3MV7D 4YEEA 3BW9B 4EUPH 4Z77B 2FNBA 3CH1B 4J3VA 5HYJB 3U7AA 3OPZH 4G7YH 1U95B 1M7XA 3O2DH 3O9WC 3PWVB 3STZA 1PYWA 5D2LA 5IF0A 2NXYD 5F7EL 1KG0A 3RJDA 1L0XA 2QHRL 4TVPL 2H8PB 5E8EA 4OGXH 4N0YL 4K3DL 1YECL 5HHXH 4QT5B 5IEKA 2BNUB 4S10A 3MRJB 2DL2A 2FDBP 3UBXI 4ZPTA 5EZJB 3HG1A 2HVJB 5EDXA 5D1XC 1MFNA 2CGRH 2X9YA 3H9YA 1IGMH 5IK3A 2BC4A 2NY1D 4KHXL 5TQ2L 2ICWI 1I3RA 3SCMD 2ZOLB 2QQNL 3HTLX 3W9DB 2IQAB 4OD3H 1FN4A 5IFAH 3FQUA 2ZKHL 3MRMB 3FMGH 3H9HA 4PLKD 4JZNB 4ODTL 5EO9B 2QSCH 5HYSG 1AJ7H 5ACLA 4CVXA 1NDMA 2YUVA 3KVQA 3QRFM 4QRUA 5BOZG 2VLJB 1LP9F 1I9RH 2AGJL 1DLHB 1MELA 2AJZB 4ZQKA 2I26N 4R8WH 3TYGH 1C5DB 1MFCL 4KVNH 5IW6B 3W2DH 1YEJH 4Q9RH 1JPSH 2PXYC 5JR1H 2FBOJ 4GRMB 1IFHH 4YDIH 4X7EC 1FO0A 3UDWC 3R0MA 5C71A 1NGZB 4HUWA 3NTCL 5FO8B 4M3JA 3LZFH 4Q0XL 1NANH 3QUXD 4LF3A 4OIAA 1G6RB 1AI1L 4PJCE 2AJXH 4JKPL 1NMCB 5IG7B 3ZTJG 2PTTB 4PJ8A 1J1OL 1SYVB 4HKZA 5EUKA 1NKOA 1LO3L 3G6JA 4NN5B 5F93C 2LVCA 4GW4A 3U4EB 3CX2A 4XTRD 2XKSA 5J12C 1OAUL 3L9RA 3EO0B 2CLZA 5A3IC 1OSZB 1LO0H 1KULA 1J8HB 4GKNB 2Z92A 1FBIL 4UINH 2GSGA 3WXVL 1F4XH 4L4VA 4Z6AT 1G1YA 1P1ZA 3EFFB 4ETQB 1YEHL 3UTSB 1HK6A 1EGJH 2C3VB 5EO0B 5D71H 1KGCD 4E41A 1RIHL 5BRZE 2FL5A 1KFAL 2FRGP 2EDQA 1U3HD 3G5XA 1OARH 4L3EB 4JJHA 4NKDB 1EEZA 1T0NA 3QFDA 3EIFA 5SWSA 5L0QC 2GKIA 1FL6B 4U2ZA 2G5BA 3KPRA 3BGMA 2IBZX 3BP6B 2XNAB 5TE7L 2VYRE 1B2WH 2BSTA 5GJTH 3K4ZA 4L4TA 2NW3A 3SE9H 3QCVH 3T4AB 3KPOA 4LKXB 4P9ML 1RUKH 4Z7UB 2CLVB 1NFDF 1G6RL 4I0PD 1AH1A 4L8DA 4XNMA 5C0CB 5BOPA 3L3GA 2AXGA 5ICYA 4EXKA 4RBPH 3X14B 4EDWL 2OL3L 3U4BL 1TVHA 3IXTA 3LN4B 4O58L 1ZHKA 4LLMA 3P9LB 2X4UB 3T0VA 3CD4A 3DURA 1G7JA 3TA3D 4X99A 3QG7H 3MLRL 2BVTA 2R2HB 1NMAH 3OG4B 2W59A 4KWUA 1RURL 1I7UA 3ECBB 1CD9B 2FJFB 3ARQA 4R7DA 1WVZA 1J87A 3UYRL 5SX5K 4F7PB 1N3NA 2EXWD 5L2JA 2R9HC 4JR9H 2JLLA 3TO2A 3OR7B 1MCWW 4DEPC 4L9LB 3NFNA 5E6IC 3VRJB 3Q5YA 4H1LA 3IAGC 4JKLA 3RWJA 3DETC 1DE4B 1NJ9B 3QIWD 1LEIB 4DGIH 2DJUA 1I7TA 3FT3B 3BRFA 3DSFL 2BY3A 5GGSA 5B8CC 3KPOB 4LKXA 5CBEB 3W0WB 3WE6A 4CMHB 1IGYB 2F74B 4Y19E 1DBKH 2Y23A 2YPLA 1WIUA 4M6NL 1H3XA 4ODHL 4D0CA 2A2QT 1MJUL 4NKDA 5IGXH 1BWMA 4IJ3B 4U6TA 2ZSWA 3HA0A 1P9MC 1AXTL 5K9OB 1GGTA 5JXAH 1J1XL 4BSVB 1ZVSB 1JGEB 2YN3A 4DFIA 3QIUD 2IADA 4K7PH 4XCNA 3QDGE 1X7QA 4OFPA 3C2SA 4I5BA 1L0YA 4LLWA 1IRAY 3UTSA 3VXUA 2WNGA 1JGUL 1C12A 1DFBL 5TDOA 4FQ2H 1JTTA 1PBYA 3EYOA 2AQ3A 3OAUH 1OAQL 2V7HA 1RUQH 1LO0L 3DHJA 