1W10U

Urokinase type plasminogen activator
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w10U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w10U01
1UMAH 1OWHA 3UY9A 1SFIA 4OS6A 1GHAG 4K1TA 2BXTH 3A89A 4AN7A 4CBOA 1EZXC 5A09A 2W7SA 1F5LA 2GV7A 1F92A 1NO9H 4B76A 4J1YA 1Y3UA 2ZQ2A 1GI4A 4JZFH 1XUKA 4D7GA 3A7XA 3BEIB 1GJ6A 1O5FH 1NZQH 2G5VA 1INCA 1HRTH 4KELA 2VIQA 1KXAA 2AGEX 1SSXA 2CHAC 4Y71A 1K1OA 1TOCB 2Z7FE 3P17H 2WYJA 1C2JA 1FN8A 2PGBB 6GCHF 1GBHA 5DO4H 2NWNA 4VGCC 4K8BA 3RMOH 3ZZDA 1GJBB 4I8JA 5FCKA 1CA0B 1EAUA 1SL3A 2ZTYA 1O31A 4KTUA 3TGIE 1BRAA 2EEKA 3HGNA 4ABAA 3KQEA 1W13U 4SGBE 1P2IA 1P2KA 4AX9H 2RDLA 2QF3A 3A8BA 3E16B 3A7WA 4FU9A 4UONA 1THPB 1ELEE 2Y7ZA 4MVNA 1SGPE 1DITH 3RXGA 1OP0A 4DY7B 4ESTE 1XUGA 3U98H 1N8OC 1RIWB 1BZXE 1BBRK 1OWDA 4TY7A 2RA3A 1CA8B 1P02A 1GJ5H 2BMGB 1NPMA 2EA3A 1TGSZ 2CF9H 4UFDH 3RC4A 2HPQH 1MTNB 3A81A 1UCYH 5E8EH 2ZDMA 2VINA 3K2UA 3M7UA 1W8BH 3ENSB 2AIPA 1Z8GA 2CN0H 1LTOA 1NROH 1SGYE 2ZA5A 2C93B 2WPJS 1O3OA 4NA9H 3TITA 5A0BA 1C5OH 4ZROA 4YZUA 2FZZA 1ANCA 5ESTE 2PGQB 2PTNA 2P3FH 4AB8A 1L2EA 4U30A 2B0FA 1BMNH 1BTUA 3UNQA 3V3MA 1BJUA 3LKWA 1DICA 1H8DH 1MKWH 2OD3B 1ARCA 4GLYA 1DUAA 2ZGHA 1Q31A 2J4IA 1SQOA 5FPSA 2CV3A 1ZJDA 3SHCH 1HBTH 2V6NA 3CP7A 4FVBA 3GYMA 2HWLB 3PLKA 3RXIA 4GUXA 2FOAA 1B0EA 2J94A 2M5TA 1GHZA 1EZUC 3UNSA 2Y6TA 3TJOA 2STAE 1KIGH 2UUKB 1SGEE 2ZU3A 3T2NA 4WMFA 1TNGA 1J15A 3PWBA 6ESTA 2WV5A 5I25A 2A7JA 2CMYA 5ETXA 2F9BH 4IS5A 2BLOA 2OLGA 1MD8A 1GBJA 4ZHAA 1ABJH 1AE8H 1P10A 3AW0A 4XBDA 1MKXK 1TPSA 1OP2A 1TRNA 4OS1A 3HK3B 1O5DH 1LPKB 3BIVH 1L4ZA 3GYLB 1BIOA 3R0FA 5HXFA 2BB4A 1HJ8A 4IGDA 1TGTA 3ZZ6A 2P16A 1J9CH 3ZZ7A 2Q6FA 4X2XA 2BQ6B 1GL1A 2RA0A 1JIRA 4X1RU 1AZ8A 1DWBH 3BN9A 1C1SA 2BDGA 2BDBA 2R0LA 4SGAE 3ZZ9A 3BG8A 3HK6B 2O8MA 5B6OA 1YBWA 1NRRH 3UTUH 1W7GH 3RC5A 4ZKNU 1O32A 4THNH 4NIVA 4MTBA 4NWKA 1ESTA 3K6YA 2J92A 4ZXXH 1C2LA 1NFXA 5E2PA 1VGCC 2FM2A 3DT0H 5FXLA 1HJAB 2BLWA 1O3DA 1YC0A 1MTVA 5DP9A 2F9UA 3JZ1B 3P8FA 1SG8B 3C1KA 1O3IA 1O3GA 1SBWA 5DK1A 1TNJA 1YF4A 1DY9A 3EYDA 2ODPA 1WYKA 2ZHDA 1F0TA 4I7YH 4YT6H 1FNIA 1GI7B 4ABGA 2BLQA 5EG4A 2BX4A 2FWWA 3W95A 1WV7H 2QCYA 1MAYA 1BRBE 1TPOA 2BOKA 3UQOA 2B8OH 1AGJA 1J16A 2H5DA 3MU4A 2QV1A 1MU6B 1AKSB 1C2DA 4JZIA 3SV2H 4E7NA 1QR3E 5JBTA 2FDAA 1C2FA 1G2MA 1P06A 4X1SU 5F03A 4KGAA 1GBAA 1PFXC 1PPCE 2Z3CA 1TAWA 3SQEE 4ZHLU 2BVXH 1FONA 1KXDA 3GOVB 3DA9B 1CA0C 1HFDA 2J34A 1QNJA 2NU2E 3CS0A 4CHAB 2BY8X 1QRXA 1GBDA 3A87A 5EQSA 1D3QB 3L3TA 4FUGA 1C4V2 4TY6A 1K9OE 1XUIA 4CH8B 2ZQ1A 4NA8A 4FU7A 1LQDB 2I6SA 3RXRA 7ESTE 2ZTZA 3D49H 1EJAA 1LPZB 1G3BA 1RIWC 5EPNA 2XWBI 1N1LA 3GCHC 5GCHF 5K7RA 4BNRA 3LH1A 1GG6B 7LPRA 3P8OA 4MNYA 4LOYH 1Z7KA 3RXFA 3HKJB 1FDPA 3RLWH 2AFQB 3SUFA 4DJZB 1ANBA 2AMDA 1EUFA 1YGCH 1GBMA 2ANKH 1NU7B 4D9RA 1EPTA 4DIHH 1AVGH 1LHCH 1MTNC 1QL7A 1TFXA 2VH0A 1A5HA 2ZPQA 5DG6A 3G01A 4J2YB 1LQEA 1EAIA 5HYOA 3SGAE 1ELAA 2GTBA 1ZLRA 2PKSB 2O8TA 1W0YH 2LPRA 1UTKA 4H6TA 3SU6A 3KF2A 3FVFB 1LHDH 3TIUA 4A1XA 1AUTC 3LGWA 3NKKA 4O97A 4B71A 1TALA 