1W0ZU

Urokinase type plasminogen activator
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 59
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w0zU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w0zU01
3VB7A 1XVOA 1J9CH 1MKWK 2Y82A 4XDEA 1PPBH 1ANBA 1P10A 4KTSA 2ZTZA 1BHXF 3TK6A 3ATWA 3M7TA 2W7UA 2P95A 5EODA 3RU4T 3O8BA 4OS5A 3D65E 5FBEA 4NFFA 1GMCG 4TPYA 5CHAC 2BY5X 1DXPA 4U01A 5E2PA 2ZTYA 2HOBA 1EOLA 1P3CA 5E8EH 1FDPA 3LGYA 4TWWA 2FLRH 2KAIA 2WYGA 1MQ6A 1PPGE 1GDNA 4THNH 1MUEB 2CMYA 2J92A 5DP9A 3ATIA 5AHGH 1MZAA 4BAOB 2VH6A 3RXCA 1S83A 3S69A 2EEKA 3NCLA 3VB3A 7LPRA 1ZGVA 4MPWA 2BDAA 4K5ZA 3CENA 2EA3A 1AB9B 1BRUP 5L2YH 2C8XB 3KN2A 1P2OA 3TIUA 1O5FH 4RKOB 3A87A 5A0CA 3S0NA 3A84A 4ASHA 4JCNA 4BAMB 1G36A 3GY8A 5A8XA 3BTQE 1BRAA 1F92A 1P04A 1H8IH 1MTUA 1KY9A 3E8LA 2ZDNA 4Y0YE 2B7DH 4H4FA 2BD3A 1P57B 1FPCH 1BQYA 2ZCKP 1C1SA 1NM6A 4I8KA 3SU0A 3LC3A 2OBOA 3MU0A 4H6SB 2Y5FA 1O37A 1O34A 1T4VH 1YKTA 3BEFB 4KGAA 2JETB 5AFZH 3M3VA 1S82A 2PGBB 3ZVCA 3Q00A 1IHSH 3PTNA 3UWJH 1ZSKA 5JB9S 4AN7A 2G4UA 5CMXH 1J8AA 2FYQA 3HK3B 3VGCC 2FOBA 4JK5A 1Y59T 1TLDA 1OXGA 1BTPA 1OWIA 3ZZ8A 3LDXH 1MCVA 4B74A 1QR3E 1G32B 3DFJA 3ZZ6A 1SG8B 1GHAF 5FBIA 3ZVAA 1H8DH 3FP6E 2IN2A 3LGIA 4WXIA 8KME2 3MWIU 2W3IA 4FU7A 4MPXA 3U8RH 4Y7AA 2W26A 1N6XA 2VWOA 3PWCA 1YCPK 2ZHEH 1A3BH 1EAUA 2A2XH 2FS8A 3HKIB 3VB4A 1GHXH 1GI3A 1EX3A 4J1YA 3V3MA 2G5NA 3EGKH 5C5OA 5JYIA 2ZFPH 3PB1E 4IW4E 5FPTA 3PO1B 1AVWA 2VIDA 2ZPSA 5HGGA 2BD4A 2GMTC 4YM9A 2J38A 1GI1A 1SMFE 1G3BA 1T8NA 1ZLRA 2FDAA 4Z0KA 3ESTA 3M5MA 1DITH 2BM2A 3T25A 3SN8A 3E91A 4HZHA 1KDQA 3ZZ9A 5F8XA 3ODFA 3B23B 2BOKA 6ESTA 1Z71A 2ZDAH 4LXBH 3A89A 1C2HA 1DDJA 1P12E 2BOHB 3HKJB 1HAYB 2HWLB 4WH6A 4HI3A 1Z8JB 4Q80A 4ZKOU 1A0LA 3PLBA 1L2EA 4DY7B 4GHTA 1QA0A 3H5CB 1O3MA 1UJ1A 1P0SH 3M5OA 1K1MA 1C2GA 2B5TB 4NFEA 3LU9B 4TYDA 4WMFA 1F0RA 1OOKB 1SHHB 5E0GA 2QXGA 1H1BA 2ZU3A 1OWHA 1ZYOA 1LMWB 1P2MA 1BTYA 3MNBA 3NXPA 1F0UA 3SV2H 1F7ZA 2ZGHA 2B8OH 1BDAA 2ZI2H 4BNRA 5HYOA 1K22H 1GI6A 2STAE 3UR6A 1NZQH 1AKSB 1GI8B 4UFDH 3E3TA 1K1OA 1TYNA 2H5DA 1GL0E 1FLEE 1SGTA 2EI6A 3M5NA 3HGNA 1YPKH 1SLUB 1C1MA 1FN6A 1J14A 2SGPE 3BTME 4MG3A 3LJOA 1C5OH 2O8MA 2PUXB 3SUDA 1SPJA 1LPKB 2CXVA 3EAJA 3SJKA 5G4BA 3T62A 2FTLE 2VIPA 3RXLA 1O3CA 2GCTB 1BT7A 2FXRA 4K8BA 1DLKB 3RMOH 4O03A 1O3IA 1XUFA 2OCVB 5E2OA 1ESBA 1QCPA 1XX9A 1OWEA 1GMCF 3H7OA 4NIWA 3UTUH 5DKMA 5FXLA 4SGBE 1BTUA 1KXBA 2FOHA 2H9HA 2FMJA 1BHXB 2Z3EA 4CRFA 1AQ7A 1LHGH 1O2PA 5HM2A 3RXJA 1O2XA 1YPHC 4ZKSU 1O2HA 1BB0B 3P8GA 4K69A 2HLCA 2I6QA 4VGCB 2BDHA 2JH6D 1HBTH 4Y10E 1GDQA 1BMLA 1CHGA 4NZQA 1SGPE 4X6PA 3UQOA 1TRYA 1KIGH 1W3CA 2EC9H 2G52A 3F9FA 3BTDE 5GIBA 9ESTA 2CHAB 1WBGB 4NWLA 1BUIA 3U98H 7KMEH 1O2KA 1C1RA 2O9QA 3GDSA 1DT2A 1Q3XA 3W95A 1WV7H 1F5KU 3ZZ4A 3SGAE 4AB8A 2J34A 1LCYA 2CF8H 4XOJA 2XC5A 3GOVB 5EPYA 1A5HA 1K9OE 2UUKB 1PPFE 5CE1A 1C5QA 2ZQ1A 4X2YA 1ELAA 4FXGH 1A61H 4AFZA 1C1QA 2BDYA 4XE4A 1V2KT 3PMBB 2ZU5A 5TCAA 1VJAU 4X2VA 3L6PA 2WPIS 5GCHF 1JBUH 1P09A 2PSYA 4MNVA 1O3NA 4VGCC 4WMDA 8LPRA 4UEHH 3KCGH 1GVLA 1ID5H 1CA0B 2VH0A 1WCZA 1BIOA 2QV1A 2R9PA 1C1PA 3M3SA 2BB4A 4KKDA 1KYNA 1GPZA 1TMUH 2IJOB 1E35B 3PMHB 5EGMA 2ZGXH 2A4OA 2FEQH 1HYLA 4AG1A 2A7HA 5JBBS 2W3KA 5L6NH 3TLOA 2ZWLH 5DP3A 1XKBC 2FLBH 3RLYH 1CGIE 4E7RG 1DLEA 5SGAE 1SQTA 1GJBB 2BXTH 3E0PB 1CVWH 3ZVFA 1J16A 1SGQE 2Z94A 1VCWA 1ZHPA 4MVNA 2TGDA 3BEUA 1AVXA 1MTSA 1G3DA 3BIVH 5C5NA 4CR9A 3RXAA 1QRXA 2I6SA 3RC5A 1C9PA 1TB6H 4GPGA 3K9XB 3OY6U 1OWJA 2F9OA 1QFKH 2UWPA 8GCHG 5DP7A 1CSOE 1QB9A 2AH4X 1HB0B 1CA0C 1ZPZA 3Q3KA 4K3JA 1C5UA 1DY8A 1RXPA 1GBLA 4I8HA 3ZZCA 3MH6A 2KAIB 1FAKH 4K1SA 1WTGH 1NROH 1ZTKA 1C1UH 5IYTA 2ZGJA 4AB9A 1ZZZA 1K1PA 4OGYA 3K65B 1GBEA 4CRBA 1O2YA 2PR3A 2AIPA 1NRPH 1AE5A 1T32A 1GI7B 1ABIH 5GDSH 1NRQH 3N7OA 5DO4H 1IQMA 1SFQB 1NFWA 3FFGA 1MH0A 2C8YB 2VWLA 1A7SA 1P02A 1AUJA 1YBWA 1AWFH 2O8LA 2WYJA 1GJAB 1NU7B 4I7YH 1DVAH 3ZVGA 1GCTB 2VIQA 2ALPA 2WPKS 3F9HA 2ZFRH 2RG3A 4CRDA 2H9TH 1O3FA 1LHFH 2VIVA 1TNIA 1TBQH 1EP6A 4A5TS 1UTLM 3ODDA 2A45B 1EJAA 2Z9IA 1C2JA 1C1NA 5C1YA 4AYYB 2FOAA 3QUMP 3I77A 3UUZA 4BXWA 2Z3DA 3UQVA 4X6MA 1V2MT 3KQBA 1NFUA 1G9IE 1SLXB 1C5WB 1LDTT 3T2NA 3RXBA 4UFEH 1CA8B 1ORFA 1D3DB 3RDZA 4JZDH 1O2OA 1THRH 5F6MA 1BJVA 1OWDA 1AMHA 1K1NA 1WYKA 1YPEH 2VB0A 3GCTG 3R0FA 4FUBA 3ZV9A 2TGPZ 1TX7A 1ARCA 3EYDA 6LPRA 1L4ZA 2G8TA 1TABE 3T5FH 3TJNA 1S5SA 3M37A 3U1IB 1C2LA 1KXEA 1AUTC 1YP9A 1GCTC 3T27A 1KTSB 1QJ7B 3GCOA 3DFLA 4DJZB 3L33A 4ZHAA 2Q6GA 2G5VA 3MI4A 3RXEA 3U69H 3ZZDA 1FAXA 3CP7A 4Y8XA 1O2MA 1DX5M 1C1VH 2Y5HA 2V3OH 2W5EA 2W7SA 1W2KH 1WU1A 3MNXA 1GJCB 2BD5A 2PKSC 4WXVA 4B76A 1ZHRA 1TGSZ 4ZXXH 1NESE 3M61U 1K2I1 1PQ7A 1L0ZA 1OP2A 2BY6X 2C93B 1FUJA 3A8BA 3M5LA 1ZPBA 2OC7A 1W14U 4U32A 1AY6H 1T4UH 4LK4A 1C9TA 1EPTB 3BTWE 6GCHG 2CV3A 4Y8ZA 4ZH8A 1TONA 2A7JA 2HVXA 2ZZUH 5T6GA 1Z6JH 3E0NB 4CHAB 4XFQA 1JRSA 1P11E 1MD7A 4Y71A 1M9UA 3BTKE 2C8ZB 1SOTA 3UWIA 4MNWA 5EQQA 1SI5H 3MTYA 3A8DA 4F4OC 1O33A 1PJPA 1PQAA 2VWMA 4BOHA 3SGQE 5EXNA 1EATA 1PYTD 4INKA 4ABAA 1P2JA 1P2QA 