2QADD 1UG9A 4EOWL 1J7VR 4LGSB 2YPKA 4JHWH 3EO9L 4F7EB 4OLZH 3KPTA 3VFWB 2J8UA 4IM8A 4GW1A 1B90A 2OR7A 3PUCA 2G9HA 3X17A 5L2KE 1LEKA 4N5UA 2X9WA 3VD4A 3GBNL 4NRZB 1TZHA 4WV1B 1JP5A 3KPQA 4HZAA 1QA9A 4GRWE 5ITFB 1GZQA 3CUPA 4RFEB 3LKNB 5TPWL 4ODHH 4CN6A 3UX9B 5KVGH 1MCQA 5KVGL 2YPLD 5D1ZB 4EQ3A 4WUUD 4PJ7B 4WTZA 1MFDH 3WEXA 3GHBH 1MI5E 5CBAA 2YN5A 3V52H 5C09E 1U3HC 1P7QB 1INDL 4LDOB 4PJ5D 4KHTL 5D1QB 2J5LC 1AXSB 5C3TA 1FH5L 5I1LA 2DQEH 2HKFH 3VXRD 3EZJB 4X7CC 4I48A 4HUUB 4L3ED 4ELKB 5DD5L 2VLMD 1Q94A 2EXYD 6FABH 5IJVB 3L5JA 4JRXE 2XV6B 3OV6A 4UILL 3KPMA 1A6AB 5CD3B 1CTOA 3CC5B 4AMKL 2BC4B 3ZL4L 3Q3GA 5JQ6H 3OB8A 3VXRB 4OZGB 1KTDA 1F4HA 2X1QA 4P9HC 5HHOD 2AV7A 2OTWB 4QRRB 1Q72L 3U0PB 3VRLE 3HMWH 4JRYA 5DRXB 1UKSA 3RWEA 2K9UA 5GSVB 3ZDYF 1NLDL 3TFKD 3RUGF 3FQXB 3DX6A 2BK8A 4LLYA 4CNIB 4JQVC 4RWHA 1I9IH 4JE4B 3MJGX 1SHMA 5TQ0H 5ISZB 4NRZA 3UTTD 4ZMAT 3O4LD 3TYFA 5BRZA 3VXSB 4RMVA 2HYMA 4YDLC 4UUJB 4G6JH 5KS9E 2A9NL 4F7EA 4PTUA 5IMKB 4KPHH 2A74A 3BW9A 3MLTA 1RUPH 3UJJH 3ZHLA 1NFKA 4KUCF 1KN2H 3V7AG 3VFMA 2Q3ZA 1MQKH 2HFFA 4HJJL 5CBAB 3WXVH 5F9OH 3RVWD 1OF2A 3TESA 1RURH 3P4MA 1EFXA 2VERN 4KQ4H 4Y16A 1EGJL 4LEXH 1KJ3L 3LH2H 3RTQD 2J4WL 4XVUD 4WW1B 5FA3A 2R29H 1DUZA 4UV4H 4X6FA 1SQ2N 3BJ91 2D31B 2EIEA 2ZPKH 1J11A 3DX6B 4BH8A 3BE1L 1LD9B 5EOCH 1C8PA 3G6JE 4FFZH 4JM4H 1QRND 1PAMA 1QNZL 3HHRB 4XNYL 5DD0L 1QNZH 4XNYH 5DD0H 3MR9B 2NXZD 4IRJA 2D03L 2FO4B 3B2UD 3SE9L 4DTGL 2Q76A 3KYOB 4IDLA 1KSRA 2NY1C 2CLRB 5J11C 3GI8L 3LKSB 3G5YA 3VFSB 3WLWC 1FL5B 4EDWH 3LKNA 2DI7A 4U1GB 5JPNB 4OLYL 5C6WH 3UCRA 1FG2B 1IAIM 3UJTL 1DQML 1JGLL 2W0KA 1G0DA 3O45B 1F6FB 1MQKL 1CK0H 3CFEB 4FNLH 5ANME 3DV4B 2G9HB 5ID1A 2P7TB 1WFTA 2VN4A 2EDFA 3CFJA 3D0LB 4OUOA 1IAOA 2H3NA 4ZUWA 2YOCA 4QRSB 5FGCB 2X09A 4LSTH 4OF3A 4YDLB 2C3HA 2YXMA 1AO7D 4KQ3H 1KPRB 4JDVB 4CUCA 1A14H 5DWUL 3KJ4B 3IKCA 3QPXH 4FQQB 4AZ8A 4K07A 4NP4L 2CLVA 4H0IA 2NW3B 3DX7A 3LEVH 4IHOA 4F9LC 1V7ML 3C09B 3F7QA 4BK5A 1ZT1B 2B5IB 3IJHA 4QHUB 3HS0B 5HHXL 3E6FA 3R1GL 3MX0A 3VRJA 3G6JB 2UY7A 3U46A 4HUNB 1XCQB 1NC4A 2D9CA 5I9QB 2P5EB 3PGDB 4ZNEE 4M1GH 5EBGA 2CIKA 1RFDH 1PD6A 1N5AA 1PW3A 3DRQB 2NXZB 1EIBA 2XFXA 2H1PH 4ZDHB 1NMAL 3ROLB 3C2AH 4P23C 1ZLWK 2L0DA 5IVXE 1H5BC 2C4FT 5IBLC 4GXUM 3OR6B 1EFQA 1U8MA 4GKOA 4U6VL 4YPGA 6FABL 1HDMA 3D69A 2JIXD 2F5BH 2WK2A 4LRIC 2UUDK 3GIZH 4YHPB 2VKWA 3CFEA 3NBNA 3RVUD 2I60L 1OM3H 2CR3A 5JQ6L 5I1JL 4YFLI 