1IHTH 4WH6A 1EZQA 1TLDA 1V6DA 4AGJA 3SOSA 4K1EA 4B2CA 1LVBA 2P8OB 3UOPA 2C8ZB 4I8LA 5HM9A 1ETRH 1EP6A 2BZAA 3QZQA 3V12A 3LT3A 4ZMAH 1BHXB 3L6PA 4BAQB 1NRQH 3NK8A 1K1LA 2BTCE 5E2OA 1LMWB 1O3JA 4ZKSU 2XC4A 2HRVA 1GVKB 1RTLA 1GI2A 2XBXA 1Q2WA 3FP6E 5TCCA 1GJAB 3SUDA 2GCHG 4DVAU 1IQMA 2TGDA 3E3TA 1FQ3A 3SV9A 1K2I1 2BHGA 1S0RA 4UFFH 2TBSA 1GI6A 1KXFA 3ATWA 3SBKA 2PUXB 1IQJA 4XBCA 3LH3A 1GMHG 1GMDG 3SNAA 4BXWA 1O37A 1QA0A 2FIRH 4NZLA 1S83A 3UNRA 3I29A 1SGNE 1OPHB 2SGPE 3GY8A 4YOIA 3LU9B 1XVOA 3LGTA 1C5QA 2VIDA 3U8RH 1EB1H 4Y0ZE 4YTAA 2H5CA 3GY4A 3OTJE 4WJG2 2FPZA 2PW8H 2J9NA 3QUMP 4ABBA 1CGHA 2J38A 3UREA 1QQUA 2FTMA 4CRAA 5L6NH 2HLCA 5L2YH 1TE0A 2DE8A 3U8TH 3SORA 1D6WA 1IQFA 1CE5A 1G9IE 2ANMH 2XBWA 1LKAA 3ESTA 4B2AA 1ELFA 1UHBA 1ZPCA 1SB1H 3MU8A 3AAVA 1WQSA 1AE5A 1CBWC 4R0IA 2UUYA 2ZDAH 1UVOA 4IC5A 1Y5UT 4GHQA 1OWKA 3GY6A 2J2UA 1BOQA 1Z6JH 2C8YB 1IQEA 4X8UH 4YLUA 4K60A 1EX3A 2O8UA 3U8OH 4E06H 4GHTA 3O8RA 1T7CA 1UTOA 4LXBH 4UFEH 4Q2KA 1NM6A 2GV6A 5AFYH 1O2KA 3ZVBA 3GCTG 1ZYOA 1LHFH 2G4TA 4OS2A 4D9QA 3VXFH 1HJAC 3BG4B 2G51A 4K3JA 3SHAH 1IOEA 1C5MD 5FX6A 5EXLA 2B5TB 2NU4E 3TK6A 5LPFA 1C4U2 1GCDA 1ARBA 3Q3KA 1AY6H 2BD5A 3SU3A 4I31A 3A7VA 2GD4B 2OC0A 3RXEA 2FLRH 1C1OA 1HAIH 2G00A 1FZZA 2GMTB 3A8AA 3PMJA 1G30B 4JCNA 3SZNA 3STJA 1TYNA 3OX7U 1FAKH 2HVXA 1TMUH 1ZTJA 4INKA 2UUFB 5LPEA 1UTMA 1C1QA 4AGKA 2HGTH 2BYAX 2Z3EA 3ATMA 2FXRA 1QBOA 3ODFA 3GY3A 3LGYA 1OKXA 1O3LA 1P12E 1XUJA 3GDVA 1YP9A 1P3CA 1HAZB 4JYUH 4ZH8A 3RM0H 4CHAC 4NGAH 1BRCE 2Y7XA 5FPTA 1QB6A 2BDCA 3UIRA 1C9PA 1HAXB 1SLXB 1QB1A 3UR6A 3E8LA 5DP3A 2R9PA 3STIA 1QQ4A 3EQ0H 2Y80A 1H9LB 4DG4A 1RS0A 5FX5A 2G55A 1H8IH 9LPRA 2ANWA 1S6FA 5EW1H 4CRCA 2F91A 4CRGA 1GG6C 3HGPA 1TOMH 4AORA 4UDWH 4BAOB 2NU3E 3ELAH 5EXNA 3ZZCA 1S82A 1JXPA 3S7HB 3K65B 1MCTA 1TGCA 3SU2A 2XCFA 3T5FH 1HAPH 4UFGH 2WPMS 2NU1E 3F9FA 3P8NA 6GCHG 1HJ9A 1P03A 3T29A 1SQAA 1O0DH 3NZIA 2TGPZ 2FP7B 3PMHB 2PKSC 2AEIH 4JYVH 3EA7A 3SO3A 4Y7BA 3SJOA 8GCHF 1GVZA 4H42U 1O34A 3ITIA 5IYTA 1XM1A 3F1SB 1K1IA 1HXEH 1T4UH 2GGVB 5FHTA 2SGQE 1QJ7B 3KL6A 1K1JA 4ZHMU 3CS7A 3ZVFA 1ETTH 2O9QA 2P8OC 2VIPA 1A7SA 1ESBA 4BANB 3SNEA 2BY7X 2OBQA 1UVTH 5GWZA 2OQ5A 2OCVB 1WSSH 2SNWA 3H7OA 2GX4A 2ILNA 1NY22 4E05H 1IQKA 1EATA 1GWAA 3E91A 3SU1A 1TGNA 1FUJA 3SU0A 1V2UT 1G3EA 4U01A 3P8GA 5DP8A 2VIVA 2ZKSA 3RU4T 2QYIA 3F68H 3SN8A 3GDUA 2BDHA 4X8TH 4KKDA 1O35A 1V2MT 4PROA 5EPYA 3TNSA 4CH2B 1SR5C 3FAOA 1RD3B 1P05A 2OC7A 2PKAA 1P11E 1BT7A 3MYWA 4Y11E 3GY5A 2UWOA 3D23A 2W7UA 3KQDA 4XSKU 4INHA 2UWLA 5DP7A 2PFEA 5A2MH 1OP8A 1GHWH 3MU0A 1TONA 4FU8A 2VVUA 2PLXA 2Z9IA 1PPEE 1XXFA 4CRBA 3AW1A 1HLTH 2STBE 2Z9KA 2Z94A 2B9LA 2ZHFH 2ZF0H 1ANDA 2JETB 3VB4A 4B75A 1Y5BT 4DGJA 1BQYA 4HFPB 1O2ZA 4KP0A 1GJCB 3MOCA 3K9XB 4LZ4B 1P3EA 1SMFE 1BBRE 2FS9A 1P2NA 3ZVEA 3S9CA 2BD4A 2F9NA 3S7KB 5F8XA 1SHYA 1LVOA 1AD8H 1VJ9U 3EGKH 1C5WB 4K8YA 2FOHA 1NU9A 1ZGVA 1Z8RA 3NXPA 1GI8B 1K1PA 4TPYA 1C2MA 1GL0E 1O38A 2C3SA 2GZ8A 1WTGH 4BTIB 4Y0YE 1Q3XA 1PPGE 2QXJA 4B1TA 1V2KT 5EODA 1CT4E 3RXQA 2D26C 1C5XB 