4NIVA 2F9UA 2AGEX 1TWXB 1CU1A 1SGFG 2ZECA 1S6FA 2AS9A 1Q31A 4BAQB 2NU3E 2R0LA 3A7ZA 1QHRB 1GJDB 1CGHA 1XMNB 2SFAA 1EPTC 2WUCA 1ZPCA 3R3GB 2CF9H 1INCA 2Z9GA 1B0EA 3HK6B 2IOTA 3UNRA 1YYY1 4CHAC 2GCHG 1XXFA 2P93A 3S9CA 3I78A 1F0SA 1HAGE 1TBRH 4KTCA 4D8NA 2PTNA 4ZUHA 2H2ZA 1OPHB 1O5EH 5I25A 1CHOF 1F0TA 3RXGA 3UNQA 4CREA 3LKWA 1ZMJA 1O2UA 3TK9A 1V6DA 1SGRE 2FO9A 5FHTA 3QLPH 1TGTA 1E38B 3C1KA 5EQSA 2NU0E 1VCQA 1N1LA 1Q2WA 1P8VC 1TNLA 4MNYA 9LPRA 4YOIA 3S9AA 4YO9A 1TNGA 1H9IE 1V2VT 1ZSLA 3GCHB 5DK1A 3RXFA 2SGAA 4FU9A 4XBCA 1XUKA 1PFXC 3A7YA 3GISB 3F9GA 3G01A 3A82A 3A7TA 3MH7A 1FONA 2VINA 4ZAEA 1HAZB 3QDZB 1YCPM 2GZ9A 4WWYA 3UIRA 1FZZA 1MAXA 5E0JA 1KXDA 3LIWA 1AE8H 2RCEA 3TGKE 4WJG2 5A0AE 2BVRH 2LNCA 5AVDA 3M7QA 1MD8A 3TH4H 4IGDA 4BAHB 1TE0A 3SJ8A 2BD7A 1SB1H 1GHBF 4PROA 1VJ9U 3LC5A 3UR9A 4DG4A 4B71A 2AYWA 2M5TA 2ZU1A 3Q77A 4OS4A 1GDUA 5C1XA 3PWBA 1TNKA 1ETSH 2XTTB 4AORA 3NK8A 2QGRA 1Z1JA 2D2DA 3SUGA 2F83A 2H6MA 2BDBA 2J9NA 4NSYA 4O97A 1FIWA 1JRTA 2VU8E 1G2LA 2XRCA 4NGAH 1DUAA 4AGJA 5EXMA 1OWKA 3VB6A 1ELTA 1JOUB 3A81A 1XUJA 2VGCB 1QL7A 4GAWA 4ZHLU 5T6DA 4OS2A 1DM4B 3KQDA 1EB1H 1RJXB 1IQKA 4AG2A 4X6NA 4MLFB 2FOFA 1D3PB 2XCFA 1KXCA 2ULLA 1D3TB 1D6RA 3B8JA 3L3TA 1O36A 2XC0A 5C20A 4JK6A 3TJOA 4A7IB 1YPGH 2A1DB 1XKAC 1VGCB 3W94A 1HCGA 3ELAH 1AB9C 5GWZA 2ODPA 5A8YA 1TPAE 4UE7H 2FYRA 1FQ3A 1C4Y2 1BRBE 1Z8GA 2BQWB 1EZQA 1CT2E 1UK4A 4JYVH 3UFAA 1CBWB 1HRTH 4MTBA 2BX4A 3KQEA 5ESTE 4X2XA 1FJSA 1HAOH 3I29A 3GDUA 1ZMNA 5FCRA 2FP7B 1E34B 1GBHA 2VGCC 4OS1A 2XYAA 5JB8S 2BLQA 1GMDF 1YPMH 1FI8A 6GCHF 1S84A 2YNBA 1C1OA 2DE9A 1QL9A 1AHTH 1ANDA 1UTQA 1X7AC 2XWAA 3TNTA 4O9VA 2JETC 4KTUA 2WUBA 1DSTA 1OKXA 2BQ6B 1AWHB 1O31A 4I32A 1TMBH 3T28A 1VGCC 6CHAB 4KELA 1QBNA 1OYQA 2BXUH 3FZZA 3IG6B 3V13A 5JDUB 3F1SB 3GYMA 2QIQA 4B2AA 2SGFE 1UTMA 2NU1E 1IQLA 2GT8A 1QQUA 3P8OA 4WH8A 1CBWC 2GGVB 1UCYE 1HAVB 5DP5A 4JZIA 1GJ8B 2ODYB 1Y3YA 4INHA 5ESBA 4ABIA 1FY8E 5K7RA 1HJ9A 3NPSA 3STJA 1H9LB 1TNHA 5FX5A 2P3FH 2FOMB 1NTPA 3RXSA 4CH8B 5LPRA 1VCPA 2F9VA 1OX1A 1UHBB 2FZZA 2GDEH 3MO9A 2PKAB 3PO1C 3GY6A 2PHBA 1O2GH 1MMJN 2GCHF 1HPGA 1IQFA 3Q3YA 1QRZA 3SV8A 4E7NA 2A4QA 4YLUA 2CJIA 1A3EH 2OC1A 4GCHF 2CN0H 3LJJA 1KLIH 4JYTA 1MAYA 4ABJA 4TY6A 7GCHF 2ZQ2A 1P9SA 2QXHA 1XUGA 3SNAA 2YNAA 1P03A 1TOCB 3EA7A 1EJNA 3S9BA 1W7GH 5LPEA 3K2UA 2P59A 1G3EA 3SU1A 2PW8H 1YF4A 3SNBA 1TA2A 3KIDU 2PWXA 2TGTA 4B2CA 2VIOA 5GPIB 1TRNA 3OYPA 4OS6A 4O3TA 3KGPA 4ABEA 4D76A 2P16A 2DUCA 1KXFA 2QC2A 1C2EA 1V2PT 3D49H 8ESTE 1FY4A 1C5NH 3GICB 1QIXB 4X1NU 4MNXA 1ELCA 4IMZA 4ZKRU 1NS3A 3C27B 5TJXA 3SHAH 3M3TA 1L1NA 1TX6A 4DVAU 4AFUA 3RXMA 2D1JA 1VITG 4JZEH 3A8AA 1A5IA 4GHQA 4J2YB 1ZMLA 2C3SA 2FS9A 1O2ZA 1UVTH 2JKHA 3RXUA 3MYWA 1BMNH 5EQRA 2BY7X 4HFPB 4Q7YA 5C67A 2HNTC 3P8NA 1NRNH 2TBSA 1TX8A 3PMAB 4E05H 3M35A 2R0KA 2F9PA 2BVSH 3A7VA 3SU5A 2PV9B 1GHWH 4OS7A 2AEIH 2GCTC 2PGQB 1QJ6B 4I8GA 3A85A 1MKWH 4NA9H 2QYIA 1QB6A 1FNIA 1RTLA 3HPTB 2RA0A 3FP7E 4TWYA 2BZ6H 4FUGA 1CGJE 1DWDH 1WQVH 4NG9H 4I8LA 3SI4H 2B0FA 4I33A 1V2OT 2AIQA 4ZKNU 3SNCA 5A2MH 2ZFSA 1E0FD 2ANKH 1LPZB 4JZFH 3U8OH 1IQHA 2V0BA 2C90B 2FESH 3BSQA 1DPOA 3OY5U 1DWCH 3ZV8A 2GVFA 2J95A 1ANEA 2Q6FA 1C5PA 1ZOMA 1YLCA 1LVBA 1O5AB 1SLWB 2FI5E 1HAIH 4HTCH 3SV6A 1SFIA 4A1TA 3P6ZB 3QX5H 5EU8A 2CHAC 2ZFQH 1SSXA 2AMPA 2O8WA 3MH4A 1FMGA 3RXPA 4FVBA 1QBOA 2O8TA 3A83A 1BTZA 1DFPA 2ZNKH 1L1JA 1SGNE 1GBBA 1O3JA 2ZHDA 1T8OA 4M7GA 4X6OA 1T8MA 3VB5A 5JBCS 1GG6B 3AVZA 1C4U2 2IPHA 2ZFFH 3SGBE 2OD3B 1O2IA 4ISLA 4ABFA 1LHEH 2A31A 1EAXA 2ZCLP 2ZPQA 1UK2A 3UREA 4O3UA 3IWMA 3E1XB 5JBTA 2ZPRA 1RRKA 3KHVA 2Y7ZA 3SNEA 2ZF0H 1ZTLA 4IN1A 3P92A 1O3BA 4UFGH 4CRAA 2QA9E 1S85A 3RXTA 2RA3A 1HFDA 2NU2E 1GHVH 1QURH 4CR5A 1ESAA 2B9LA 1AD8H 4ZROA 3EA8A 1P2NA 2OINA 1O5CB 1EOJA 1RIWB 4AX9H 4B75A 1HXEH 3Q76A 5FPSA 3MO6A 4GVUA 1TIOA 1GG6C 1VZQH 2VVUA 1Y3XA 3QGNB 1F5LA 2D8WA 3V0XA 3QZQA 4Y6DA 5ETXA 4NCYA 4ABBA 1GBFA 1TQ0B 1XM1A 1GVKB 2BZAA 2BY8X 4Q2KA 1Z8RA 1TGNA 3D62A 1FY1A 1BTXA 3TITA 1EZSC 1KSNA 4X1SU 4ABHA 1TNJA 2ZGBH 2F3CE 3DD2H 1BJUA 1NO9H 4HGCA 3OX7U 1NT1A 1K28D 4U2WA 2OQ5A 4CRCA 1GJ9B 3BIUH 3VEQB 1IQEA 3DT0H 4IMQA 3JZ2B 2Y5GA 1HAPH 3DUXH 1JMOH 4Z6AH 1NU9A 1T8LA 1TPPA 1Y5UT 1BITA 2SGQE 1EXFA 3ZVEA 1OS8A 1SBWA 3UY9A 2WINI 1GBIA 1AFQB 1P01A 2G81E 1BCUH 5F8ZA 1YPLH 3QK1A 2WPHS 3QN7A 4JMYA 5DP6A 2QF0A 2QY0B 3TU7H 2JH5D 5J4QA 1SQOA 1ESTA 1ZJDA 1SLVB 2NU4E 1O3KA 1VITF 1GI0A 3MO3A 2VVVA 1QQ4A 1AKSA 5A0BA 3SU4A 1O3PB 3BF6H 1DUEA 1A0JA 2F9NA 4WY3A 1GI2A 1QL8A 3SI3H 3SORA 4DW2U 4K60A 2GV6A 4SGAE 1UCYH 3P8FA 3F6UH 3PV4A 4K1TA 2D26C 3RUOA 4NWKA 4CH2B 3LPRA 5EG4A 3A88A 2BLVA 5DGJA 2STBE 1C2KA 1C4V2 2LPRA 4X2WA 5JPMH 4JYUH 3S7KB 3TH2H 1BTWA 2Z9JA 1FIZA 1AFQC 3UOPA 1EB2A 1ETTH 4GUXA 1KDQB 1P2IA 4RN6A 1GL1A 1GGDB 2Z6BD 1E37B 2XBWA 2AGIX 2XWBI 1S81A 1O2TA 4R0IA 4BTIB 1NRSH 1J17T 1O32A 1GBDA 2R2MB 5ABWA 1O39A 1H4WA 1EAWA 2R2WU 4JZ1A 2A4RA 1O2WA 2BHGA 1P9UA 1D4PB 1O2JA 1O3AA 3SW2B 1A0HB 1ARBA 4DCDA 1XUHA 3MU1A 4BAKB 2GD4B 2V35A 2A5AA 2ZHFH 1B5GH 1GBKA 3SU2A 3WY8A 3BTTE 2P8OB 5GJ4B 