2WBJA 4YHYC 1JV5A 3E2HB 4JG0H 5DJXB 1IKFH 5DVMA 5JPNA 4Y19A 3ZKMC 2GITB 4XP4H 2BXZA 5IWLC 1DQJA 3L3GB 2NNAA 5C0CA 2ITDB 2JF1A 2BFVL 4HH9A 3UO1L 2A77L 1X5XA 4HHAB 5ESAB 4AYFA 2AJXL 1ZSDB 4JKPH 1WBZA 4F15B 1TPXC 1BFOB 4JFQB 4NQEE 2IAMB 4LCYB 4OZGE 5JIPA 4Y4FD 3RWHA 1WWCA 1T6VN 1MCRA 1N3NB 4Y4HC 4B53A 1PKQB 1T2QL 4ORGA 1I7UB 3ECBA 3MV9E 1A22B 3HC0B 1PG7X 2X4RB 1A21A 5I1KH 5D2NB 4FQXB 3OAUL 5HI3C 1NANI 4G6AD 5FO9B 3EYUL 1JVKA 1MRFH 4HKXB 1YN6B 3S37L 4YIQA 3OZ9H 4JFXB 5J6HB 2HTKD 4YBLB 3SPVB 2NX5B 1KACB 2GSIB 3LKPA 5GSRB 4Z0XA 1UXSB 3BQUA 3MV8E 5CFHA 1Z3GH 3L3IA 3MO1A 5T3ZL 3D0VB 3TIEB 4X7DC 5FOBB 5GRUH 2AP2A 4GKSB 3U1SH 3C87A 3C6LD 4ZPTB 4HH8A 3QWOA 2MCPL 1BD2B 2KZ1B 1HXYA 3MUJA 1K4DA 1MRDH 1XGYH 5IROC 4M7LT 3PWVA 1REIA 1DBKL 5GGVY 2H9GB 4G9FD 4JO2H 1J1PH 1NCCH 4I13B 4WW2A 1YNKH 4YHYB 4S0SD 3MRMA 3H3PH 4G7VH 5JXAL 4WTZG 4OBSA 3FL7A 1QPXA 4Z78A 2DWDB 1CFVL 1NCBH 3OKDA 4Y4KB 3LSOB 1XIWB 5HDQH 4FXKA 1LDSA 3B9VA 1AIFB 3AREB 1AGEB 4XC1L 4F9PA 4P5TB 2XI9A 1TPXB 4HEPG 5ID1B 4MNHB 3QDGB 5F1IB 5C08D 2XN9D 4XCEA 3JWOC 4XWOC 1I1YA 3EDFA 3PWJA 4ODBD 2HMID 1MJJB 3C60A 4WI3A 4BYHA 1NMBH 5DZOA 3V5DA 3H6JA 2P5ED 5EOTA 1A6WL 5C0NC 4M1CD 1XGRA 5D93B 3FB5B 1ZS8B 1M6OB 4Q2ZA 5DQ9B 3I2CH 1WBZB 1L9NA 1HSAA 5TE7H 5D70H 5HI3D 3SDXA 3RWDA 5C0JA 2HJLA 3CFCH 3WEXB 1BOYA 4OCRH 5F71A 3M17B 3NFSH 4HG4J 5DT1L 4Z7WB 1Q0XL 4DCQA 2VDKL 3ISWA 3UTZB 5I17A 3OAYK 4F8QA 1NCAL 2NMSA 4R90H 1KJ2A 3TNNA 4V1DA 1ZHBB 1YYLL 2F54E 3QQ4B 3T1FA 1QSEA 5ANMA 2FGWL 3ARGD 4BH8B 2AKRA 1R24A 2K3TA 1ZA6A 4K7FA 4MHHI 3QZWB 4U3XA 5D9SA 5JPMB 4OQ1A 2EXYC 4XCYA 3GNML 2FHCA 3T0XA 4ELMA 3QQ3B 3HKFA 4YHOH 3VXQA 5E5RB 4OT1L 4A2MA 4PGCB 4MA7H 4HXBH 5FGBA 1HHJB 5I1IH 1T80A 4JM2C 4NUJB 3PE9A 5LKNA 4PLJC 4ODTH 3DX9A 4KJWD 1CD0A 1DVFB 1NMBL 4HPYL 1KB5H 4OB5L 3MV7E 2B4CH 3I9GL 4I8DA 1BBJA 1JPGB 1AQDA 3I84A 1I75A 4X6DF 2H2PD 5EU7C 1M7DB 2AABH 4G8IA 2VMFA 4IS6B 2UVFA 5D7LA 3MROB 2P45B 5EBLA 1F3RB 2LU3A 1HH6A 1AE6L 5L2KD 3VJ6B 3CMGA 1X4XA 4EI6A 1U8OA 1FC2D 4LNRA 3DO7A 1IJ9A 3JTTA 4P2YA 3HAEA 2MTPA 2VE6B 4NBXB 2YMXH 1FAKT 1I3VA 1Q0YL 1QQDB 5F89A 5IBTH 4YXKL 1DFBH 2UWEA 5C0ND 1T66C 4MA7L 1ZT4B 5I6XC 4OLVH 5IB2B 4IBLT 1CFVH 3TCXA 4WO4A 4JANB 4OF7A 4RGND 2VDOL 4R0LA 4TYUA 2PUQT 4IDJH 1XF2A 2I5YL 4KK9D 5ALBL 4BZ2H 3V7MA 3ZDXE 3WL9A 5J1TC 1D5BB 1BJMA 5DFVC 5FK9B 5HHNA 2CQVA 3ARTA 1CXIA 1Z3GL 4LP4A 2R23B 4R8WL 4QY8A 4JQXC 4IOSD 3UPRB 3ZT5A 