2A2QH 2A45B 5C1YA 4IMQA 3H5CB 2Y5HA 2B7DH 4CREA 1ELTA 3MH5A 1OWIA 3IG6B 4BOHA 2SGDE 4WWYA 1HV7A 1GI5A 3GY7A 1A5GH 2ZU4A 3UWJH 1FJSA 1ZMJA 2VVVA 5E0GA 3RDZA 2G8TA 1MCVA 3LONA 4YOJA 8LPRA 2FOGA 1J17T 1HIAB 3BG4C 1L4DA 1S5SA 1FAXA 2ZFPH 1FIWA 1ZPBA 2Q1JA 5AFZH 2D2DA 2FLBH 4WMEA 5LH8A 3L33A 1C5ZB 3TH2H 2Q6DA 1F5KU 4O9VA 4TPIZ 1YCPH 1C5NH 1DLEA 3B23B 1BTPA 3RM2H 1BRUP 2FOBA 3PROA 1ZRKA 2H1UA 2SFAA 4A5TS 4D8NA 3MO9A 4ABHA 2GMTC 3RUOA 1CSOE 4NFEA 3QGNB 1F5RA 1HYLA 3MU1A 3KCGH 1V2JT 1C5TA 2VH6A 1GI3A 2IPHA 2FTLE 2PSYA 1UO6A 3M7QA 1LO6A 2UWPA 1QJ1B 4QT8C 4ABIA 1FN6A 1BITA 1QFKH 1D9IA 4DOQA 2Y82A 3BEFB 3IWMA 5IDKA 1ANEA 1PYTC 1UVUH 1UK3A 1TBRH 2A4OA 1MQ5A 1D3TB 1LHEH 1P2MA 3RLYH 4CR9A 5E0JA 1H1BA 4CBNA 1O3KA 4MG3A 2OTVA 2ANYA 3HKIB 2VIWA 3A82A 4H4FA 1A4WH 1EJNA 2XWAA 1FY1A 3A86A 1DSUA 2P93A 1C1NA 2ZGXH 4ISLA 5C2ZA 3AAUA 3UPEA 4YT7H 1P9SA 2ALPA 2ZHEH 3QTOH 2CXVA 2AH4X 1YPHE 3TJVA 1K1NA 3ZYDA 4ZAEA 1O2QA 2ZDLA 2ZDNA 2BVSH 4UD9H 3ZZ5A 1D3DB 1RRKA 1Z71A 1VR1H 1O3FA 2J95A 4IMZA 3RXSA 3SNCA 1ZTLA 2W5EA 1O2IA 5A0AE 2AIQA 4X6NA 3RXOA 1DT2A 2A4QA 1UVSH 5DGJA 1ZGIA 1A5IA 3SGQE 1W14U 5GPIB 1BTWA 1GPZA 2OQUA 1UTNA 3ODDA 1E0FD 1EB2A 1GBLA 1Y3YA 4K5ZA 1GMCF 1AHTH 4O03A 1C4Y2 1KTSB 1IQLA 1H4WA 4ZKRU 4BAHB 4AFZA 3SGBE 1CHOF 4BAKB 2H6MA 1P0SH 2EI8A 1V2TT 1SGDE 1QL9A 2R2MB 4ISIH 3TJUA 2ZU1A 5ABWA 2NU0E 3BV9B 4RKJB 2QGRA 1O2TA 2ZWLH 1MTSA 2G5NA 3VEQB 1FY4A 5HGGA 2I6QA 3O8BA 1FPCH 6CHAB 1O2LA 3LGIA 1E35B 1O2SA 3ZZ3A 5C67A 3BTQE 4NCYA 1P2QA 3KEEA 4NSVA 3UFAA 2XNIA 2ZFRH 4ABEA 3A80A 5TCAA 2Y5FA 3BTHE 1DVAH 2P3UB 2ZFFH 2ZU2A 3Q3XA 1TNLA 3PM3A 1A0LA 4R8TB 3FFGA 1UCYK 1C5SA 1C5PA 1TA6A 1VITF 4ZKOU 4IBLH 1AZZA 2JETC 1ZMLA 1XUHA 1LHGH 5AHGH 1P2OA 2BVRH 1YCPM 4MQAA 1BDAA 4ISHH 4B74A 3R3GB 3OY6U 1XMNB 2CJIA 1EAXA 3T26A 3ATKA 3LJOA 5SGAE 4HI3A 1FV9A 1AWHB 2OBOA 3RXBA 1PQ8A 1C1PA 2VIOA 1HAGE 1O2MA 1RXPA 4NZQA 1U6QA 5H4IB 1DANH 1AI8H 2BD7A 1DLKB 4AFUA 4I8GA 5A0CA 4Q7XA 3QO6A 3UUZA 3M3VA 1AVXA 1SGCA 4CRDA 1P01A 3SV7A 7GCHG 2A7CA 2FO9A 1DSTA 5T6FA 5FCRA 3C27B 4D7FA 3F6UH 4NSYA 5C5OA 3MTYA 3MU5A 3PWCA 1MTWA 2CGAA 2VU8E 1L1JA 1WUNH 2AGIX 3LPRA 1TA2A 3IITA 4JK6A 1C2HA 3Q77A 2FOEA 5C5NA 1ABIH 3PLBA 3P92A 3D62A 1Y5AT 1QBVH 4ZXYH 1TIOA 1FY3A 1DWDH 1GHXH 5GXPA 1GHBF 3V0XA 1C2GA 1YKTA 2AERH 4XDEA 4LK4A 3OY5U 1KDQB 3KQBA 3UQVA 1VJAU 1S0QA 3GCOA 1ORFA 4FUHA 1QRZA 1FPHH 2WPKS 3QN7A 2YNBA 4JZDH 5GDSH 2A2XH 3PYHA 1HGTH 1QTFA 3ZVCA 4OGYA 5K0HA 1O3AA 1PPBH 2QXGA 2C8XB 4X6PA 1BMMH 1TPPA 2C8WB 2A31A 1AWFH 4DW2U 1ELCA 2Z6BD 3QWCH 1HDTH 1MD7A 2Y5GA 2GP9B 1V2LT 2HOBA 3BEUA 4GPGA 2F83A 1O3HA 3BTTE 1GBEA 4X2YA 1FMGA 2AYWA 3A7YA 1B7XB 1H9HE 1BTZA 2ZHQH 1O2XA 2A4GA 4FUIA 2RCEA 3S0NA 1TWXB 1BTXA 1DXWA 2A1DB 2A32A 1W3CA 1SGFA 1AVWA 1E34B 4HGCA 4JK5A 2Q6GA 3PB1E 4X8VH 2ODQA 4AG2A 2K1QA 3HATH 3DHKH 2PV9B 2QXHA 1A0JA 3Q3YA 1O3NA 3TK5A 1SGIB 3SUEA 1W10U 3LGVA 1IQIA 4MNWA 1CT2E 4CRFA 4BTUB 1MBQA 2ZGBH 3FP8E 2ODYB 2GZ7A 1TRYA 1GBBA 1GJ7B 2W3KA 4GCHG 2W3IA 1P9UA 1O5EH 4AOQA 4TYDA 5A8XA 1A2CH 5DP5A 1AN1E 2VWLA 