2ZTXA 1AI8H 2VWNA 1NRRH 3PROA 1BA8B 5JBAS 4U30A 1V2WT 1XUIA 3KQCA 3UNSA 3LOXA 1BBRH 3EE0B 1PPZA 4BXSA 3TPIZ 3ITIA 1EKBB 1K1LA 2QCYA 2BDIA 1O3OA 1DWEH 1EAIA 1LO6A 5EW1H 1W10U 1SL3A 1Y5AT 2ILNA 1GGDC 3ATLA 3U9AH 1Z8IB 2QXIA 3RMNH 1LVOA 1MBMA 1UK3A 1YM0A 2BX3A 4D9QA 2G4TA 1V3XA 2GKVE 2ZEBA 4AZ2B 3FZDA 1P3EA 3BTEE 1LVYA 3URCA 8GCHF 4B2BA 1YPHE 1PPHE 3SZNA 1EQ9A 2J94A 1ELEE 2EI8A 3MU4A 3O8DA 1Y3UA 5CHAB 2FWWA 2OBQA 5L30H 5DP4A 1LQEA 1UVSH 3QO6A 4R8TB 1GI9B 3BV9B 1O2LA 1ANCA 1PQ8A 3HATH 4WVPE 1TALA 4B73A 5IDKA 5FPYA 4Y7BA 1T31A 3VXFH 2P3TB 2AMDA 3SNDA 1PQ5A 1Y8TA 2QN5T 1DE7H 3KNXA 1O3HA 1ZHMA 1OP0A 2WPMS 2AMQA 1IQGA 1ELVA 4NIXA 2Q6DA 3RM2H 3TGJE 1C5TA 4LZ1H 5J4SA 4RKJB 1U6QA 3U1JB 3TNSA 2BD9A 1NPMA 3M36A 1WOFA 2FI3E 3MNCA 1C2FA 1GBAA 4Y76A 2NWNA 2ZA5A 3CS7A 3MOCA 1C1WH 1W7XH 2O8UA 3FVFB 2ALVA 1LQDB 3FANA 3H7TA 1V2LT 1VR1H 3LGWA 3GY2A 1FY3A 1V2QT 4ABGA 1SR5C 2BY9X 2XBYA 2FTMA 2G51A 5F03A 1C5SA 2ZKSA 3GCHC 1Z6EA 4CBOA 3TJVA 2FPZA 1QBVH 1SC8U 3AASA 3TGIE 1SGFA 3PLPA 3O8RA 3GY7A 5T6FA 4LZ4B 3URDA 2VVCA 1PYTC 1QB1A 3GCTF 4UFFH 3SOSA 3QTVH 3VGCB 1C1TA 1V2RT 1UVUH 1QA7A 2WV5A 3AAVA 5C1UA 4K2YA 2GV7A 1DICA 3TJUA 4A6LA 3BTFE 2OP9A 2TGAA 1HAXB 2EI7A 1WSSH 2P94A 5BRRE 3RU4E 1KXAA 4X8TH 2VNTA 5TCCA 2K1QA 4MPUA 4A1VA 2XBVA 4FUFA 2BQ7B 3ENSB 1FV9A 1FPHH 1DOJA 5GXPA 5GCHG 2ZDKA 5L2ZH 2AERH 1Z7KA 3BN9A 2GMTB 4X0WU 3LH1A 2ZHQH 2H9EH 2UWOA 5EOKA 1UTPA 1MCTA 4NSVA 1RGQA 5EXLA 1QRWA 4X8VH 4Q7ZA 1RS0A 5A8ZA 1XXDA 3RXRA 1GJ7B 5DP8A 1GHYH 3VXEH 1TA6A 1ZR0A 1PPEE 5F8TA 3RXDA 4YT7H 1THPB 2BD8A 3B9FH 4BTTB 1ELFA 5LH8A 1BMAA 3GY4A 4X8SH 5FAHA 2G55A 1MKXH 4UD9H 2TPIZ 3GCNA 4DIIH 2BVXH 3U8TH 4H6TA 1BOQA 3SJIA 1TGCA 3CS0A 3EA9A 5C3NA 1MTVA 3NUMA 4I8JA 1HJAB 3K6ZA 2Z3CA 1G30B 3NZIA 1O3GA 3MFJA 1MU6B 2PLXA 2PFEA 5C2ZA 1GJ6A 1DY9A 1O3LA 2FOCA 2UUJB 1MZDA 1SOZA 1WUNH 1A2CH 4LOYH 1ABJH 2AGGX 5EW2H 2ANMH 1VITH 3GY3A 3K6YA 1HUTH 1Z1IA 3MMGA 2THFB 1EPTA 2ZO3H 5AF9H 1C5LH 4FUIA 3ZVDA 1W12U 2A5KA 4NA7A 2GZ8A 5DG6A 1RD3B 2AFQB 2C4FH 3SV9A 3IITA 1DXWA 1L4DA 1UO6A 3PLKA 1GJ5H 2OLGA 6CHAC 1RTKA 5B6OA 2PSXA 1HJAC 1LKBA 1Y3WA 4WF8A 1EZUC 3KEEA 2XC4A 1DWBH 1ZRKA 1HGTH 1LPGB 1O5DH 4DOQA 1IQJA 4NIYA 1V2ST 1EZXC 2V3HH 4FUCA 4YTAA 1UCYK 3RMLH 1YGCH 1MQ5A 3BTGE 1A4WH 2ZU2A 1J15A 3QGJA 4AYVB 4FVDA 1ELBA 4X1QU 2OTVA 1UTJA 1HIAA 3ZVBA 1QTFA 7ESTE 2ZG0H 1SVPA 3RMMH 3SUEA 5K0HA 3PM3A 3BTHE 2BDCA 4CBNA 1JWTA 3LH3A 3SU3A 1BBRE 1V2TT 3RC4A 1GBTA 2PUQH 4BANB 4Y79A 1HXFH 3ATKA 2Z9KA 4QT8C 2GT7A 3VPKA 1S0QA 3BEIB 2XCNA 2ZDVH 1G3CA 2P3UB 1MTNB 2TIOA 1SGYE 1KTTB 1O2NA 1NC6A 1ZRBA 4AFSA 3SBKA 1B7XB 5I46H 1TMTH 3E6PH 1HLTH 2HPQH 1P06A 4DT7B 2ZGCA 2GX4A 1ZSJA 1W8BH 2OC8A 2A4GA 3RU4D 3LONA 1S0RA 1UMAH 1JIRA 1GBJA 2RDLA 1O30A 1C2DA 1OYTH 1N6YA 2BLWA 2BD2A 4UONA 1D6WA 1K1IA 3RXOA 2HPPH 2FX6A 3TK5A 2C8WB 1ETRH 2ZDLA 1C5VA 3JZ1B 1IQNA 5AFYH 1BBRK 2R3YA 2ZHWH 1YLDA 1GI4A 3ATMA 5BPEA 3KF2A 4D9RA 2J4IA 1ZGIA 1DS2E 3OTJE 4WMEA 1B0FA 1O2QA 3AAUA 1MTNC 1A46H 1ELDE 4X1RU 3LT3A 1W0YH 3A80A 4FUDA 3E90B 3SJOA 1ACBE 3RXQA 2UUYA 1LHCH 1C2IA 1HJ8A 2ZP0H 4ZMAH 2F9BH 1O2RA 3P95A 2XBXA 2XXLA 2FODA 3MNSA 1LKAA 2Y6TA 3QZRA 4MDSA 3RXIA 2WPLS 1SQAA 3TH3H 2F91A 4FU8A 2SNWA 2A32A 3V12A 3STIA 2DE8A 2Q1JA 1G2MA 3PMJA 3RLWH 3T26A 1JXPA 1NN6A 3ZZAA 2GDDA 4YLQH 3RM0H 2OC0A 2J2UA 2Y7XA 2ASUB 2ZC9H 5HM9A 2ANWA 2XW9A 1BTHH 3RXVA 3ZYDA 1RTFB 3O8CA 2GP9B 1L1GA 3PYHA 1C5XB 2QXJA 3BG4B 5PTPA 2GTBA 1P05A 2ZU4A 1K1JA 3AW0A 3Q3XA 4Y11E 1F2SE 1GCDA 4KP0A 2FOGA 4ISNA 2WPJS 1C5MD 2ANYA 1TPOA 4Y0ZE 4ISOA 4D7FA 4MPVA 4DIHH 4YT6H 4ISHH 1TAWA 1C5YB 2VIWA 4FUJA 1SGIB 3SU6A 3EQ0H 1W13U 2UWLA 4UDWH 3D23A 2ZDMA 1O3EA 3F9EA 1A1RA 1TPSA 1GMHG 1GI5A 1GHZA 3ZYEA 4MQAA 5DPAA 1BMMH 1AZ8A 1FN8A 4BTUB 1RFNA 1CHOG 1TBZH 1DANH 2Z9LA 3EDXB 3OU0A 1WQSA 3SJ9A 4IC5A 1Y3VA 1N8OB 3FAOA 1TRMA 1O5BB 3A86A 1GBMA 3BG4C 3HGPA 1UTOA 3A7WA 1TQ7B 3A8CA 1O5GH 1C2MA 1UTKA 3MU5A 1EUFA 3RC6A 1V2UT 1YCPH 1D9IA 1HDTH 4IS5A 1SGCA 2VJ1A 2G00A 1YC0A 4TPIZ 3FP8E 1TGBA 4ABDA 2FX4A 4NA8A 2HRVA 5H4IB 1QNJA 1W0ZU 1KLTA 3P17H 3DA9B 1E36B 2ESTE 1UVPA 1RIWC 1GVZA 2SNVA 3PTBA 2BMGB 1AFEH 1IHTH 1MBQA 2A2QH 2CGAA 1LHDH 1HAVA 1C5RA 1HNEE 4ISIH 5E0HA 4Q7XA 1GHBG 2V6NA 4K8YA 3S7HB 3NKKA 1N8OC 1UVOA 2A7CA 3OSYA 1MTWA 1QY6A 2GZ7A 1QGFA 1XVMA 1O38A 4ZHMU 4TY7A 2ZIQH 3UPEA 4D7GA 1UHBA 2PKAA 1LTOA 2ZFTA 3V7TA 2BLOA 2SGEE 1FY5A 1TFXA 3T29A 2PKSB 3MU8A 4XSKU 2QAAA 1DSUA 1ZTJA 2WV4A 2PTCE 3QTOH 1MKXK 2XNIA 1MU8B 1ZJKA 1H9HE 3TVJB 1AGJA 1AN1E 5HMAA 4F49A 1W11U 1JIMA 2FM2A 2ODQA 3LGVA 4I31A 2SGDE 3RXHA 4FUEA 1NFXA 4GLYA 1G37A 1AZZA 4NZLA 5EPNA 5A09A 2JH0D 4A1XA 4E06H 2BDGA 4GSOA 2FIRH 4X8UH 4ESTE 1C5ZB 1GBCA 1IQIA 4DGJA 1CE5A 4K1EA 4XBDA 1GHAG 1CO7E 1EJMA 3VFEA 3SQHE 1WTHD 1YPJH 1SGEE 1AO5A 3SHCH 1SGDE 1Y5BT 3ZZ5A 2QF3A 2HGTH 3MH5A 1V2JT 3UOUA 5LGOA 5LPFA 1GMDG 1K21H 4CRGA 4FUHA 3AW1A 2R3UA 1F5RA 1OP8A 3GDVA 3ZZBA 1TOMH 1IOEA 5FX6A 4OGXA 4ZXYH 1HAHH 1S6HA 2A5IA 3SV7A 1IAUA 1EP5A 3A7XA 3DHKH 5FCKA 2OXSA 2Y81A 1GJ4H 2BTCE 2HALA 3ZZ7A 4RSPA 4DURA 1WAYB 3E16B 5DJ7A 4IC6A 3GYLB 1BZXE 3SO3A 3RP2A 2OUAA 2OQUA 1KLJH 3LGUA 4IN2A 4YESB 1O0DH 1T7CA 2Y80A 1THSH 1D3QB 5T3HA 4AOQA 1V2NT 1O2VA 1O2SA 3MHWU 3QWCH 3F68H 1LVMA 4IBLH 4XBBA 2FOEA 4AFQA 4YOJA 1NY22 3KL6A 4B1TA 2H5CA 3GY5A 3BG8A 4YZUA 2BYAX 1HIAB 4Y8YA 3LGTA 3RXKA 1CT4E 2Z7FE 1AIXH 1FXYA 4AGKA 1GWAA 3SUFA 1AVGH 2P8OC 1HV7A 2H1UA 1BRCE 2HNTE 2YOLA 1QJ1B 1UTNA 2HNTF 1GMHF 3P70B 1PPCE 4INLA 1O3DA 2TRMA 1O35A 3ZZ3A 4X1PU 1A5GH 4GCHG 4YOGA 1NFYA 3SQEE 1ELGA 7GCHG 3M7UA 1OSSA 1AU8A 2A0QB 2FI4E 2UUFB 3NWUA 4A92A 4H42U 2ZCHP 5HXFA 1EASA 1CQQA 1CT0E 1P2KA 1SHYA