3FRPG 1ADQA 1UM6L 1RJLA 4LCWA 5IFHH 5HPMA 2FX7L 2CLRA 3Q1SH 3RP1A 1F3DJ 2A6DB 2W60A 3NAAL 3O8XC 1SJHB 5D2NE 4IJ3C 3E8UH 5FB8A 4LCUB 4MJIE 3L3JB 3BIKB 5MEQA 5F1SA 1VADB 1QR1A 4HCRL 3MCLH 2HMIC 3GJFK 4S2SA 2R2EB 3WFCH 4U6XA 2GUOB 1YPZE 4NQTA 4EEEA 2B7DT 3QAZB 1HDMB 1RULL 4M5YL 4WW1A 5FA3B 2Q87A 4R0LB 3DSNA 1WQVT 2FL5B 4B5EA 4YBHA 1ZK9A 1U6AL 2JTDA 5DJCB 3H7BA 4X5WB 5KAQG 2XQYG 4NQXA 3PIQB 4KRPB 2CRYA 5EZLA 5F9AC 3T8XB 2Z92B 3QEHB 4JLRA 5T1MA 4KKBC 5IBUB 4M48L 4WTXA 2VE6A 4KK5D 5ACZB 4MAYB 2WIMA 4HT1H 5CHNB 5MENA 1L9MA 3DO7B 3TVMC 3O2DA 4MQ7A 4JY6B 5INDB 2ZSWB 4R97B 4G9FE 4YZFF 5CUSH 5FF6B 5DEGA 3WYRA 4DTGH 5EBLB 4WEUD 1S5IL 3QXTA 2FZ3A 1X5JA 3MOBL 4POYA 3L5XL 2ZG1A 8FABA 5CEYA 3CXDH 2DICA 3QUKB 1F4WH 3FO0L 2DD8L 4TSCH 1VGKB 3AU1B 5IOPB 5D5ME 2NTFA 1Y18A 3RNKB 3GSNL 3K74B 3OKKA 4ZODA 4L4TD 1VFBA 4P59L 4F58L 4QY8B 3RBGA 2HKHL 4MJ5A 3GRWH 2HT4C 4BUHA 1UWGL 2XWTB 1PDKA 1KGCE 2VLJA 1EO7A 1INEL 4NO3A 2VIRB 2MSPA 2AJUH 5JOEA 2ZCKH 3MJ8B 4N0UA 2EKJA 3OBAA 3BYYA 2FX9L 4DEPB 4PRPB 5DYOA 1FN4B 4TSBH 4AG4H 1PX4A 3NCFB 15C8H 2QJDA 4FP8H 5J8OA 3VXOA 3ARGB 3B2VL 5D96B 1S3KL 4DKFL 4H26A 4R97C 2DQHH 1KB5A 1QBML 5CEZD 1SJEA 4FQPA 5DJAB 1AGFB 1UEMA 2EKSA 1I9IL 1QBLH 5L0QB 3MFFA 3D85B 4RGNC 2ZCHL 3W0WD 2EYSA 4YFLF 5I1GL 1P7KA 3IJYB 3GUTA 4C83A 3QNXA 5H37G 3QIWB 5DFVD 4MQSB 1TJGH 1X44A 2BVQA 5CKAA 7FABL 5E8EB 1ZGLB 4P0DA 5FCUH 2C1PB 4OFYA 4U1LA 1P2CB 2EDNA 4OCYH 5C0BE 3VFWA 2YD2A 1U93B 2F53D 4M93B 2P46B 1PQZB 4I77H 1MCPH 4OF5A 1Q1JH 3U83A 4WWKC 3BUYA 4R4BA 2WP3T 1OT1A 1WCBB 1U8KA 4QWWD 5C0BD 5DI8B 2MQ0A 4GSDL 2EDHA 3DTXA 2W1NA 2HFEB 3HPJA 3QJHB 1EZVY 3L9RB 1MVUB 4GG8B 1N8ZA 1B6UA 4YNYB 3SDDD 4UV7L 1A4JA 3SGEI 2XA3A 4FTVA 2RR3A 4Z7QF 4HPOL 4CW1A 5JLZB 4PB9L 1I3UA 5HHPB 2C3GA 1SYVA 2YD6A 1DDHA 4JN1H 5MEQB 3MBEC 5ANMB 1RUAH 2J8UE 4P3CL 3RDTC 3CPLB 1WZKA 1I8KB 4V1DB 4OUUA 5F88B 1VPOH 4WU7A 1TQCB 4NRXA 5KZCB 4LMQI 3BZFA 1NGPH 4JZJB 2VITB 4OBRA 1KXQE 1OGAE 1FO0B 4RFNB 2D7MA 2NY6D 1XCTA 3NFPB 4PJHE 2WQRA 4KK6C 4LCWD 1MIEH 1VHPA 1BOGA 5AAMA 1FORL 4ZAKA 4OLWL 1LK3L 1OGAB 3C09C 3EKCA 3QRGH 4PJHF 4RGNB 1MFBL 1G0YR 4X6BA 1KIQA 1JI1A 1TDQA 5D2NA 3VXUE 1U41A 1U3ZA 4MQXC 4GKZA 4I9WE 3TT3L 4ODWA 2CMRL 2R2BA 4K8RH 4KKNA 2ADJB 1FGNL 4Y1AB 1ZLUH 3BEWB 5CSGA 1IM3A 3VXRE 4AEHH 3O2DL 2UWEB 4QXWA 4FXKB 1FNEB 4V2BA 1T04B 5D7IB 2HJLB 3ZTNH 1T5XB 3GSVB 4L3AA 4M8VA 4HS6B 4AM0A 4WI4A 4Z8FH 4OZ4B 2DYPD 2ESVD 