3RXAA 1C9TA 1JMOH 2FYQA 3ATLA 3MNXA 1QY6A 1O2JA 3EE0B 2C4FH 3P70B 2ZGCA 3VFEA 4NIWA 3DFJA 1RGQA 1AKSA 1M9UA 1TQ0B 5C1XA 1C5VA 3M5NA 1VITH 3PMAB 3EA9A 1DFPA 2OC8A 3MI4A 2XBYA 1WOFA 4MPVA 1B5GH 3U9AH 3PV4A 3QDZB 4MNVA 1B0FA 1ZZZA 1KXBA 1EP5A 2ZPRA 1JOUB 4K1SA 1H9IE 3RXHA 3SU5A 3M5MA 4DURA 5EGMA 2PTCE 1SOTA 4OS5A 2V0BA 1HPGA 1GMDF 3V7TA 3TK9A 1UJ1A 3PMBB 2C90B 4NIYA 3ZVGA 3F9HA 3SV6A 4Y8XA 1GBTA 1QHRB 1SOZA 1W0ZU 3RXTA 3VB7A 8GCHG 2IN2A 3W94A 6CHAC 2FYRA 1BBRH 1RJXB 3ZYEA 4DT7B 2BD3A 4D76A 4Q7ZA 1V2VT 2A5AA 3DFLA 2ZU5A 2GDDA 4Y10E 2G52A 5EU8A 4O3UA 1ZRBA 1C2KA 3I78A 3B9FH 3O8DA 1YPJH 1AFQB 3PO1B 5L2ZH 2VJ1A 4WH8A 4Y7AA 1C5RA 2XC0A 2Z3DA 3OYPA 1Z1IA 3MNSA 6LPRA 5EOKA 1UTJA 3WY8A 1OYQA 4WMDA 1F0RA 2FX6A 1G2LA 1K1MA 3EA8A 3QTVH 5JYIA 4KTCA 5DJ7A 1Z6EA 1GHVH 3BIUH 1BA8B 4FUDA 1THRH 1YPKH 2THFB 1HXFH 2XYAA 4X8SH 1YLDA 3URCA 5CHAB 1ELGA 5BRRE 4X0WU 1W12U 1SC8U 1GHYH 2ZIQH 3NCLA 3GCTF 1EAWA 1AQ7A 5AF9H 1AUJA 1YPMH 3PLPA 1L0ZA 1ZSLA 1BTHH 2Z9JA 2VWOA 4ISNA 3LGUA 4FVDA 2P59A 1ZR0A 1SGRE 1LVMA 4X1NU 5F8ZA 1E36B 1A61H 1BHXF 5GJ4B 1O5BB 1DUEA 3CENA 1DM4B 1TBZH 4O3TA 4XE4A 3FZZA 2SGFE 3Q76A 1SPJA 1XX9A 2HNTC 4FUFA 4XOJA 4K2YA 2G81E 1NRSH 2P95A 1J14A 1WTHD 3SNDA 1V2PT 2BLVA 3SJ8A 3M61U 1JRSA 4B2BA 3M37A 3T62A 4NA7A 1YYY1 1NTPA 2AMPA 1MQ6A 1SVPA 1TNHA 3FANA 4A1TA 1MKXH 5J4QA 3URDA 2GT7A 2BQWB 2ASUB 1G36A 1UTLM 1A3EH 1N6XA 1SFQB 5EW2H 4HTCH 1DPOA 1IHSH 4Q7YA 5JDUB 1EOLA 1TNIA 1GBFA 1MUEB 3MMGA 1UTPA 4AZ2B 1WCZA 1QJ6B 3VGCB 1LPGB 3MNCA 2XW9A 4X1PU 3MHWU 4IC6A 1T31A 4I33A 4U32A 2A0QB 3SUGA 1GGDB 1XKBC 4DIIH 4AYVB 3Q00A 1KXCA 1TX6A 1C1WH 4JZEH 1TABE 1PQ5A 2KAIB 1QA7A 3RXPA 3KGPA 2LNCA 2XTTB 1G37A 1UK2A 2WPIS 4UEHH 2FESH 1PPZA 1Z1JA 3A7TA 3KIDU 1W7XH 2ZFTA 2BXUH 3RP2A 1HCGA 4Z6AH 5JB8S 2ZEBA 1KLTA 3BSQA 1KSNA 1OXGA 4FXGH 1O3PB 3TH4H 1HUTH 2R3YA 4Y6DA 4INLA 1AB9B 2FOCA 1LDTT 4AYYB 1F7ZA 5FBIA 1V2ST 4MPXA 2ZECA 3FZDA 3BTEE 3GISB 4CR5A 3TU7H 5FAHA 2ZPSA 3GCHB 1X7AC 1ETSH 4AFSA 3SV8A 2PR3A 2FOMB 1A46H 2JKHA 1GHAF 5JBBS 1GBIA 3SJIA 3TJNA 2OXSA 1P57B 1HAVB 1ELVA 1F0SA 3U1IB 1K21H 1EZSC 2PHBA 1O2VA 5EQQA 3VB6A 1TGBA 5HMAA 3BTFE 2JH5D 3RMNH 1NESE 1ZHPA 4Y79A 2WPLS 2H9EH 3P95A 3PTBA 2A5KA 3NWUA 5CMXH 2TRMA 1BCUH 2BDAA 4RN6A 1O2UA 4IN2A 3ZVDA 1G3CA 2DE9A 1O5CB 3E6PH 3UWIA 1P04A 3F9GA 5TJXA 4GSOA 1UVPA 4ABDA 1EOJA 2O8LA 1C5UA 3RXVA 1EPTB 2UUJB 1V2NT 4AFQA 3DUXH 2ZI2H 2ZHWH 3LDXH 1RFNA 3M36A 1G3DA 1Z8IB 1AFQC 3PO1C 1CGJE 3P6ZB 1NC6A 4A6LA 3SJ9A 1TB6H 1GMCG 1WU1A 4UE7H 4A7IB 1PQAA 2VGCB 5G4BA 5BPEA 3RC6A 1CHOG 1NN6A 3GICB 2F9OA 1FY5A 1O3MA 5C20A 1Y59T 3AASA 5JBCS 1S85A 2ZCKP 1ZSJA 1E37B 4NFFA 1C2IA 2GVFA 4MDSA 1NFUA 5F6MA 3KNXA 1KY9A 1SLUB 4GAWA 1FI8A 5L30H 1O3CA 5LPRA 1HAOH 1O3EA 3U69H 3SI3H 3ZZBA 3LJJA 1CU1A 5CHAC 4E7RG 2GCTB 1PPFE 1TX7A 3KQCA 5PTPA 4BXSA 1C1TA 4MNXA 3ZZ4A 2VB0A 1GCTB 1CT0E 2WUCA 4KTSA 1TMTH 2BY5X 1ELDE 3I77A 2PSXA 1GI9B 2QA9E 2SNVA 2AMQA 1VITG 3AVZA 3KN2A 1LCYA 1MAXA 1T8MA 1WQVH 1YM0A 2BDYA 3OSYA 1KLIH 2BQ7B 1S81A 5DP4A 1CBWB 4JYTA 1K28D 1CVWH 3U1JB 