chains in the Genus database with same CATH superfamily
3VB7A 1XVOA 1J9CH 1MKWK 2Y82A 4XDEA 1PPBH 1ANBA 1P10A 4KTSA 2ZTZA 1BHXF 3TK6A 3ATWA 3M7TA 2W7UA 2P95A 5EODA 3RU4T 3O8BA 4OS5A 3D65E 5FBEA 4NFFA 1GMCG 4TPYA 5CHAC 2BY5X 1DXPA 4U01A 5E2PA 2ZTYA 2HOBA 1EOLA 1P3CA 5E8EH 1FDPA 3LGYA 4TWWA 2FLRH 2KAIA 2WYGA 1MQ6A 1PPGE 1GDNA 4THNH 4TSFD 1MUEB 2CMYA 2J92A 5DP9A 3ATIA 5AHGH 1MZAA 4BAOB 3DCLA 2VH6A 3RXCA 1S83A 3S69A 2EEKA 3NCLA 3VB3A 7LPRA 1ZGVA 4MPWA 2BDAA 4K5ZA 3CENA 2EA3A 1AB9B 1BRUP 5L2YH 2C8XB 3KN2A 1P2OA 3TIUA 1O5FH 4RKOB 5GNDA 3A87A 5A0CA 3S0NA 3A84A 4ASHA 4JCNA 4BAMB 1G36A 3GY8A 5A8XA 3BTQE 2F4LA 1BRAA 1F92A 1P04A 1H8IH 1MTUA 1KY9A 3E8LA 2ZDNA 4Y0YE 2B7DH 3OE7D 4H4FA 2BD3A 1P57B 1FPCH 1BQYA 2ZCKP 1C1SA 1NM6A 4I8KA 3SU0A 3LC3A 2OBOA 3MU0A 4H6SB 2Y5FA 1O37A 1O34A 1T4VH 1YKTA 3BEFB 4KGAA 2JETB 5AFZH 3M3VA 2VBCA 1S82A 2PGBB 3ZVCA 3Q00A 1IHSH 3PTNA 3UWJH 1ZSKA 5JB9S 4AN7A 2G4UA 5CMXH 1J8AA 2FYQA 4YXWD 3HK3B 3VGCC 2FOBA 4JK5A 1Y59T 1TLDA 1OXGA 1BTPA 1OWIA 3ZZ8A 3LDXH 1MCVA 2KCPA 4B74A 1QR3E 1G32B 3DFJA 3ZZ6A 1SG8B 1GHAF 5FBIA 3ZVAA 1H8DH 3FP6E 2IN2A 3LGIA 4WXIA 8KME2 3MWIU 2W3IA 4FU7A 4MPXA 3U8RH 4Y7AA 2W26A 1N6XA 2VWOA 3PWCA 1YCPK 2ZHEH 1A3BH 1EAUA 2A2XH 2FS8A 3HKIB 3VB4A 3AK5A 1GHXH 1GI3A 1EX3A 4J1YA 3V3MA 2G5NA 3EGKH 5C5OA 5JYIA 2ZFPH 3PB1E 4IW4E 1WDIA 5FPTA 3PO1B 1AVWA 2VIDA 2ZPSA 5HGGA 2BD4A 2GMTC 4YM9A 2J38A 1GI1A 1SMFE 1G3BA 1T8NA 1ZLRA 2FDAA 4Z0KA 3ESTA 3KYGA 3FKSD 3M5MA 1DITH 2BM2A 3T25A 3SN8A 3E91A 4HZHA 1KDQA 3ZZ9A 5F8XA 3ODFA 3B23B 2BOKA 6ESTA 1Z71A 2ZDAH 4LXBH 3A89A 1C2HA 1DDJA 1P12E 2BOHB 3HKJB 1HAYB 2HWLB 4WH6A 3W1EA 4HI3A 1Z8JB 4Q80A 4ZKOU 1A0LA 3PLBA 1L2EA 4DY7B 4GHTA 1QA0A 3H5CB 1O3MA 1UJ1A 1P0SH 3M5OA 1K1MA 1C2GA 2B5TB 4NFEA 2V3MA 3LU9B 4TYDA 4WMFA 1F0RA 1OOKB 1SHHB 5E0GA 2QXGA 1H1BA 2ZU3A 2J5UA 2KZ4A 2QF4A 1OWHA 1ZYOA 1LMWB 1P2MA 1BTYA 3MNBA 3NXPA 1F0UA 3SV2H 1F7ZA 2ZGHA 2B8OH 1BDAA 2ZI2H 4BNRA 5HYOA 1K22H 1GI6A 2STAE 3UR6A 1NZQH 1AKSB 1GI8B 4UFDH 3E3TA 1K1OA 1TYNA 2H5DA 1GL0E 1FLEE 1SGTA 2EI6A 3M5NA 3HGNA 1YPKH 1SLUB 1C1MA 1FN6A 1J14A 2SGPE 3BTME 4MG3A 3LJOA 1C5OH 2O8MA 2PUXB 3SUDA 1SPJA 1LPKB 2CXVA 3EAJA 3SJKA 5G4BA 3T62A 2FTLE 2VIPA 3RXLA 1O3CA 2GCTB 1BT7A 2FXRA 4K8BA 1DLKB 3RMOH 4O03A 1O3IA 1XUFA 2OCVB 5E2OA 1ESBA 1QCPA 3F2HA 1XX9A 1OWEA 1GMCF 3H7OA 4NIWA 3UTUH 5DKMA 5FXLA 4SGBE 1BTUA 1KXBA 2KCYA 3PRBA 2FOHA 2H9HA 2FMJA 1BHXB 2Z3EA 4CRFA 1AQ7A 1LHGH 1O2PA 5HM2A 3RXJA 1O2XA 1YPHC 4ZKSU 1O2HA 1BB0B 3P8GA 4K69A 2HLCA 2I6QA 4VGCB 2BDHA 2JH6D 3EE7A 1HBTH 4Y10E 1GDQA 1BMLA 1CHGA 4NZQA 1SGPE 4X6PA 3UQOA 1TRYA 1KIGH 1W3CA 2EC9H 2G52A 2K0QA 3F9FA 3BTDE 5GIBA 9ESTA 2CHAB 1WBGB 4NWLA 1BUIA 3U98H 7KMEH 1O2KA 1C1RA 2O9QA 3GDSA 1DT2A 1Q3XA 3W95A 1WV7H 1F5KU 3ZZ4A 3SGAE 4AB8A 2J34A 1LCYA 2CF8H 4XOJA 2XC5A 3GOVB 5EPYA 4P00A 1A5HA 1K9OE 2UUKB 1PPFE 1H8HD 5CE1A 1C5QA 2ZQ1A 4X2YA 1ELAA 4FXGH 1A61H 4AFZA 1C1QA 2BDYA 2JJ2D 4XE4A 1V2KT 3PMBB 2ZU5A 5TCAA 1VJAU 4X2VA 3L6PA 2WPIS 5GCHF 1JBUH 1P09A 2PSYA 4MNVA 1O3NA 4VGCC 4WMDA 8LPRA 1UW7A 4UEHH 3KCGH 2YMSD 1GVLA 1ID5H 1CA0B 2VH0A 1WCZA 1BIOA 2QV1A 2R9PA 1C1PA 3M3SA 2BB4A 4KKDA 1KYNA 1GPZA 1TMUH 2IJOB 1E35B 3PMHB 5EGMA 2ZGXH 2A4OA 2FEQH 1HYLA 4AG1A 2A7HA 5JBBS 2W3KA 5L6NH 3TLOA 2ZWLH 5DP3A 1XKBC 2FLBH 3RLYH 1CGIE 4E7RG 1DLEA 4ACAA 5KECA 5SGAE 1SQTA 1GJBB 2BXTH 3E0PB 1CVWH 3ZVFA 1J16A 1SGQE 2Z94A 1VCWA 1ZHPA 4MVNA 2TGDA 3BEUA 1AVXA 1MTSA 1G3DA 3BIVH 5DSFA 5C5NA 4CR9A 3RXAA 5EIYA 1QRXA 2I6SA 3RC5A 1C9PA 1TB6H 4GPGA 3K9XB 3OY6U 1OWJA 2F9OA 1QFKH 2UWPA 8GCHG 5DP7A 1CSOE 1QB9A 2AH4X 1HB0B 1CA0C 1ZPZA 3Q3KA 4K3JA 1C5UA 1DY8A 1RXPA 1GBLA 3N7EA 4I8HA 3ZZCA 3MH6A 2KAIB 1FAKH 4K1SA 1WTGH 1NROH 1ZTKA 1C1UH 5IYTA 2YMSB 2ZGJA 4XD7D 4AB9A 1ZZZA 1EFRD 1K1PA 4OGYA 3K65B 1GBEA 3PV5A 4CRBA 1O2YA 2PR3A 2AIPA 1NRPH 1AE5A 1T32A 1GI7B 1ABIH 5GDSH 1NRQH 3N7OA 5DO4H 1IQMA 1SFQB 1NFWA 3FFGA 1MH0A 2C8YB 2VWLA 4Z1MD 1A7SA 1P02A 1AUJA 1WXRA 1YBWA 1AWFH 2O8LA 2WYJA 1GJAB 1NU7B 4I7YH 1DVAH 3ZVGA 1GCTB 2VIQA 2ALPA 2WPKS 3F9HA 1W0KD 2RG3A 2ZFRH 4CRDA 2H9TH 1O3FA 1LHFH 2VIVA 1TNIA 1TBQH 1EP6A 4A5TS 1UTLM 3ODDA 2A45B 1EJAA 2Z9IA 1C2JA 1C1NA 5C1YA 4AYYB 2FOAA 3QUMP 3I77A 3UUZA 4BXWA 2Z3DA 3UQVA 4X6MA 1V2MT 3KQBA 1NFUA 1G9IE 1SLXB 1C5WB 1LDTT 3T2NA 3RXBA 4UFEH 1CA8B 1ORFA 1D3DB 3RDZA 4JZDH 1O2OA 1THRH 5F53A 5F6MA 1BJVA 1OWDA 1AMHA 1K1NA 1WYKA 1YPEH 2VB0A 3GCTG 3R0FA 4FUBA 3ZV9A 2TGPZ 1TX7A 1ARCA 3EYDA 6LPRA 4FETA 1L4ZA 2G8TA 1TABE 3T5FH 3TJNA 1S5SA 5CHBA 