1ROWA 5IKCA 3O41A 2XTJE 5H94B 3IDIB 3OKOB 1YNTA 4RWYL 3O6FB 2KDGA 2AK1H 4QRTA 4HUXB 2LE9A 3UDWA 1DDHB 4RAHA 2CDEB 3VXSE 3FT4A 3T2NH 1PG7L 5C0RH 3MRPA 4X4ME 3VXUD 1OB1B 2DDQL 4FZEH 4OD3L 4KPHL 4CBPA 3UTOA 2WP3O 3MRFB 4NQCE 1OSPL 4PRID 3OJ2C 5TDNA 4G80A 3UJJL 2F54A 2Z31B 3X3GL 4P2RA 5J57B 1CDUA 4HWBL 5KANG 4LCWE 1U91A 5KTEH 4GKNA 1MHHB 1E28A 1G7LB 4RMUA 3MV9D 5FYJD 2X4OA 2BVPA 1MLCA 1QOKA 1JGVL 4XRCB 1TETH 4X8XA 5I16A 1U3JA 3I6LD 3O3BA 1BLNA 2C4FU 1DQDL 3AS3A 5C0BA 3VE0A 1FAIL 1U2HA 1IAIL 4P23B 2XY1A 4TSBL 4JDTL 1LE9B 4MSWA 4ONOA 4RAUA 2IAMA 5FYJL 3ARDD 4QHNB 4JJ5A 2F8XC 3CK0H 3B8SA 4ISVB 1YEFH 3RHWK 2W0PA 1AKJB 4UOW1 2EDYA 3RWCA 1XGQA 2OL3H 4E42A 2GCYA 1QBBA 2YD8A 3QIBA 5ICZA 4H20H 5ECJE 3QT2A 4MVBC 4Y1AA 4EI5A 3DRTB 4KKCC 4HWZB 2Z8SA 4M1DL 3ZT7A 4XPFL 3WXWH 1F6AA 2EE3A 3HPLA 1QO3B 4R7NA 1T7YA 1V7NL 3O11B 2FGZA 1UFUA 4HF5L 1FORH 2BSRB 2YC1A 3QEQA 2FX8H 2F15A 1KEML 4FTVE 1XF1A 1JGVH 5LGJB 3CVIH 3QUMA 1MCHA 3GMLA 5D8JL 4DN4H 1BZ9B 1FVEA 2AEPL 4JFEE 1YZZA 3U2SB 2UZIH 1F2XK 2ITDA 15C8L 1T03H 1OTSD 4MDIA 2A6IB 2GITA 4NJAL 1NGQH 5DD1H 3H42L 2AABL 3QIUC 5DR5L 5EZJA 4GBXA 3NCCB 2F53B 3BWAB 1O7VA 3H2WA 3BKCL 5LGHH 1T1WA 4XB8A 5IMOB 2BNQA 5B8CA 3DXAD 1JN6B 4OF0A 4TSCL 2VO5A 3VFPA 1G1CA 3BVNB 1CFTA 1U8MB 3DETD 3P4LA 3S97C 1T2XA 1E28B 1G7LA 2WBKA 4OF6A 1GGYA 1BGXL 4LPYA 2CDFA 5IESH 4NQEA 2Y7QA 3NH7H 3LS5H 4NO5A 3MRQB 5GGTA 1MY5A 2NX5A 5EBWB 5IB4A 1IMHC 1NMCC 1KIPB 2QEJA 5FM5M 3TZVC 2XZCL 1JWUB 3EO9H 3MYZA 4PTUB 3NPSB 3FAXA 3LDBB 2X70A 4R26L 1DANU 4XVJL 5D72L 2AEWA 4U1LB 1BX2A 4HKJA 1T0MB 3FFCB 4MAUL 3RAJL 2XY2A 4RFNC 3KJ4C 4LCCA 3HG1E 3IJYA 2R1XB 1QR1B 4LCYA 2AERT 4X5XB 4J6RL 3B9KB 2OZ4A 2HTLD 3F8UB 3GMNB 5I75C 3C5JB 4JFED 3EHBC 3KPNA 3OQ3B 5DGQA 5CUSL 4NKQB 4DVRH 5JHDD 1T5XA 5B21A 3TWCL 3P9MA 1S9YB 1I9JL 2VDML 2GQHA 3IJSA 4ODSH 2FGWH 3WFBH 2R56L 2EYTA 3IYLW 3V5KA 3MCLL 1D9KA 1KJ2H 5E9DE 5CCKH 3HC3H 4FXGB 4XX1G 2P47B 3P4OA 4AEFA 3KNBA 2CPCA 2EDWA 2VLRE 3EFDL 4QRUB 1GH7A 3D9AL 3KPMB 3O6LL 4CMHC 1WZMA 5CJ8A 2HT3D 3WUZA 1TNMA 3ULUF 1KXVC 4J8RA 4DAGL 4P2CG 1UENA 3TM6A 2VDRL 3EOTL 3WDIA 1V5JA 3N1FC 5C0DA 4OGZA 3IVKB 5C0GB 3FB7A 2R39A 3OPZL 4G8EB 3ZYZA 1BM3L 1D5IL 4P46B 1CWVA 4HUKB 4JB9H 4K71C 4AH2B 4Y5XB 2YBRA 1CR9H 1U8HB 3LKRA 1BJ1H 5HSFA 1CLZH 3S4SG 1NCNA 4O5LH 4XXCA 2X1OA 3MC0A 3QP3A 1VEOA 5FEBA 4XTRC 2R8SL 2Y07L 4X4YA 1RK1B 5TDPA 3VXSD 1R3KB 1IQWH 3DROA 1U95A 4NC0B 2FJHA 4P4KB 