1QB9A 3VXEH 1V2OT 1BJVA 2F9VA 2H9HA 2IOTA 4BTTB 2Y81A 1PYTD 1MH0A 1V2RT 5GCHG 2H2ZA 1GI1A 1ELBA 2XRCA 3TGJE 1CQQA 3BTDE 1TQ7B 3EDXB 2VNTA 1HAHH 1OS8A 2WUBA 2QF0A 1EJMA 1T4VH 2ZG0H 3MWIU 1QBNA 2TGAA 8KME2 2KAIA 1CGIE 2FOFA 1O2OA 4A92A 2DUCA 2R0KA 1JWTA 1D3PB 1ZHRA 1UHBB 1NS3A 2EI6A 5FPYA 3RXMA 1O39A 3SJKA 5JB9S 2ZZUH 2FI4E 3UR9A 2TIOA 5HM2A 1O2GH 1W11U 3VPKA 1ZPZA 3OU0A 3S9BA 3TGKE 1NFWA 3BTKE 1NRNH 3A7ZA 3H7TA 3DD2H 4F4OC 1A1RA 1UCYE 2BD2A 2GT8A 2TPIZ 4ZUHA 1ZTKA 3RU4D 3VGCC 3ZZAA 3M5LA 3M3TA 3LIWA 2QC2A 1P2JA 1GGDC 4RSPA 4A1VA 1E38B 1L1GA 1Y3XA 1Z8JB 2ZP0H 4WXVA 3LC5A 1GVLA 4LZ1H 1XVMA 3T27A 1A3BH 3LC3A 1GHBG 2ZGJA 1MMJN 3SU4A 1C1VH 2CF8H 1OWJA 1EXFA 1FY8E 1AU8A 1SLVB 2QN5T 2A7HA 2OUAA 2WV4A 4X2WA 4AB9A 1NT1A 5GIBA 1JRTA 1C1RA 1PJPA 2VWNA 1QRWA 1MZDA 2SGEE 2HNTE 4K69A 2VWMA 1ID5H 1PQ7A 2F9PA 1BMLA 1VCQA 2D8WA 3RXUA 1HAVA 4ISOA 1HIAA 1ACBE 1MKWK 1IQNA 1CO7E 1YCPK 3SQHE 1O2PA 1AB9C 2YNAA 4NG9H 2BY9X 3A8CA 4FUCA 4Q80A 3O8CA 1YLCA 2QAAA 4FUEA 4U2WA 3V13A 4AG1A 2A4RA 5DPAA 2AS9A 5ESBA 2V3OH 3RXJA 3S69A 4Y76A 3TH3H 4X6MA 1FXYA 1O2WA 3NUMA 3MFJA 1S84A 2ZTXA 2HPPH 2BD9A 1GBCA 2P94A 2OP9A 1SGFG 1N6YA 2R3UA 2XBVA 2G4UA 3RMMH 3RXLA 3QX5H 4ABFA 5LGOA 2PUQH 2V3HH 3M3SA 1VZQH 1ZMNA 1THSH 1JIMA 1XKAC 1A0HB 3MO3A 4M7GA 1ESAA 3E1XB 2GKVE 4X2VA 1QURH 2ZO3H 1JBUH 5AVDA 3RMLH 1O2YA 2ZCLP 3LOXA 4YO9A 1EPTC 1O5AB 4X6OA 3RXDA 2OC1A 5FBEA 2BDIA 1G32B 1C1MA 2FI5E 1W2KH 1C5LH 3ZV9A 1T8OA 4HZHA 2EC9H 1FIZA 1GDNA 2FI3E 1NRPH 2D1JA 1HNEE 1GDUA 1AO5A 2AGGX 1DDJA 4WVPE 1OX1A 2EI7A 1RTKA 2ZCHP 1KLJH 1ZSKA 1GJ9B 1YPLH 1IQHA 4NWLA 2VGCC 1O36A 1HB0B 1SGQE 1LVYA 1TPAE 1ZOMA 1GDQA 1KTTB 1PPHE 3M35A 1V2WT 1EKBB 1MU8B 1DX5M 1O33A 1C2EA 3F9EA 1XUFA 4YESB 7GCHF 4OS4A 2CHAB 4FUBA 2BX3A 4WF8A 3N7OA 1J8AA 1GBKA 4VGCB 5T6GA 2VVCA 2P3TB 2GCTC 2OINA 1C5YB 3MNBA 1O30A 2V35A 3MO6A 2O8WA 2H9TH 4MPUA 1IQGA 1O2RA 1CHGA 3NPSA 4DCDA 3SI4H 2BZ6H 4IN1A 1QGFA 1GCTC 2R2WU 2F3CE 1DE7H 1O2NA 1RTFB 1S6HA 3MH6A 5C3NA 1BMAA 4TWYA 2PKAB 3BF6H 5A8YA 5DKMA 1SLWB 5CE1A 4JMYA 1K22H 1GI0A 2FODA 2XCNA 1N8OB 2JH6D 2WYGA 4TWWA 3TLOA 1O3BA 3HPTB 1ZJKA 5EQRA 4FUJA 3EAJA 1P8VC 1BTYA 3T25A 2GCHF 5I46H 3GY2A 1Y3WA 2QY0B 3M7TA 3ATIA 3BTGE 2PWXA 1MZAA 1QIXB 1TMBH 1FLEE 1OOKB 2ESTE 1KXEA 1UTQA 5A8ZA 4RKOB 4JZ1A 4X1QU 3S9AA 3QK1A 5JBAS 1QCPA 3KHVA 1AMHA 1Y8TA 1GMHF 2YOLA 1YPEH 3FP7E 3A85A 2SGAA 2TGTA 3QLPH 4WY3A 1ZHMA 1QL8A 5C1UA 3BTME 2HALA 5E0HA 2ZFQH 5T3HA 1LKBA 1YPHC 1TX8A 4Y8YA 8ESTE 1C1UH 2WINI 2BM2A 1MBMA 4OS7A 2Z9LA 1YPGH 1DWEH 2FX4A 2BOHB 9ESTA 1AFEH 3MH4A 1DS2E 1TRMA 1IAUA 2QIQA 1Y3VA 1DWCH 3QZRA 3VB3A 3RU4E 1MTUA 1BB0B 4I32A 4YM9A 5J4SA 1L1NA 1T8NA 1WBGB 1D4PB 1VCWA 4Y8ZA 3ZZ8A 1VCPA 3BTWE 4ABJA 4GCHF 3E0NB 3E90B 1EQ9A 4I8HA 3PTNA 2WPHS 1TNKA 1V3XA 3D65E 3A83A 3TNTA 1GJ8B 4XFQA 2A5IA 2GDEH 3GDSA 2XXLA 5T6DA 4MPWA 1D6RA 1DY8A 1AIXH 3QGJA 1XXDA 2FEQH 2XC5A 4NIXA 4YOGA 1O5GH 3A84A 1SGTA 4IW4E 2BY6X 5EXMA 2HNTF 4BAMB 2FS8A 3A8DA 4I8KA 1KDQA 2Z9GA 3TPIZ 1F2SE 2GZ9A 2ZDVH 2ALVA 4MLFB 2ZNKH 2FMJA 4GVUA 2BD8A 3GCNA 4WXIA 1T32A 2IJOB 3UOUA 1BUIA 1OWEA 1SI5H 4YLQH 1O2HA 3JZ2B 3A88A 3VB5A 3ZV8A 1WAYB 3RXCA 3E0PB 4ASHA 1NFYA 4B73A 4OGXA 1UK4A 5DP6A 2RG3A 2ULLA 2JH0D 3M5OA 2ZC9H 3SNBA 3ZVAA 3T28A 1F0UA 1SQTA 1OSSA 4F49A 1HAYB 2ZFSA 2W26A 1KYNA 3MH7A 2QXIA 3RXKA 3SW2B 1DOJA 4Z0KA 1DXPA 1T8LA 3B8JA 1SHHB 1GJDB 1VGCB 3TVJB 1V2QT 1TBQH 1P09A 3K6ZA 4H6SB 5JPMH 1OYTH 2ZDKA 5F8TA 1EASA 1GJ4H 7KMEH 4XBBA