3M37A 3U1IB 1C2LA 1KXEA 1AUTC 1YP9A 1GCTC 3T27A 1KTSB 1QJ7B 3GCOA 3DFLA 4DJZB 3L33A 4ZHAA 4RT1A 4B6FA 2Q6GA 2G5VA 3MI4A 3RXEA 5C0TA 1H8ED 3U69H 3ZZDA 4HG6A 1FAXA 3CP7A 4Y8XA 1O2MA 1DX5M 1C1VH 2Y5HA 2V3OH 2LELA 2QE7D 2W5EA 2W7SA 1W2KH 1WU1A 3MNXA 1GJCB 2BD5A 2PKSC 4WXVA 4B76A 1ZHRA 1TGSZ 4ZXXH 1NESE 1E1QD 3M61U 1K2I1 3H09A 1PQ7A 1L0ZA 1OP2A 2BY6X 2C93B 1FUJA 3A8BA 2AHME 3M5LA 1ZPBA 2OC7A 1W14U 4U32A 1AY6H 1T4UH 4LK4A 1C9TA 1EPTB 3BTWE 6GCHG 2CV3A 4Y8ZA 4ZH8A 1TONA 1W0JD 2A7JA 2HVXA 2ZZUH 5T6GA 1Z6JH 3E0NB 4CHAB 4XFQA 1JRSA 1P11E 5FL7D 1MD7A 4Y71A 1M9UA 3BTKE 1QZ8A 2C8ZB 1SOTA 3UWIA 4MNWA 5EQQA 1SI5H 3MTYA 3A8DA 4F4OC 1O33A 1PJPA 1PQAA 2VWMA 4BOHA 3SGQE 5EXNA 1EATA 1PYTD 4INKA 5C0UA 4ABAA 1P2JA 1P2QA 4NIVA 2F9UA 2AGEX 1TWXB 1CU1A 1SGFG 2ZECA 1S6FA 2AS9A 1Q31A 4BAQB 2NU3E 2R0LA 3A7ZA 1QHRB 1GJDB 1CGHA 3F0OA 1XMNB 2SFAA 1EPTC 2WUCA 1ZPCA 3OEED 3R3GB 2CF9H 1INCA 2Z9GA 1B0EA 3HK6B 2IOTA 3UNRA 1YYY1 4CHAC 2GCHG 1XXFA 2P93A 3S9CA 3I78A 1F0SA 1HAGE 1TBRH 4KTCA 4D8NA 2PTNA 4ZUHA 2H2ZA 1OPHB 3UB0A 1O5EH 5I25A 1CHOF 1F0TA 3RXGA 3UNQA 2RDEA 4CREA 3LKWA 1ZMJA 1O2UA 3TK9A 1V6DA 1SGRE 2FO9A 5FHTA 3QLPH 1TGTA 1E38B 3C1KA 2QF5A 2NU0E 5EQSA 1VCQA 1N1LA 1Q2WA 1P8VC 1TNLA 4MNYA 9LPRA 4YOIA 3S9AA 4YO9A 1TNGA 1H9IE 1V2VT 1ZSLA 3GCHB 5DK1A 2KR7A 3RXFA 2SGAA 4FU9A 4XBCA 1XUKA 1PFXC 3A7YA 3GISB 3F9GA 3G01A 4ASUD 3A82A 3A7TA 3MH7A 1FONA 2VINA 4ZAEA 1HAZB 3QDZB 1YCPM 2GZ9A 3FOAA 4WWYA 3UIRA 4M9FA 1FZZA 1MAXA 5E0JA 1KXDA 3CNRA 3LIWA 1AE8H 2RCEA 3TGKE 4WJG2 5A0AE 2BVRH 2LNCA 5AVDA 3M7QA 1MD8A 3TH4H 4IGDA 4BAHB 1TE0A 3SJ8A 2BD7A 1SB1H 1GHBF 4PROA 1VJ9U 3LC5A 3UR9A 4DG4A 4B71A 2AYWA 2M5TA 2ZU1A 3Q77A 4OS4A 1GDUA 5C1XA 3PWBA 1TNKA 1ETSH 1FX0B 2XNDD 2XTTB 3NK8A 4AORA 2QGRA 1Z1JA 5DN6D 2D2DA 3SUGA 2F83A 2H6MA 2BDBA 2J9NA 4NSYA 4O97A 1FIWA 1JRTA 2VU8E 1G2LA 2XRCA 4NGAH 1DUAA 4AGJA 5EXMA 1OWKA 3VB6A 1ELTA 1JOUB 3A81A 1XUJA 2VGCB 1QL7A 4GAWA 4ZHLU 3WWBA 5T6DA 4OS2A 1DM4B 3KQDA 1EB1H 1RJXB 1IQKA 4AG2A 4X6NA 4MLFB 2FOFA 1D3PB 2XCFA 1KXCA 2RFKC 2J98B 2ULLA 1D3TB 1D6RA 3B8JA 3L3TA 1O36A 2XC0A 5C20A 4JK6A 3TJOA 4A7IB 1YPGH 2LP6A 2A1DB 1XKAC 1VGCB 3W94A 1HCGA 3ELAH 1AB9C 5GWZA 2ODPA 5A8YA 1TPAE 4UE7H 2FYRA 1FQ3A 1C4Y2 1BRBE 1Z8GA 2BQWB 1EZQA 1CT2E 1UK4A 4JYVH 3UFAA 1CBWB 1HRTH 4MTBA 2BX4A 3KQEA 5ESTE 4X2XA 1FJSA 1HAOH 3I29A 3GDUA 1ZMNA 5FCRA 2FP7B 1E34B 1GBHA 2VGCC 4OS1A 2XYAA 5JB8S 2BLQA 1GMDF 4OM9A 1YPMH 1FI8A 6GCHF 1S84A 2YNBA 3OTPA 1C1OA 2DE9A 1QL9A 1AHTH 1ANDA 1UTQA 1X7AC 2XWAA 3TNTA 4O9VA 2CK3D 2JETC 4KTUA 2WUBA 1DSTA 3N99A 1OKXA 2BQ6B 1AWHB 1O31A 4I32A 2W6JD 1TMBH 3T28A 1VGCC 6CHAB 4KELA 1QBNA 1OYQA 3WW7A 2BXUH 3FZZA 3IG6B 3V13A 5JDUB 3F1SB 3GYMA 2QIQA 4B2AA 2SGFE 1UTMA 2NU1E 1IQLA 2GT8A 1QQUA 3P8OA 4WH8A 1CBWC 1YLNA 2GGVB 1UCYE 1HAVB 5DP5A 4JZIA 1GJ8B 2ODYB 1Y3YA 4INHA 5ESBA 4ABIA 1FY8E 5K7RA 1HJ9A 3NPSA 3STJA 1H9LB 1TNHA 5FX5A 2P3FH 2FOMB 1NTPA 3RXSA 4CH8B 5LPRA 1VCPA 2F9VA 1OX1A 1UHBB 2FZZA 2GDEH 3MO9A 2PKAB 3PO1C 3GY6A 1COWD 2PHBA 1O2GH 1MMJN 2GCHF 1HPGA 1IQFA 3Q3YA 1QRZA 3SV8A 1K0HA 4E7NA 2A4QA 4YLUA 2CJIA 1A3EH 2OC1A 4GCHF 2CN0H 3LJJA 1KLIH 4JYTA 1MAYA 4ABJA 4TY6A 7GCHF 2ZQ2A 1P9SA 2KCAA 2QXHA 1XUGA 3SNAA 2YNAA 1P03A 1TOCB 3EA7A 1EJNA 3S9BA 1W7GH 2M2AA 5LPEA 3K2UA 2P59A 1G3EA 3SU1A 2PW8H 1YF4A 3SNBA 1TA2A 3KIDU 2PWXA 2TGTA 4B2CA 2VIOA 5GPIB 1TRNA 3OYPA 4OS6A 4O3TA 1SKYE 3KGPA 4ABEA 4D76A 2P16A 2DUCA 1KXFA 2QC2A 1C2EA 1V2PT 3D49H 8ESTE 1FY4A 1C5NH 3GICB 1QIXB 4X1NU 4MNXA 1ELCA 4Q63A 4IMZA 4ZKRU 1NS3A 3C27B 5TJXA 3SHAH 3M3TA 1L1NA 1TX6A 4DVAU 4AFUA 3RXMA 2D1JA 1VITG 4JZEH 3A8AA 1A5IA 4GHQA 4J2YB 1ZMLA 2C3SA 2FS9A 1O2ZA 1UVTH 2JKHA 3WWFA 4RI0A 3RXUA 3MYWA 1BMNH 5EQRA 2BY7X 4HFPB 4Q7YA 5C67A 2HNTC 3P8NA 1NRNH 2TBSA 1TX8A 3PMAB 4E05H 3M35A 2R0KA 2F9PA 2BVSH 3A7VA 3SU5A 2PV9B 1GHWH 4OS7A 2AEIH 2GCTC 2PGQB 1QJ6B 4I8GA 3A85A 1MKWH 4NA9H 2QYIA 1QB6A 1FNIA 1RTLA 3HPTB 2RA0A 3FP7E 4TWYA 2BZ6H 2HLDD 1CGJE 4FUGA 1DWDH 1WQVH 4NG9H 4I8LA 3SI4H 2B0FA 4I33A 1V2OT 2AIQA 4ZKNU 3SNCA 5A2MH 2ZFSA 1E0FD 2ANKH 1LPZB 4JZFH 3U8OH 1IQHA 2V0BA 2C90B 2FESH 3BSQA 1DPOA 3OY5U 1DWCH 3ZV8A 2GVFA 2J95A 1ANEA 2Q6FA 1C5PA 1ZOMA 1YLCA 1LVBA 1O5AB 1SLWB 2FI5E 1HAIH 2JIZD 4HTCH 2IPQX 3SV6A 1SFIA 4A1TA 3P6ZB 3QX5H 5EU8A 2CHAC 2ZFQH 1SSXA 2AMPA 2O8WA 3MH4A 1FMGA 3RXPA 4FVBA 1QBOA 2O8TA 3A83A 1BTZA 1DFPA 2ZNKH 1L1JA 1SGNE 1GBBA 1O3JA 2ZHDA 1T8OA 4M7GA 4X6OA 1T8MA 3VB5A 5JBCS 1GG6B 3AVZA 1C4U2 2IPHA 2ZFFH 3SGBE 2OD3B 1O2IA 4ISLA 4ABFA 1LHEH 2A31A 1EAXA 2ZCLP 2ZPQA 1UK2A 3UREA 4O3UA 3IWMA 3E1XB 5JBTA 2ZPRA 1RRKA 3KHVA 2Y7ZA 3SNEA 2ZF0H 1ZTLA 4IN1A 3P92A 1O3BA 4UFGH 4CRAA 2QA9E 1S85A 3RXTA 2RA3A 1HFDA 2NU2E 1GHVH 1QURH 4CR5A 1ESAA 2B9LA 1AD8H 4ZROA 3EA8A 2JDID 1P2NA 2OINA 1O5CB 1EOJA 1RIWB 4AX9H 4B75A 1HXEH 3Q76A 5FPSA 3MO6A 4GVUA 1TIOA 1GG6C 1VZQH 2VVUA 1Y3XA 3QGNB 1F5LA 2D8WA 5KGOA 3V0XA 3QZQA 4Y6DA 5ETXA 4NCYA 4ABBA 1GBFA 1TQ0B 1XM1A 1GVKB 2BZAA 4F48B 2BY8X 4Q2KA 1Z8RA 1TGNA 3D62A 1FY1A 1BTXA 3TITA 1EZSC 1KSNA 4X1SU 4ABHA 1TNJA 2ZGBH 2F3CE 3DD2H 1BJUA 1NO9H 4HGCA 