3U6RA 1VERA 4OQTA 4PJGE 4MA8L 5T5FL 4B41A 3BP5B 4YHIB 4FMKA 4EJ1C 2ZJSH 5LXGL 3IAQA 2IH1B 1A7NH 3JV4A 4HDIB 4PV9A 5M7QA 5E70A 3KHQA 2GTWA 4HWEL 3QDMD 1UKQA 2BNRB 3MLZH 5CIPH 3RKDC 5IIEB 4LK4A 5CD5D 2Q7NA 1YMHB 4TNVF 4EKXA 3U0TB 3VFUA 4X80L 1P69B 1QSZA 1Y6MR 2C7UB 5EA0L 4UAOB 5KG9B 3QNXB 4HV8B 3T3MF 4WUUE 2FBJH 4FG6D 4XPAL 2D0GA 5I0DA 3WMSA 2YWZA 3Q1SL 1G7HA 3VXTA 2Y5EA 1TZIB 1NCUA 3G5YB 3O8XD 3AC0A 4LU5H 3OWEA 3WSQL 4WFGE 1AKJD 4AQOA 4KAQL 4OI8A 4ZNCD 3O2WL 3VWKA 2P8PB 2R4RL 2B1AL 4O4YH 4D9QD 4PYHA 3AGVA 2I25N 1T89A 4IRJC 2EDDA 2DLEA 3OR7A 4DW2L 2AI0L 2QADC 4HC1L 4KHXH 1AR1D 3E6HB 3IFOB 3PP4H 1U8HA 2QQNH 3E0GA 1RZ7L 3LKRB 2ADIB 4Y2DA 5IESL 1QFUL 2IBBA 4HXBL 4X6CF 3H0TB 1OGAD 5D1QA 5TF1H 2OR9L 3UEZA 2X4UA 3KGRA 5EZOH 4Y2DD 3EOTH 1T6WA 5KJRH 4NJ9H 4GSDH 3GIVA 2JB6A 4NO5B 4AG4L 1UM5L 5F6IC 4I18C 1R5VA 4NNXB 1HH9B 2AJVH 1FL3B 5HGBA 3HZVA 3AY4C 4BFEA 4KGLA 4K7PY 5IFJB 2E6QA 4TTGA 1JGEA 2BRQA 5E4EC 4LSRH 5SWSD 2G75B 4WV1A 2OJEB 5AUMA 4LLAA 2EDRA 4KI5C 5EO1A 3TF7C 4QYOA 3DIFA 5FYKU 5DURB 2BFVH 2C1OA 1IGJA 2DQGL 4M1GL 2Y6SD 3E8UL 1C7SA 4O58H 1BEYL 3HFML 1LQSR 4OM1L 5MEOA 1FFNA 4PJDF 5EZLB 3BH9A 2IBZY 3T08A 3OKLA 3S96B 1A1MA 5D7SL 4JG1L 5I18H 3L3IB 3MO1B 1MCSA 3HE6A 4OFVA 5A2JH 1MCIA 3DMMB 5GGVL 5ADPH 2DQIH 4N8VA 2CD0A 2OR9H 3CXHK 4EUPA 4PP1C 1OSPH 3L3KB 3KS0H 2XZCH 4UDUA 2X7LA 2R1WB 4QXUL 1J8HD 1KLUB 1ODAA 1T1YA 2W92A 1G9NL 2CO6B 4ELKA 3LMJL 3ULSB 4JY4A 5D7KE 2QHLA 1NBQA 3JWOL 1Y6KR 4WFHE 5HGAA 1M71B 4LBEA 1OM3L 3BIKA 4OSUH 3V6BR 5FB8B 5FM4A 5DK0A 4OIIL 4U33A 4PJ7A 2WIIB 1XMWA 4F7CB 4Z7OE 5AZEH 3VWJC 3MRCA 4K9EL 1LMKA 2YMXL 2O61A 3D39D 3TV3L 1FNSH 4Y4FA 1QZ1A 4PREB 4ZPVA 5F8QC 3TGXA 3LDBC 1JCKA 4I18B 4PV8A 5I2IA 4HGWB 3RHWF 3T0AA 1S7WB 4Y5VB 3F7VB 1MIEL 3GI8H 5IWLA 2IC2A 1LO3H 2RIKA 5B4MD 3T65B 3PV7A 3PWLB 3OXRA 5C0CD 2FJFA 1E4XL 2BSRA 3KPSE 4XCFL 3SJVA 5GRXG 3CXHJ 4KFZC 4J1UA 5I1CH 1OLZA 1T1YB 3CFBA 4CN1A 1CZ8L 3MRNB 2M2DA 4EI5B 5F7WC 4LPTA 3BMWA 1X5IA 2R0ZH 4NM4L 5KBNC 1JWMA 1K4CB 3QO1A 1AGDB 3BIAX 3V5HB 1OTSC 4K2UL 1GGCL 1FO0H 1YEJL 4JDZA 3WLBB 4Q9RL 1FO0L 3C5JA 3D2UA 1D5XB 4KTYA 5FAAA 3C6LB 1RY7B 5F3HA 3I6KB 1A3LL 4OTXL 3HMWL 4O5LL 5IV2A 4LNRB 4LVNC 4N0FB 4UNVA 3U4EA 4MWFB 3BQUC 2E9BA 4MXQC 2EE9A 3QEGL 2J3SA 2BNQB 4BA8A 4D9QE 1ITCA 3I6LE 3TO4A 1ND0A 3BGFC 4FQCL 3PHQB 2O5YH 1UT9A 4WFFE 4LQ1A 1CYGA 2EDXA 5F7MC 3O2WH 1KT2A 2X2YA 1DUYA 5DJDB 1CLYH 4N0CD 2C3VA 4W68A 