chains in the Genus database with same CATH superfamily
1UMAH 1OWHA 3UY9A 1SFIA 4OS6A 1GHAG 4K1TA 2BXTH 3A89A 4AN7A 4CBOA 1EZXC 5A09A 2W7SA 1F5LA 2GV7A 1F92A 1NO9H 4B76A 4J1YA 1Y3UA 2ZQ2A 1GI4A 4JZFH 1XUKA 4D7GA 3A7XA 3BEIB 1GJ6A 1O5FH 1NZQH 2G5VA 1INCA 1HRTH 4KELA 2VIQA 1KXAA 2AGEX 1SSXA 3DSPA 2CHAC 4Y71A 1K1OA 1TOCB 2Z7FE 3P17H 2WYJA 1C2JA 1FN8A 2PGBB 6GCHF 1GBHA 5DO4H 2NWNA 4VGCC 4K8BA 3RMOH 3ZZDA 1GJBB 4I8JA 1OHHD 3NRLA 5FCKA 1CA0B 1EAUA 1SL3A 3F3BA 2ZTYA 1O31A 4KTUA 3TGIE 1BRAA 2EEKA 3HGNA 4ABAA 2GJGA 3KQEA 1W13U 4SGBE 1P2IA 1P2KA 4AX9H 2RDLA 2QF3A 3A8BA 3E16B 3A7WA 4FU9A 4UONA 1THPB 1ELEE 2Y7ZA 4MVNA 1SGPE 2J98B 1DITH 3RXGA 1OP0A 4DY7B 4ESTE 1XUGA 3U98H 1N8OC 1RIWB 1BZXE 1BBRK 1OWDA 4TY7A 3WW7A 2RA3A 1CA8B 1P02A 1GJ5H 2BMGB 1NPMA 2EA3A 4FOUC 1TGSZ 2CF9H 4UFDH 3RC4A 2HPQH 1MTNB 3A81A 1UCYH 5E8EH 2ZDMA 2VINA 3K2UA 3OEED 3M7UA 1W8BH 3ENSB 2AIPA 1Z8GA 2CN0H 1LTOA 1NROH 1SGYE 2ZA5A 2C93B 2WPJS 1O3OA 4NA9H 3TITA 5A0BA 1C5OH 4ZROA 4YZUA 2F4LA 2FZZA 1ANCA 5ESTE 2PGQB 2PTNA 2P3FH 4AB8A 1L2EA 4U30A 2B0FA 1BMNH 1BTUA 3UNQA 3V3MA 1BJUA 3LKWA 1DICA 2QE7D 1H8DH 1MKWH 2OD3B 1ARCA 4GLYA 1DUAA 2F43B 2ZGHA 1Q31A 3N7DA 2J4IA 1SQOA 5FPSA 2CV3A 1ZJDA 3SHCH 4ZCNA 1HBTH 2V6NA 3CP7A 4FVBA 3GYMA 2HWLB 3PLKA 3RXIA 4GUXA 2FOAA 1B0EA 2J94A 2M5TA 1GHZA 1EZUC 3UNSA 1BMFD 2Y6TA 3TJOA 2STAE 1KIGH 2UUKB 2KX4A 1SGEE 2ZU3A 3T2NA 4WMFA 1TNGA 1J15A 3PWBA 2KM0A 2WV5A 6ESTA 5I25A 2A7JA 2CMYA 5ETXA 3GS9A 2F9BH 4IS5A 2BLOA 2OLGA 1MD8A 1GBJA 2WV9A 4ZHAA 1ABJH 1AE8H 1P10A 3AW0A 4XBDA 1MKXK 1TPSA 1OP2A 1TRNA 4OS1A 3HK3B 1O5DH 3KQ5A 1LPKB 3BIVH 1L4ZA 3GYLB 3OFND 1BIOA 3R0FA 5HXFA 2BB4A 1HJ8A 4IGDA 1TGTA 3ZZ6A 2P16A 1J9CH 3ZZ7A 2Q6FA 4ACAA 4X2XA 2BQ6B 1GL1A 2RA0A 1JIRA 4X1RU 1AZ8A 1DWBH 2L6OA 3BN9A 1C1SA 2BDGA 2BDBA 2R0LA 4SGAE 3ZZ9A 3BG8A 3HK6B 2O8MA 5B6OA 2V3MA 1YBWA 1NRRH 3UTUH 1W7GH 3RC5A 4ZKNU 1O32A 4THNH 4NIVA 4MTBA 4NWKA 1ESTA 3K6YA 2J92A 4ZXXH 3SYJA 2KCAA 1C2LA 1NFXA 5E2PA 1VGCC 2FM2A 3DT0H 5FXLA 1HJAB 2BLWA 1O3DA 1YC0A 1MTVA 5DP9A 3PV5A 2F9UA 3JZ1B 3P8FA 1SG8B 3C1KA 1O3IA 1O3GA 1SBWA 5DK1A 1TNJA 1YF4A 1DY9A 3EYDA 2ODPA 1WYKA 2ZHDA 1F0TA 4I7YH 4YT6H 1FNIA 1GI7B 4ABGA 2BLQA 5EG4A 2BX4A 2FWWA 3W95A 1WV7H 2QCYA 1MAYA 1BRBE 1TPOA 2BOKA 3UQOA 2B8OH 1AGJA 1J16A 2H5DA 3MU4A 2QV1A 1MU6B 1AKSB 1C2DA 4JZIA 3SV2H 4E7NA 1QR3E 5JBTA 2FDAA 1C2FA 1G2MA 1P06A 4X1SU 5F03A 4KGAA 3OTPA 1GBAA 4AC9A 1PFXC 1PPCE 2Z3CA 3PRDA 1TAWA 3SQEE 4ZHLU 2BVXH 1FONA 1KXDA 3GOVB 3DA9B 1CA0C 1HFDA 4F55A 2J34A 1QNJA 2NU2E 3CS0A 4CHAB 2BY8X 1QRXA 1GBDA 3A87A 5EQSA 1D3QB 3L3TA 4FUGA 1C4V2 4Q4LA 4TY6A 1K9OE 1XUIA 4CH8B 