3MQKC 3OX7U 1NT1A 1K28D 4U2WA 2OQ5A 4CRCA 2PP6A 1GJ9B 3BIUH 3VEQB 1IQEA 3DT0H 4IMQA 4B6EA 3JZ2B 2Y5GA 1HAPH 3DUXH 1JMOH 4Z6AH 1NU9A 2YMSC 1T8LA 1TPPA 1Y5UT 1BITA 2SGQE 1EXFA 3ZVEA 1OS8A 1SBWA 3UY9A 2WINI 1GBIA 1AFQB 1P01A 2G81E 1BCUH 1E79D 5F8ZA 3PRDA 1YPLH 3QK1A 2WPHS 3QN7A 4JMYA 5DP6A 2QF0A 2QY0B 3TU7H 2JH5D 5J4QA 1SQOA 1ESTA 1ZJDA 3SYJA 1SLVB 2NU4E 1O3KA 1VITF 1GI0A 3MO3A 5EJLA 2VVVA 1QQ4A 1AKSA 3FO8D 3SU4A 1O3PB 5A0BA 5EJ1A 3BF6H 1DUEA 1A0JA 2F9NA 4WY3A 1GI2A 1QL8A 3SI3H 3SORA 4DW2U 4K60A 2GV6A 4SGAE 1UCYH 3P8FA 3F6UH 3PV4A 4K1TA 2D26C 3RUOA 4NWKA 4CH2B 3LPRA 5EG4A 3A88A 2BLVA 5DGJA 5C94A 4ACBA 2KFWA 1C2KA 2STBE 1C4V2 2LPRA 4X2WA 5JPMH 5IK2D 4JYUH 3S7KB 3TH2H 1BTWA 2Z9JA 1FIZA 3FN8A 1AFQC 3UOPA 1EB2A 1ETTH 4GUXA 1KDQB 1P2IA 4RN6A 1GL1A 1GGDB 2Z6BD 1E37B 2XBWA 2AGIX 2XWBI 1S81A 1O2TA 4R0IA 4BTIB 2WV9A 1NRSH 1J17T 1O32A 1GBDA 1SQRA 2R2MB 5ABWA 1O39A 1H4WA 1EAWA 2R2WU 4JZ1A 2A4RA 1O2WA 2BHGA 1P9UA 1D4PB 1O2JA 1O3AA 3SW2B 1A0HB 1ARBA 4DCDA 1XUHA 3MU1A 4BAKB 2GD4B 2V35A 2A5AA 2ZHFH 1B5GH 1GBKA 3SU2A 3WY8A 3BTTE 2P8OB 5GJ4B 2ZTXA 1AI8H 2VWNA 1NRRH 3PROA 1BA8B 5JBAS 4U30A 1V2WT 1XUIA 3KQCA 3UNSA 3LOXA 1BBRH 2W6ID 3EE0B 1PPZA 4BXSA 3TPIZ 3ITIA 1EKBB 1K1LA 2QCYA 2BDIA 1O3OA 1DWEH 1EAIA 1LO6A 2EY4C 5EW1H 1W10U 2WZQA 1SL3A 1Y5AT 2ILNA 1GGDC 3ATLA 3U9AH 1Z8IB 2QXIA 3RMNH 1LVOA 1MBMA 1UK3A 1YM0A 2BX3A 4D9QA 2G4TA 3F0PA 1V3XA 2GKVE 2ZEBA 4AZ2B 3FZDA 1P3EA 3BTEE 1LVYA 2KX4A 3URCA 8GCHF 2EQNA 1NBMD 1YPHE 1PPHE 4B2BA 3SZNA 1EQ9A 2J94A 1ELEE 2EI8A 3MU4A 3O8DA 1Y3UA 5CHAB 2FWWA 2OBQA 2WSSD 5L30H 5DP4A 1LQEA 1UVSH 3QO6A 4R8TB 1GI9B 3BV9B 1O2LA 1ANCA 1PQ8A 3HATH 4WVPE 1TALA 4B73A 2WHXA 5IDKA 5FPYA 4Y7BA 1T31A 3VXFH 2P3TB 2AMDA 3SNDA 1PQ5A 1Y8TA 2QN5T 1DE7H 3KNXA 1O3HA 1ZHMA 1OP0A 2WPMS 2AMQA 1IQGA 1ELVA 3SZEA 4NIXA 2Q6DA 3RM2H 3TGJE 1C5TA 4LZ1H 5J4SA 4RKJB 1U6QA 3U1JB 3TNSA 2BD9A 1NPMA 3M36A 1WOFA 2FI3E 3MNCA 1C2FA 1GBAA 4Y76A 2NWNA 2ZA5A 3CS7A 3MOCA 1C1WH 1W7XH 2O8UA 3FVFB 2ALVA 1LQDB 3FANA 3H7TA 1V2LT 1VR1H 3LGWA 3GY2A 1FY3A 1V2QT 2XOKD 4ABGA 1SR5C 2BY9X 2XBYA 2FTMA 2G51A 5F03A 1C5SA 2ZKSA 3GCHC 1Z6EA 4CBOA 3TJVA 2FPZA 1QBVH 1SC8U 3AASA 2JJ1D 3TGIE 1SGFA 3PLPA 3O8RA 3F2GA 3GY7A 5T6FA 4LZ4B 3URDA 2VVCA 1PYTC 1QB1A 3GCTF 4UFFH 3SOSA 3QTVH 3VGCB 1C1TA 1V2RT 1UVUH 1QA7A 2WV5A 3AAVA 5C1UA 4K2YA 2GV7A 1DICA 3TJUA 4A6LA 3BTFE 2OP9A 2TGAA 1HAXB 2EI7A 1WSSH 2P94A 5BRRE 3RU4E 1KXAA 3GS9A 4X8TH 2VNTA 5TCCA 2K1QA 4MPUA 4A1VA 2XBVA 4FUFA 2BQ7B 3ENSB 1FV9A 1FPHH 1DOJA 5GXPA 5GCHG 2ZDKA 5L2ZH 2AERH 1Z7KA 3BN9A 2GMTB 4X0WU 3LH1A 2ZHQH 2H9EH 2UWOA 4AC9A 5EOKA 1UTPA 1MCTA 4NSVA 1RGQA 5EXLA 1QRWA 4X8VH 4Q7ZA 1RS0A 5A8ZA 1XXDA 3RXRA 1GJ7B 5DP8A 1GHYH 4XRNA 3VXEH 1TA6A 1ZR0A 1PPEE 5F8TA 3RXDA 4YT7H 1THPB 2BD8A 3B9FH 4BTTB 1ELFA 5LH8A 1BMAA 3GY4A 4X8SH 5FAHA 2G55A 1MKXH 4UD9H 2TPIZ 3GCNA 4DIIH 2BVXH 3U8TH 4H6TA 1BOQA 3SJIA 5C17A 3F2FA 1TGCA 3CS0A 3EA9A 5C3NA 1MTVA 3NUMA 4I8JA 1HJAB 3K6ZA 2Z3CA 1G30B 3NZIA 1O3GA 3MFJA 1MU6B 2PLXA 2PFEA 3NRLA 5C2ZA 1GJ6A 1DY9A 1O3LA 2FOCA 2OK5A 3OFND 2UUJB 1MZDA 1SOZA 1WUNH 1A2CH 4LOYH 1ABJH 2AGGX 5EW2H 2ANMH 2F43B 1VITH 3GY3A 4ZCNA 3K6YA 1HUTH 1Z1IA 3MMGA 2THFB 1EPTA 2ZO3H 2KCOA 5AF9H 1C5LH 4FUIA 3ZVDA 1W12U 2A5KA 4NA7A 2GZ8A 5DG6A 1RD3B 2AFQB 2C4FH 3OEHD 3SV9A 3IITA 1DXWA 1L4DA 1UO6A 3PLKA 1GJ5H 2OLGA 6CHAC 1RTKA 5B6OA 2PSXA 1HJAC 1LKBA 1Y3WA 4WF8A 1EZUC 3KEEA 2XC4A 1DWBH 1ZRKA 1HGTH 1LPGB 1O5DH 4DOQA 1IQJA 4NIYA 1V2ST 1EZXC 2V3HH 4FUCA 4YTAA 1UCYK 3RMLH 1YGCH 1MQ5A 3BTGE 1A4WH 2ZU2A 1J15A 3QGJA 4I86A 4FVDA 5HIYA 4AYVB 1ELBA 4X1QU 2OTVA 1UTJA 1HIAA 3ZVBA 1QTFA 7ESTE 2ZG0H 1SVPA 3RMMH 3SUEA 5K0HA 3PM3A 3BTHE 2BDCA 4CBNA 1JWTA 3LH3A 3SU3A 1BBRE 1V2TT 3RC4A 1GBTA 2PUQH 4BANB 4Y79A 1HXFH 3ATKA 2Z9KA 4QT8C 2GT7A 3VPKA 1S0QA 3BEIB 2XCNA 2ZDVH 1G3CA 2P3UB 1MTNB 2TIOA 2J97A 1SGYE 1KTTB 3N7DA 1O2NA 1NC6A 1ZRBA 4Q4LA 4AFSA 3SBKA 1B7XB 5B6LA 5I46H 5KEDA 1TMTH 3E6PH 1HLTH 2HPQH 1P06A 4DT7B 2ZGCA 3DSOA 2GX4A 1ZSJA 1W8BH 4RT0A 2OC8A 2A4GA 3RU4D 3LONA 1S0RA 1UMAH 1JIRA 1GBJA 2RDLA 1O30A 1C2DA 1OYTH 1N6YA 2BLWA 2BD2A 4UONA 1D6WA 1K1IA 3RXOA 2HPPH 1YY3A 2FX6A 3TK5A 2C8WB 1ETRH 2ZDLA 1C5VA 3JZ1B 1IQNA 5AFYH 1BBRK 2R3YA 2ZHWH 1YLDA 3DSGA 1GI4A 3ATMA 5BPEA 3KF2A 4D9RA 2J4IA 1ZGIA 1DS2E 3OTJE 4WMEA 1B0FA 1O2QA 3AAUA 1MTNC 1A46H 1ELDE 4X1RU 3LT3A 1W0YH 3A80A 4FUDA 3E90B 3SJOA 1ACBE 3RXQA 2UUYA 1LHCH 1C2IA 1HJ8A 2ZP0H 4ZMAH 2F9BH 1O2RA 3P95A 2XBXA 2XXLA 2FODA 3MNSA 1LKAA 1MABB 2Y6TA 3QZRA 4MDSA 3RXIA 2WPLS 1SQAA 3TH3H 2F91A 3UAIC 4FU8A 2SNWA 2A32A 2L6OA 3STIA 3V12A 3KQ5A 2DE8A 2Q1JA 1G2MA 3PMJA 3RLWH 3T26A 1JXPA 1NN6A 3ZZAA 2GDDA 4TT3D 4YLQH 3RM0H 5EJZA 4FOUC 2OC0A 2J2UA 2Y7XA 2K8IA 2ASUB 2ZC9H 5HM9A 2ANWA 2XW9A 1BTHH 3RXVA 3ZYDA 1RTFB 3O8CA 2GP9B 1L1GA 3PYHA 1C5XB 2QXJA 3BG4B 5PTPA 2GTBA 1P05A 2ZU4A 1K1JA 3AW0A 3Q3XA 4Y11E 1F2SE 1GCDA 4KP0A 2FOGA 4ISNA 2WPJS 2J98A 1C5MD 2ANYA 1TPOA 4Y0ZE 4ISOA 4D7FA 4MPVA 1VKYA 4DIHH 4YT6H 4ISHH 1TAWA 1C5YB 2VIWA 4FUJA 1SGIB 3SU6A 3EQ0H 1W13U 2UWLA 4UDWH 3D23A 2ZDMA 1O3EA 3F9EA 1A1RA 