4LQFH 5KOMC 2MPAL 5BO1H 2P44B 4KJPD 1ZKAA 4NYLB 1XF3B 2Y7QB 3P11H 1GRWA 3W9EB 5D5MF 4LDEB 4N1CA 5DJ0B 4D9LL 3EYUH 3ULVL 1IQDB 4X0KA 4LVHC 1JTPA 5GGTL 2NQCA 4XVTH 2XACC 1MCNA 1BFVL 2UUDH 4XWGH 3FQWB 1MHCA 4FQ2L 3W11C 4AMKH 4LEXL 5GS2D 5IW1A 3BEVB 4AEHL 2PCPB 3U9UA 1AO7A 1JRHI 4HAFA 4X99B 5L2KA 4HIHB 5GIRA 1HYSC 4UOW0 1JUFA 1D9KD 4QRRE 3CFDA 4F3FA 4PRIE 5I17B 2AJYL 3T3ME 5MERA 1TTGA 5FHBH 2O61B 3H9SB 1UVQA 3TT1L 4P57A 1HXMA 3QWRA 5BS0B 4QGYA 1KF9B 1XGUA 2NYYC 2APBA 3VGGA 2ICCA 5F72S 5CLWA 5I1EL 1ZGLP 3WKNA 5FYKH 5EZIH 3SGJA 3SDAA 3AVEA 3QBTB 4K9EH 1NGPL 2R2BB 2PO6C 1XR9A 4PD4J 2VLKD 4EUPG 1IAKA 4PJXF 4ALAL 5IKCB 1F58H 1OAYL 4QO1A 4Y89A 5E00B 3V6OC 2IBGA 2ARWA 3QI9C 1CCZA 3U82B 4XVSL 1MLCB 2YUXA 2VKXA 4Q9BA 1XH3B 1I8MB 5C0AD 2OCFD 2JK5B 4JRYE 3IKKA 1FNEA 3VWJD 2YEZB 3AXLB 2J12B 4UT9H 2MKLC 1JF1A 4UV4L 5INCA 4QXUH 3MV7B 5BMFL 3TNMA 1FNHA 4HZLB 4X9HA 4G3YL 4WU7B 5D7JC 1ZT7B 4KDVA 4NIKB 5DZNA 3HC4H 2P5EA 4XH2A 2Z31C 5CLTA 2R1YB 1MHPH 5C0IB 2VQTA 4L8SC 5HHOB 2V2TB 4Z95L 1IC4H 4MWFA 2COQA 3HUJF 3G08A 3DX7B 3I6KA 3SDDC 4ODSL 4IRSB 4F37K 3Q5TA 5I73B 2IANE 1J1XH 3LQAL 3FRPA 3HR6A 4P2OD 3VWKD 3O4LA 4K94L 1F58L 1OAYH 4RRPA 4XCCL 2JIXB 3HLAA 5DJYA 2ATKA 4PJ9D 2YS4A 3BDYL 1TCRA 2VLJD 4KHTH 1HSBB 3SPVA 4HXAH 1K4CA 3LKQA 3QO1B 4HF5H 3QRGL 4ZO7A 4HXAL 3B9EA 4NM8H 2BZDA 1FV1B 1MOEA 1XF5B 5SWZD 5TFSL 3U9UB 4G9FA 1J9CT 5ELIA 5DMGD 4NPYA 2CK0H 1JF5A 4F37F 1H3PL 1PFCA 4QRPE 1S7SA 3BT2H 2YA0A 4TNWK 1FHGA 1PJ9A 2CXGA 3BMVA 3X13B 3T77B 3ZL4H 1RZKL 2DMKA 1NL0L 4WO4C 4X7SL 1NL0H 3GBML 1U8PB 1ZSDA 1IEBB 2XN9B 1D7FA 3QO0B 3KLHD 5I30L 4JAMA 3NN8B 3KAAA 2F58L 3VG0H 2F9BT 5IOPA 3VXMB 3QUKA 4U4BA 1MFEL 4W70A 3GSQA 5C7XH 5GRVL 4LAJH 2BHUA 3VXTB 1OY3B 3LB6D 1QLEH 1HHHB 5GJTL 4KTEH 5JORA 1LP9E 1QPPA 1YQVL 3C5ZD 4ZTPH 5HHVL 1S9KC 3W81A 4P5TA 2L4OA 3FB8B 5LQBL 3JWDC 4ZO8A 1ORSA 4YLQT 1EFXB 5DVLA 1OAUH 4RDQF 5CKGA 4F7MB 3B6SA 2IWGA 1RUPL 2NY6C 5JNYB 2FLRT 1ORQA 3CDGB 2A9MH 1WZLA 5FYKD 3WS6C 3NCMA 5HJ3B 1CICA 1CG9A 1GGCH 4J3OC 1RIHH 2BMKB 4RIRA 5I1JH 3LD8C 4PGJA 3ARBD 4NNYA 4LSUL 5DFTA 3V0WL 3D87B 3PDOB 3BVNA 5E8NA 2QSQA 4GMSH 4TQEL 3SBWA 4Y5YC 2JE8A 2C3XA 5CGTA 2X4PB 3X11B 3WO4C 4C83B 5J89A 3UTSD 3P30H 2MFNA 3UPCA 4JZOA 4QHMB 1T22B 3MJ6A 1AI1H 3MUY1 3CFKA 4FS0A 3SE3C 4K3EH 3ETBF 2XICA 4NCDA 3WLBA 4P48A 1F11B 4HCRH 3QQ9C 2BSED 4FQHA 2JJSC 3RA7L 3ARBB 1G7PA 4PRHB 1KB5B 3ZE2F 1CLOL 2XA8L 4WO4D 4MS8D 