2ZQ1A 4NA8A 4FU7A 1LQDB 2I6SA 3RXRA 7ESTE 2ZTZA 3D49H 1EJAA 1LPZB 1G3BA 1RIWC 5EPNA 2XWBI 1N1LA 3GCHC 5GCHF 5K7RA 4BNRA 3LH1A 1GG6B 7LPRA 3P8OA 4MNYA 4LOYH 1Z7KA 3RXFA 3FN8A 3HKJB 1FDPA 3RLWH 2AFQB 3SUFA 4DJZB 1ANBA 2AMDA 1EUFA 1YGCH 1GBMA 2ANKH 1NU7B 4D9RA 1EPTA 4DIHH 1AVGH 1LHCH 1MTNC 1QL7A 1TFXA 2VH0A 1A5HA 2ZPQA 5DG6A 3G01A 4J2YB 1LQEA 1EAIA 5HYOA 3DSOA 3SGAE 1ELAA 2GTBA 1ZLRA 2PKSB 2O8TA 1W0YH 2LPRA 1UTKA 2WSSD 4H6TA 4TT3D 3SU6A 3KF2A 3FVFB 1LHDH 3TIUA 4A1XA 1AUTC 3LGWA 3NKKA 4O97A 4B71A 1TALA 1IHTH 4WH6A 1EZQA 1TLDA 1V6DA 4AGJA 3SOSA 4K1EA 4B2CA 1LVBA 2P8OB 3UOPA 2C8ZB 4I8LA 5HM9A 1ETRH 1EP6A 2BZAA 3QZQA 3V12A 3LT3A 4ZMAH 1BHXB 3L6PA 4BAQB 1NRQH 2YMSD 1K1LA 2BTCE 3NK8A 5E2OA 1LMWB 1O3JA 4ZKSU 2XC4A 2HRVA 1GVKB 1RTLA 1GI2A 2XBXA 1Q2WA 3FP6E 5TCCA 1GJAB 3SUDA 2GCHG 4DVAU 1IQMA 2TGDA 3E3TA 1FQ3A 5DN6D 1WXRA 1K2I1 3SV9A 2BHGA 1S0RA 4UFFH 2TBSA 1GI6A 1KXFA 3ATWA 3SBKA 2PUXB 1IQJA 4XBCA 3LH3A 1GMHG 1GMDG 3SNAA 4BXWA 1O37A 1QA0A 2FIRH 4NZLA 1S83A 3UNRA 3I29A 1SGNE 1OPHB 2SGPE 3GY8A 5F53A 4YOIA 3LU9B 1XVOA 3LGTA 1C5QA 2VIDA 3U8RH 1EB1H 4Y0ZE 4YTAA 2H5CA 3GY4A 3OTJE 2WHXA 4WJG2 2FPZA 2PW8H 2J9NA 3QUMP 4ABBA 1CGHA 2J38A 3UREA 1QQUA 2FTMA 4CRAA 5L6NH 2HLCA 5L2YH 3PRBA 1TE0A 2DE8A 3U8TH 3SORA 1D6WA 1IQFA 1CE5A 1G9IE 2ANMH 2XBWA 1LKAA 3ESTA 4B2AA 1ELFA 1UHBA 1ZPCA 1SB1H 3MU8A 3OAAD 3AAVA 1WQSA 1AE5A 1CBWC 4R0IA 2UUYA 3KYGA 2ZDAH 1UVOA 4IC5A 1Y5UT 4GHQA 1OWKA 3GY6A 2J2UA 1BOQA 1Z6JH 3U28C 2C8YB 1IQEA 4X8UH 4YLUA 4K60A 1EX3A 2O8UA 3U8OH 4E06H 4GHTA 3O8RA 1T7CA 1UTOA 4LXBH 4UFEH 4Q2KA 1NM6A 2GV6A 5AFYH 1O2KA 3ZVBA 3OE7D 3GCTG 1ZYOA 1LHFH 2G4TA 4OS2A 4D9QA 3VXFH 1HJAC 3AK5A 3BG4B 2G51A 2K8IA 4K3JA 3SHAH 1IOEA 1SKYE 1C5MD 5FX6A 5EXLA 2B5TB 2NU4E 3TK6A 5LPFA 1C4U2 1GCDA 1ARBA 5KEDA 3Q3KA 1AY6H 2BD5A 3SU3A 4I31A 3A7VA 2GD4B 2OC0A 3RXEA 2FLRH 1C1OA 3F0PA 1HAIH 1WDIA 2G00A 1FZZA 2GMTB 3A8AA 3PMJA 1G30B 4JCNA 3SZNA 3STJA 1TYNA 3OX7U 1FAKH 2HVXA 1TMUH 1ZTJA 4INKA 2UUFB 5LPEA 1UTMA 1C1QA 4AGKA 2HGTH 2BYAX 2Z3EA 3ATMA 2FXRA 1QBOA 3ODFA 3GY3A 3LGYA 1OKXA 1O3LA 1P12E 1XUJA 3GDVA 1YP9A 1P3CA 1HAZB 4JYUH 4ZH8A 3RM0H 4CHAC 4NGAH 1BRCE 2Y7XA 5FPTA 1QB6A 2BDCA 3UIRA 1C9PA 1HAXB 1SLXB 1QB1A 3UR6A 3E8LA 5DP3A 2R9PA 3STIA 1QQ4A 3EQ0H 2Y80A 1H9LB 4DG4A 1RS0A 5FX5A 2G55A 1H8IH 9LPRA 2ANWA 1S6FA 5EW1H 4CRCA 2F91A 4CRGA 1GG6C 3HGPA 1TOMH 4AORA 4UDWH 4BAOB 2NU3E 3ELAH 5EXNA 5C94A 3ZZCA 1S82A 1JXPA 3S7HB 3K65B 1MCTA 1TGCA 3SU2A 5FL7D 2XCFA 3T5FH 1HAPH 4UFGH 2WPMS 2NU1E 3F9FA 3P8NA 6GCHG 1HJ9A 1P03A 5T1VA 1SQAA 3T29A 1O0DH 3NZIA 2TGPZ 2FP7B 3PMHB 2PKSC 2AEIH 4JYVH 3EA7A 3SO3A 4Y7BA 3SJOA 8GCHF 1GVZA 4H42U 1O34A 3ITIA 5IYTA 5EJLA 1XM1A 3F1SB 1K1IA 1HXEH 1T4UH 2GGVB 5FHTA 2SGQE 1QJ7B 3KL6A 1K1JA 4ZHMU 3CS7A 5EJZA 3ZVFA 1ETTH 2O9QA 2P8OC 2VIPA 1A7SA 1ESBA 4BANB 3SNEA 2BY7X 2OBQA 1UVTH 5GWZA 2OQ5A 2OCVB 1WSSH 2SNWA 3H7OA 2GX4A 2KFWA 2ILNA 1NY22 2RFKC 4E05H 1IQKA 1EATA 1GWAA 3E91A 3SU1A 1TGNA 1FUJA 3SU0A 1V2UT 1G3EA 4U01A 3P8GA 5DP8A 2VIVA 2VBCA 3DCLA 2ZKSA 3RU4T 2QYIA 3F68H 