1TPSA 2V7QD 1GMHG 1GI5A 1GHZA 3ZYEA 4MQAA 5DPAA 1BMMH 1AZ8A 1FN8A 4DT4A 4BTUB 1RFNA 3VG8A 1CHOG 1TBZH 1DANH 2Z9LA 3KYFA 3EDXB 3OU0A 1WQSA 3SJ9A 4IC5A 1Y3VA 1N8OB 3FAOA 1TRMA 2GJGA 1O5BB 3A86A 1GBMA 3BG4C 3HGPA 1UTOA 3A7WA 1TQ7B 3A8CA 1O5GH 1C2MA 1UTKA 3MU5A 3PV2A 1EUFA 3RC6A 1V2UT 1YCPH 1D9IA 1HDTH 1NBME 4IS5A 1SGCA 2VJ1A 2G00A 1YC0A 4TPIZ 3FP8E 1TGBA 4ABDA 2FX4A 4NA8A 2HRVA 5H4IB 1QNJA 1W0ZU 1KLTA 3P17H 3DA9B 1E36B 2ESTE 1E1RD 1UVPA 3ZIAD 1RIWC 3DSPA 1GVZA 2SNVA 3PTBA 2BMGB 2L74A 1AFEH 4F55A 1IHTH 1MBQA 2A2QH 2CGAA 1LHDH 1HAVA 1C5RA 1HNEE 4ISIH 5E0HA 4Q7XA 1GHBG 2V6NA 4K8YA 3S7HB 3NKKA 3F3BA 1N8OC 1UVOA 2A7CA 3OSYA 1MTWA 1QY6A 2GZ7A 1QGFA 1XVMA 1O38A 1KMHB 4ZHMU 4TY7A 2ZIQH 3UPEA 4D7GA 1UHBA 2PKAA 1LTOA 2ZFTA 3V7TA 2BLOA 2SGEE 1FY5A 1TFXA 3T29A 2PKSB 2WPDD 3MU8A 4XSKU 2QAAA 1DSUA 1ZTJA 2WV4A 2PTCE 3QTOH 1MKXK 2XNIA 1MU8B 1ZJKA 1H9HE 1YWUA 3TVJB 1AGJA 1AN1E 5HMAA 4F49A 1W11U 1JIMA 2FM2A 2ODQA 3OAAD 3LGVA 2KM0A 4I31A 2SGDE 2HVYB 1OHHD 3RXHA 4FUEA 1NFXA 4GLYA 1G37A 1AZZA 4NZLA 5EPNA 5A09A 2JH0D 4A1XA 5T1VA 4E06H 2BDGA 4GSOA 2FIRH 4X8UH 4ESTE 1C5ZB 1GBCA 1IQIA 4DGJA 1CE5A 4K1EA 4XBDA 1GHAG 1CO7E 1EJMA 3VFEA 3SQHE 1WTHD 1YPJH 1SGEE 1AO5A 3SHCH 1SGDE 1Y5BT 3ZZ5A 3U28C 2QF3A 1S6LA 2HGTH 3MH5A 1V2JT 3UOUA 5LGOA 5LPFA 1GMDG 1K21H 4CRGA 4FUHA 3AW1A 2R3UA 1F5RA 1OP8A 3GDVA 3ZZBA 1TOMH 1IOEA 5FX6A 4OGXA 4ZXYH 1HAHH 1S6HA 2A5IA 3SV7A 1IAUA 1EP5A 3A7XA 3DHKH 5FCKA 2OXSA 2Y81A 1GJ4H 2BTCE 2HALA 3ZZ7A 4RSPA 4DURA 1WAYB 3E16B 5DJ7A 4IC6A 5CDFE 3GYLB 1BZXE 3SO3A 3RP2A 2OUAA 2OQUA 1KLJH 3LGUA 4IN2A 4YESB 2IJD1 1O0DH 1T7CA 2Y80A 1THSH 1D3QB 5T3HA 4AOQA 1V2NT 1O2VA 1O2SA 3MHWU 3QWCH 3F68H 1LVMA 4IBLH 4XBBA 2FOEA 4AFQA 4YOJA 1NY22 3KL6A 4B1TA 2H5CA 3GY5A 3BG8A 4YZUA 1BMFD 2BYAX 1HIAB 4Y8YA 3LGTA 3RXKA 1CT4E 2Z7FE 5HKKD 1AIXH 1FXYA 4AGKA 1GWAA 3SUFA 1AVGH 2P8OC 1HV7A 2H1UA 1BRCE 2HNTE 2YOLA 1QJ1B 1UTNA 2HNTF 1GMHF 3P70B 1PPCE 4INLA 1O3DA 2TRMA 1O35A 5HIZA 4P02A 3ZZ3A 4X1PU 1A5GH 4GCHG 4YOGA 1NFYA 3SQEE 1ELGA 7GCHG 3M7UA 1OSSA 1AU8A 2A0QB 2FI4E 2UUFB 3NWUA 4A92A 4H42U 2ZCHP 5HXFA 1EASA 1CQQA 1CT0E 1P2KA 1SHYA
chains in the Genus database with same CATH topology
3VB7A 1XVOA 1J9CH 1MKWK 2Y82A 4XDEA 1PPBH 1ANBA 1P10A 4KTSA 2ZTZA 1BHXF 3TK6A 3ATWA 3M7TA 2W7UA 2P95A 5EODA 3RU4T 3O8BA 4OS5A 3D65E 5FBEA 4NFFA 1GMCG 4TPYA 5CHAC 2BY5X 1DXPA 4U01A 5E2PA 2ZTYA 2HOBA 1EOLA 1P3CA 5E8EH 1FDPA 3LGYA 4TWWA 2FLRH 2KAIA 2WYGA 1MQ6A 1PPGE 1GDNA 4THNH 1MUEB 2CMYA 2J92A 5DP9A 3ATIA 5AHGH 1MZAA 4BAOB 2VH6A 3RXCA 1S83A 3S69A 2EEKA 3NCLA 3VB3A 7LPRA 1ZGVA 4MPWA 2BDAA 4K5ZA 3CENA 2EA3A 1AB9B 1BRUP 5L2YH 2C8XB 3KN2A 1P2OA 3TIUA 1O5FH 4RKOB 3A87A 5A0CA 3S0NA 3A84A 4ASHA 4JCNA 4BAMB 1G36A 3GY8A 5A8XA 3BTQE 1BRAA 1F92A 1P04A 1H8IH 1MTUA 1KY9A 3E8LA 2ZDNA 4Y0YE 2B7DH 4H4FA 2BD3A 1P57B 1FPCH 1BQYA 2ZCKP 1C1SA 1NM6A 4I8KA 3SU0A 3LC3A 2OBOA 3MU0A 4H6SB 2Y5FA 1O37A 1O34A 1T4VH 1YKTA 3BEFB 4KGAA 2JETB 5AFZH 3M3VA 1S82A 2PGBB 3ZVCA 3Q00A 1IHSH 3PTNA 3UWJH 1ZSKA 5JB9S 4AN7A 2G4UA 5CMXH 1J8AA 2FYQA 3HK3B 3VGCC 2FOBA 4JK5A 1Y59T 1TLDA 1OXGA 1BTPA 1OWIA 3ZZ8A 3LDXH 1MCVA 4B74A 1QR3E 1G32B 3DFJA 3ZZ6A 1SG8B 1GHAF 5FBIA 3ZVAA 1H8DH 3FP6E 2IN2A 3LGIA 4WXIA 8KME2 3MWIU 2W3IA 4FU7A 4MPXA 3U8RH 4Y7AA 2W26A 1N6XA 2VWOA 3PWCA 1YCPK 2ZHEH 1A3BH 1EAUA 2A2XH 2FS8A 3HKIB 3VB4A 1GHXH 1GI3A 1EX3A 4J1YA 3V3MA 2G5NA 3EGKH 5C5OA 5JYIA 2ZFPH 3PB1E 4IW4E 5FPTA 3PO1B 1AVWA 2VIDA 2ZPSA 5HGGA 2BD4A 2GMTC 4YM9A 2J38A 1GI1A 1SMFE 1G3BA 1T8NA 1ZLRA 2FDAA 4Z0KA 3ESTA 3M5MA 1DITH 2BM2A 3T25A 3SN8A 3E91A 4HZHA 1KDQA 3ZZ9A 5F8XA 3ODFA 3B23B 2BOKA 6ESTA 1Z71A 2ZDAH 4LXBH 3A89A 1C2HA 1DDJA 1P12E 2BOHB 3HKJB 1HAYB 2HWLB 4WH6A 4HI3A 1Z8JB 4Q80A 4ZKOU 1A0LA 3PLBA 1L2EA 4DY7B 4GHTA 1QA0A 3H5CB 1O3MA 1UJ1A 1P0SH 3M5OA 1K1MA 1C2GA 2B5TB 4NFEA 3LU9B 4TYDA 4WMFA 1F0RA 1OOKB 1SHHB 5E0GA 2QXGA 1H1BA 2ZU3A 1OWHA 1ZYOA 1LMWB 1P2MA 1BTYA 3MNBA 3NXPA 1F0UA 3SV2H 1F7ZA 2ZGHA 2B8OH 1BDAA 2ZI2H 4BNRA 5HYOA 1K22H 1GI6A 2STAE 3UR6A 1NZQH 1AKSB 1GI8B 4UFDH 3E3TA 1K1OA 1TYNA 2H5DA 1GL0E 1FLEE 1SGTA 2EI6A 3M5NA 3HGNA 1YPKH 1SLUB 1C1MA 1FN6A 1J14A 2SGPE 3BTME 4MG3A 3LJOA 1C5OH 2O8MA 2PUXB 3SUDA 1SPJA 1LPKB 2CXVA 3EAJA 3SJKA 5G4BA 3T62A 2FTLE 2VIPA 3RXLA 1O3CA 2GCTB 1BT7A 2FXRA 4K8BA 1DLKB 3RMOH 4O03A 1O3IA 1XUFA 2OCVB 5E2OA 1ESBA 1QCPA 1XX9A 1OWEA 1GMCF 3H7OA 4NIWA 3UTUH 5DKMA 5FXLA 4SGBE 1BTUA 1KXBA 2FOHA 2H9HA 2FMJA 1BHXB 2Z3EA 4CRFA 1AQ7A 1LHGH 1O2PA 5HM2A 3RXJA 1O2XA 1YPHC 4ZKSU 1O2HA 1BB0B 3P8GA 4K69A 2HLCA 2I6QA 4VGCB 2BDHA 2JH6D 1HBTH 4Y10E 1GDQA 1BMLA 1CHGA 4NZQA 1SGPE 4X6PA 3UQOA 1TRYA 1KIGH 1W3CA 2EC9H 2G52A 3F9FA 3BTDE 5GIBA 9ESTA 2CHAB 1WBGB 4NWLA 1BUIA 3U98H 7KMEH 1O2KA 1C1RA 2O9QA 3GDSA 1DT2A 1Q3XA 3W95A 1WV7H 1F5KU 3ZZ4A 3SGAE 4AB8A 2J34A 1LCYA 2CF8H 4XOJA 2XC5A 3GOVB 5EPYA 1A5HA 1K9OE 2UUKB 1PPFE 5CE1A 1C5QA 2ZQ1A 4X2YA 1ELAA 4FXGH 1A61H 4AFZA 1C1QA 2BDYA 4XE4A 1V2KT 3PMBB 2ZU5A 5TCAA 1VJAU 4X2VA 3L6PA 2WPIS 5GCHF 1JBUH 1P09A 2PSYA 4MNVA 1O3NA 4VGCC 4WMDA 8LPRA 4UEHH 3KCGH 1GVLA 1ID5H 1CA0B 