4X6CA 1G84A 2D9QB 4ZUWB 1IAOB 2H3NB 4BZYA 2HJKB 4QTIH 3SKOB 1RPQA 1S9XB 1KLUA 3NA4A 3ELAT 2J8UF 4CU8A 3V4PL 1QACA 1T7XA 2XWBA 4HSQA 3UTTB 3RVTD 1CFNA 5BVJB 1QFUH 1K85A 2I27N 1FZKB 2XWTA 4N8VB 4YEFA 4EN3C 1NEZB 2IH3B 5DVNA 3MFFB 4AEEA 2V5TA 1J0ZA 5IUSA 2Y06L 2LV4A 2OTUA 1IC7H 3F5WA 4DZBB 4ERSH 4M7LL 1S9YA 4C54A 3RUGA 2OI9C 1GIGL 3TA3A 5IVXB 1TVBB 1RZJC 3G04A 5CWSA 5JW4M 3UPRA 4KVCH 1RUAL 4P3CH 1RD6A 2HT2D 3RY5A 2DQGH 4WGVB 3SDCB 4BFBD 4JGJA 4MSWB 2R1WA 2GK2A 3U0WL 4OZIB 3HMXH 3ZE0E 4OQTH 3EYVB 3I50L 1MUJB 5ENWA 1YC8A 1YMHA 5HPOA 3WO4B 2CIIB 4CADB 3MV8B 4ZFFB 4MDJA 3RNQA 5E2TL 1RZ7H 3UXFA 1JGUH 1GGBH 4MJ4A 1DL7L 2NX5E 4ZS6D 3UYRH 1SY6L 4LSQL 3GB7A 4GRLC 3WIFB 3QFJE 1F4AA 2MMXA 2B0SH 2CDGB 5FECB 2VDOH 4R26H 4L4VE 3FO1A 3MV01 1X7QB 5EIIB 1SMOA 2VXTL 5ID0A 1W0WB 1N5YL 2MHAB 4WWKA 3QH3A 2UY6A 3JTTB 5T1DH 3U6RB 2IPTL 1S9WA 1MFCH 3JVGC 4X4MA 5F6HJ 2CKBB 2NY4D 1FVDB 1CE6B 3CU1A 4YZFE 1B4JH 1J8KA 4X4YB 3DXAE 4CVWA 2A0LD 4JPVH 4MCZA 4PRIB 5BVPH 1H8SA 4LP5A 3B83A 2DWEB 3HRZB 2ZG3A 4NNPL 3STBA 3HZYB 4JY5H 1WWAX 1Z9LA 2JJWA 5I74C 3MJ9A 3QXAB 4YXLH 1YEEL 3TH4T 3UJIL 3CC5A 4AIOA 5C0GA 4JVWA 3QCTH 2V2TA 1ZA3B 1CBVH 1FPTH 2E7CA 4RZCA 3VRLF 4G6ML 2GUOA 3ZYIA 3V6ZB 3EOBA 1CXEA 1QVOA 2WV3A 1A5FH 3LOWA 5HDQL 2X5PA 1A5FL 3S37H 2VDRH 1IEAB 3NCEB 3B9DA 1KIQB 4C56A 3P4NB 3DRTA 5CGMA 4WI9A 3RZCA 4K55A 4N68A 4R6UA 2A6DA 2W60B 3LKQB 3BXNB 3GGWB 1H8NA 3TZVD 3ZT6A 4PG9B 3LEVL 2XKNB 3WV0A 2GW5A 1VA9A 3TJHD 5FA4B 1MWAL 5T1KD 4ISVA 5CJQH 3H3BC 3OAYH 5IHUL 4XP4L 2CKNA 5BV7C 2EDBA 1R5WA 4IRSA 5EUOF 3TH3T 5KVMC 2AKRB 3O6ML 1JUFB 5CZXC 1K6QL 4KMTH 4YHLH 4R96B 4OCRL 3MACL 4U1SA 1IGML 1IQWL 4L3EA 1J86A 3T2NL 4IS6A 5D7LB 5IP4A 2BHZA 2VXSH 1PZUB 4Z0BL 1MPAH 5DK3A 1FLRH 4OCMC 4FZ8L 5DSCB 2R0WH 5F44A 1FP5A 1OAKL 5GZOD 1NDGB 1LWRA 3P40A 1TTUA 3K4DA 4K3JH 3K8KA 4FQ1H 2A0LC 3HI1A 4HMDA 3Q0HA 4U49A 3EO0A 3ME0A 2ED8A 3MNZB 1M05B 1WC7A 5EBMA 3HE7A 4MHHG 4X80H 1QTYT 1R3IH 2NY0B 1NSNL 2AV1B 3VD7A 3O0RL 4TSAL 4G9DB 4LLQB 4CNIA 4X4XA 5CINH 1Q9OA 2ZPKL 4XPAH 1QUNA 4ZFOB 1JIBA 3RWHB 1C5CL 3IJSB 4DKEL 1ZT7A 1P7KB 5F97E 4I3SL 5J9PB 3D48R 1AD0A 3FJTA 2BJMH 2JCCB 1QBLL 3MV8D 2FR4B 3BAEH 4GAGL 4YHZL 4XB7A 3GSOB 4NFCA 4UOJA 2HT4D 2YD1A 1NJ9A 1HSAB 1CFSA 2R1XA 2JK5A 1ZGLM 4PGZA 4M00A 2Z35A 3IFNH 5T3XL 3LQAH 5HY9B 5IHZB 3BISA 2DM2A 4J23A 4PRPD 3GSUA 2NTSP 5I1CL 4W4OC 4FFWC 3GSNA 1KBGL 2D7OA 1NC2D 4LASH 4J3XA 1RJCA 2X4TA