2VH0A 1WCZA 1BIOA 2QV1A 2R9PA 1C1PA 3M3SA 2BB4A 4KKDA 1KYNA 1GPZA 1TMUH 2IJOB 1E35B 3PMHB 5EGMA 2ZGXH 2A4OA 2FEQH 1HYLA 4AG1A 2A7HA 5JBBS 2W3KA 5L6NH 3TLOA 2ZWLH 5DP3A 1XKBC 2FLBH 3RLYH 1CGIE 4E7RG 1DLEA 5SGAE 1SQTA 1GJBB 2BXTH 3E0PB 1CVWH 3ZVFA 1J16A 1SGQE 2Z94A 1VCWA 1ZHPA 4MVNA 2TGDA 3BEUA 1AVXA 1MTSA 1G3DA 3BIVH 5C5NA 4CR9A 3RXAA 1QRXA 2I6SA 3RC5A 1C9PA 1TB6H 4GPGA 3K9XB 3OY6U 1OWJA 2F9OA 1QFKH 2UWPA 8GCHG 5DP7A 1CSOE 1QB9A 2AH4X 1HB0B 1CA0C 1ZPZA 3Q3KA 4K3JA 1C5UA 1DY8A 1RXPA 1GBLA 4I8HA 3ZZCA 3MH6A 2KAIB 1FAKH 4K1SA 1WTGH 1NROH 1ZTKA 1C1UH 5IYTA 2ZGJA 4AB9A 1ZZZA 1K1PA 4OGYA 3K65B 1GBEA 4CRBA 1O2YA 2PR3A 2AIPA 1NRPH 1AE5A 1T32A 1GI7B 1ABIH 5GDSH 1NRQH 3N7OA 5DO4H 1IQMA 1SFQB 1NFWA 3FFGA 1MH0A 2C8YB 2VWLA 1A7SA 1P02A 1AUJA 1YBWA 1AWFH 2O8LA 2WYJA 1GJAB 1NU7B 4I7YH 1DVAH 3ZVGA 1GCTB 2VIQA 2ALPA 2WPKS 3F9HA 2ZFRH 2RG3A 4CRDA 2H9TH 1O3FA 1LHFH 2VIVA 1TNIA 1TBQH 1EP6A 4A5TS 1UTLM 3ODDA 2A45B 1EJAA 2Z9IA 1C2JA 1C1NA 5C1YA 4AYYB 2FOAA 3QUMP 3I77A 3UUZA 4BXWA 2Z3DA 3UQVA 4X6MA 1V2MT 3KQBA 1NFUA 1G9IE 1SLXB 1C5WB 1LDTT 3T2NA 3RXBA 4UFEH 1CA8B 1ORFA 1D3DB 3RDZA 4JZDH 1O2OA 1THRH 5F6MA 1BJVA 1OWDA 1AMHA 1K1NA 1WYKA 1YPEH 2VB0A 3GCTG 3R0FA 4FUBA 3ZV9A 2TGPZ 1TX7A 1ARCA 3EYDA 6LPRA 1L4ZA 2G8TA 1TABE 3T5FH 3TJNA 1S5SA 3M37A 3U1IB 1C2LA 1KXEA 1AUTC 1YP9A 1GCTC 3T27A 1KTSB 1QJ7B 3GCOA 3DFLA 4DJZB 3L33A 4ZHAA 2Q6GA 2G5VA 3MI4A 3RXEA 3U69H 3ZZDA 1FAXA 3CP7A 4Y8XA 1O2MA 1DX5M 1C1VH 2Y5HA 2V3OH 2W5EA 2W7SA 1W2KH 1WU1A 3MNXA 1GJCB 2BD5A 2PKSC 4WXVA 4B76A 1ZHRA 1TGSZ 4ZXXH 1NESE 3M61U 1K2I1 1PQ7A 1L0ZA 1OP2A 2BY6X 2C93B 1FUJA 3A8BA 3M5LA 1ZPBA 2OC7A 1W14U 4U32A 1AY6H 1T4UH 4LK4A 1C9TA 1EPTB 3BTWE 6GCHG 2CV3A 4Y8ZA 4ZH8A 1TONA 2A7JA 2HVXA 2ZZUH 5T6GA 1Z6JH 3E0NB 4CHAB 4XFQA 1JRSA 1P11E 1MD7A 4Y71A 1M9UA 3BTKE 2C8ZB 1SOTA 3UWIA 4MNWA 5EQQA 1SI5H 3MTYA 3A8DA 4F4OC 1O33A 1PJPA 1PQAA 2VWMA 4BOHA 3SGQE 5EXNA 1EATA 1PYTD 4INKA 4ABAA 1P2JA 1P2QA 4NIVA 2F9UA 2AGEX 1TWXB 1CU1A 1SGFG 2ZECA 1S6FA 2AS9A 1Q31A 4BAQB 2NU3E 2R0LA 3A7ZA 1QHRB 1GJDB 1CGHA 1XMNB 2SFAA 1EPTC 2WUCA 1ZPCA 3R3GB 2CF9H 1INCA 2Z9GA 1B0EA 3HK6B 2IOTA 3UNRA 1YYY1 4CHAC 2GCHG 1XXFA 2P93A 3S9CA 3I78A 1F0SA 1HAGE 1TBRH 4KTCA 4D8NA 2PTNA 4ZUHA 2H2ZA 1OPHB 1O5EH 5I25A 1CHOF 1F0TA 3RXGA 3UNQA 4CREA 3LKWA 1ZMJA 1O2UA 3TK9A 1V6DA 1SGRE 2FO9A 5FHTA 3QLPH 1TGTA 1E38B 3C1KA 5EQSA 2NU0E 1VCQA 1N1LA 1Q2WA 1P8VC 1TNLA 4MNYA 9LPRA 4YOIA 3S9AA 4YO9A 1TNGA 1H9IE 1V2VT 1ZSLA 3GCHB 5DK1A 3RXFA 2SGAA 4FU9A 4XBCA 1XUKA 1PFXC 3A7YA 3GISB 3F9GA 3G01A 3A82A 3A7TA 3MH7A 1FONA 2VINA 4ZAEA 1HAZB 3QDZB 1YCPM 2GZ9A 4WWYA 3UIRA 1FZZA 1MAXA 5E0JA 1KXDA 3LIWA 1AE8H 2RCEA 3TGKE 4WJG2 5A0AE 2BVRH 2LNCA 5AVDA 3M7QA 1MD8A 3TH4H 4IGDA 4BAHB 1TE0A 3SJ8A 2BD7A 1SB1H 1GHBF 4PROA 1VJ9U 3LC5A 3UR9A 4DG4A 4B71A 2AYWA 2M5TA 2ZU1A 3Q77A 4OS4A 1GDUA 5C1XA 3PWBA 1TNKA 1ETSH 2XTTB 4AORA 3NK8A 2QGRA 1Z1JA 2D2DA 3SUGA 2F83A 2H6MA 2BDBA 2J9NA 4NSYA 4O97A 1FIWA 1JRTA 2VU8E 1G2LA 2XRCA 4NGAH 1DUAA 4AGJA 5EXMA 1OWKA 3VB6A 1ELTA 1JOUB 3A81A 1XUJA 2VGCB 1QL7A 4GAWA 4ZHLU 5T6DA 4OS2A 1DM4B 3KQDA 1EB1H 1RJXB 1IQKA 4AG2A 4X6NA 4MLFB 2FOFA 1D3PB 2XCFA 1KXCA 2ULLA 1D3TB 1D6RA 3B8JA 3L3TA 1O36A 2XC0A 5C20A 4JK6A 3TJOA 4A7IB 1YPGH 2A1DB 1XKAC 1VGCB 3W94A 1HCGA 3ELAH 1AB9C 5GWZA 2ODPA 5A8YA 1TPAE 4UE7H 2FYRA 1FQ3A 1C4Y2 1BRBE 1Z8GA 2BQWB 1EZQA 1CT2E 1UK4A 4JYVH 3UFAA 1CBWB 1HRTH 4MTBA 2BX4A 3KQEA 5ESTE 4X2XA 1FJSA 1HAOH 3I29A 3GDUA 1ZMNA 5FCRA 2FP7B 1E34B 1GBHA 2VGCC 4OS1A 2XYAA 5JB8S 2BLQA 1GMDF 1YPMH 1FI8A 6GCHF 1S84A 2YNBA 1C1OA 2DE9A 1QL9A 1AHTH 1ANDA 1UTQA 1X7AC 2XWAA 3TNTA 4O9VA 2JETC 4KTUA 2WUBA 1DSTA 1OKXA 2BQ6B 1AWHB 1O31A 4I32A 1TMBH 3T28A 1VGCC 6CHAB 4KELA 1QBNA 1OYQA 2BXUH 3FZZA 3IG6B 3V13A 5JDUB 3F1SB 3GYMA 2QIQA 4B2AA 2SGFE 1UTMA 2NU1E 1IQLA 2GT8A 1QQUA 3P8OA 4WH8A 1CBWC 2GGVB 1UCYE 1HAVB 5DP5A 4JZIA 1GJ8B 2ODYB 1Y3YA 4INHA 5ESBA 4ABIA 1FY8E 5K7RA 1HJ9A 3NPSA 3STJA 1H9LB 1TNHA 5FX5A 2P3FH 2FOMB 1NTPA 3RXSA 4CH8B 5LPRA 1VCPA 2F9VA 1OX1A 1UHBB 2FZZA 2GDEH 3MO9A 2PKAB 3PO1C 3GY6A 2PHBA 1O2GH 1MMJN 2GCHF 1HPGA 1IQFA 3Q3YA 1QRZA 3SV8A 4E7NA 2A4QA 4YLUA 2CJIA 1A3EH 2OC1A 4GCHF 2CN0H 3LJJA 1KLIH 4JYTA 1MAYA 4ABJA 4TY6A 7GCHF 2ZQ2A 1P9SA 2QXHA 1XUGA 3SNAA 2YNAA 1P03A 1TOCB 3EA7A 1EJNA 3S9BA 1W7GH 5LPEA 3K2UA 2P59A 1G3EA 3SU1A 2PW8H 1YF4A 3SNBA 1TA2A 3KIDU 2PWXA 2TGTA 4B2CA 2VIOA 5GPIB 1TRNA 3OYPA 4OS6A 4O3TA 3KGPA 4ABEA 4D76A 2P16A 2DUCA 1KXFA 2QC2A 1C2EA 1V2PT 3D49H 8ESTE 1FY4A 1C5NH 3GICB 1QIXB 4X1NU 4MNXA 1ELCA 4IMZA 4ZKRU 1NS3A 3C27B 5TJXA 3SHAH 3M3TA 1L1NA 1TX6A 4DVAU 4AFUA 3RXMA 2D1JA 1VITG 4JZEH 3A8AA 1A5IA 4GHQA 4J2YB 1ZMLA 2C3SA 2FS9A 1O2ZA 1UVTH 2JKHA 3RXUA 3MYWA 1BMNH 5EQRA 2BY7X 4HFPB 4Q7YA 5C67A 2HNTC 3P8NA 1NRNH 2TBSA 1TX8A 3PMAB 4E05H 3M35A 2R0KA 2F9PA 2BVSH 3A7VA 3SU5A 2PV9B 1GHWH 4OS7A 2AEIH 2GCTC 2PGQB 1QJ6B 4I8GA 3A85A 1MKWH 4NA9H 2QYIA 1QB6A 1FNIA 1RTLA 3HPTB 2RA0A 3FP7E 4TWYA 2BZ6H 4FUGA 1CGJE 1DWDH 1WQVH 4NG9H 4I8LA 3SI4H 2B0FA 4I33A 1V2OT 2AIQA 4ZKNU 3SNCA 5A2MH 2ZFSA 1E0FD 2ANKH 1LPZB