3SN8A 3GDUA 1UW7A 2BDHA 4X8TH 4KKDA 1O35A 1V2MT 4PROA 5EPYA 3TNSA 4CH2B 1SR5C 3FAOA 1RD3B 1P05A 2IJD1 2OC7A 2PKAA 1P11E 1BT7A 3MYWA 4Y11E 3GY5A 2AHME 2UWOA 3D23A 2W7UA 3KQDA 4XSKU 4INHA 2UWLA 5DP7A 2PFEA 5A2MH 1OP8A 1GHWH 3MU0A 1TONA 4FU8A 2VVUA 2PLXA 2Z9IA 1PPEE 1XXFA 4CRBA 3AW1A 1HLTH 2STBE 2Z9KA 2Z94A 2B9LA 2ZHFH 2ZF0H 1ANDA 2JETB 3VB4A 4B75A 1Y5BT 4DGJA 1BQYA 4HFPB 1O2ZA 2M2AA 4KP0A 1GJCB 3MOCA 3K9XB 4LZ4B 1P3EA 1SMFE 1BBRE 2FS9A 4FETA 1P2NA 3ZVEA 3S9CA 2BD4A 2F9NA 3S7KB 5F8XA 1SHYA 1LVOA 1AD8H 1VJ9U 3EGKH 1C5WB 4K8YA 2FOHA 1NU9A 1ZGVA 1Z8RA 3NXPA 1GI8B 1K1PA 4TPYA 1C2MA 1GL0E 1O38A 2C3SA 2GZ8A 1WTGH 4BTIB 4Y0YE 1Q3XA 1PPGE 2QXJA 4B1TA 1V2KT 5EODA 1CT4E 3RXQA 2D26C 1C5XB 2A2QH 2A45B 5C1YA 4IMQA 3H5CB 2Y5HA 2B7DH 4CREA 4RI0A 1ELTA 3MH5A 1OWIA 3IG6B 4BOHA 2SGDE 4WWYA 1HV7A 1GI5A 3GY7A 1A5GH 2ZU4A 3UWJH 1FJSA 1ZMJA 2VVVA 5E0GA 3RDZA 2G8TA 1MCVA 3LONA 4YOJA 8LPRA 2FOGA 1J17T 1HIAB 3BG4C 1L4DA 1S5SA 1FAXA 2ZFPH 4Z1MD 1FIWA 1ZPBA 2Q1JA 5AFZH 5C17A 2D2DA 2FLBH 4WMEA 5LH8A 3L33A 1C5ZB 3TH2H 2Q6DA 1F5KU 4O9VA 4TPIZ 1YCPH 1C5NH 1DLEA 3B23B 1BTPA 3RM2H 1BRUP 2FOBA 3PROA 1ZRKA 2H1UA 2SFAA 4A5TS 4D8NA 3MO9A 3N7EA 4ABHA 2GMTC 3RUOA 1CSOE 4NFEA 3QGNB 1F5RA 1HYLA 3MU1A 3KCGH 1V2JT 1C5TA 2VH6A 1GI3A 2IPHA 2FTLE 2PSYA 1UO6A 3M7QA 1LO6A 2UWPA 1QJ1B 4QT8C 4ABIA 1FN6A 5B6LA 1BITA 1QFKH 1D9IA 4DOQA 2Y82A 3BEFB 3IWMA 5IDKA 1ANEA 1K0HA 1PYTC 1UVUH 1UK3A 1TBRH 2A4OA 1MQ5A 1D3TB 1LHEH 1P2MA 3RLYH 4CR9A 5E0JA 1H1BA 4CBNA 1O3KA 4TSFD 4MG3A 2OTVA 2ANYA 3HKIB 2VIWA 3A82A 4H4FA 1A4WH 1EJNA 2XWAA 1FY1A 3A86A 1DSUA 2P93A 1C1NA 2ZGXH 4ISLA 5C2ZA 3AAUA 3UPEA 4YT7H 1P9SA 2ALPA 2ZHEH 3QTOH 2CXVA 2AH4X 1YPHE 3TJVA 1K1NA 3WWBA 3ZYDA 4ZAEA 1O2QA 2ZDLA 4F48B 2ZDNA 2BVSH 4UD9H 3ZZ5A 1D3DB 1RRKA 1Z71A 1VR1H 1O3FA 2J95A 4IMZA 3RXSA 3SNCA 1ZTLA 2W5EA 1O2IA 5A0AE 2AIQA 4X6NA 3RXOA 1DT2A 2A4QA 1UVSH 5DGJA 1ZGIA 1A5IA 3SGQE 1EFRD 1W14U 5GPIB 1BTWA 1GPZA 2OQUA 1UTNA 3ODDA 1E0FD 1EB2A 1GBLA 2XNDD 1Y3YA 4K5ZA 1GMCF 1AHTH 4O03A 1C4Y2 1KTSB 1IQLA 1H4WA 4ZKRU 3SZEA 4BAHB 4AFZA 2LP6A 3SGBE 1CHOF 4BAKB 2H6MA 1P0SH 2EI8A 1V2TT 1SGDE 1QL9A 2R2MB 4ISIH 3TJUA 2ZU1A 5ABWA 2NU0E 3BV9B 4RKJB 2QGRA 1O2TA 2ZWLH 1MTSA 2G5NA 2KCOA 3VEQB 1FY4A 5HGGA 2I6QA 2J98A 1FPCH 3O8BA 6CHAB 1O2LA 3LGIA 1E35B 1O2SA 3ZZ3A 5C67A 3BTQE 4NCYA 1P2QA 3KEEA 4NSVA 3UFAA 2XNIA 2ZFRH 4ABEA 2EY4C 3A80A 5TCAA 2Y5FA 3BTHE 1DVAH 2P3UB 2ZFFH 2ZU2A 3Q3XA 1TNLA 3PM3A 1A0LA 4R8TB 3FFGA 1UCYK 1C5SA 1C5PA 1TA6A 1VITF 4ZKOU 4IBLH 2JETC 1AZZA 1ZMLA 1XUHA 1LHGH 5AHGH 1P2OA 2BVRH 1YCPM 4MQAA 1BDAA 4ISHH 4B74A 3R3GB 1QZ8A 3OY6U 1XMNB 2CJIA 1EAXA 3T26A 3ATKA 3LJOA 5SGAE 4HI3A 1FV9A 1AWHB 2OBOA 2IPQX 3RXBA 1PQ8A 1C1PA 2VIOA 1HAGE 1O2MA 1RXPA 2V7QD 4NZQA 1U6QA 5H4IB 1DANH 1AI8H 2BD7A 1DLKB 4AFUA 4I8GA 5A0CA 4Q7XA 3QO6A 3UUZA 3M3VA 1AVXA 1SGCA 4CRDA 1P01A 3SV7A 7GCHG 2A7CA 3FKSD 2FO9A 1DSTA 5T6FA 5FCRA 3C27B 4D7FA 3F6UH 4NSYA 5C5OA 3MTYA 3FO8D 3MU5A 3PWCA 1MTWA 2CGAA 2VU8E 1L1JA 1WUNH 2AGIX 3ZIAD 3LPRA 1TA2A 3IITA 4JK6A 1C2HA 3Q77A 2FOEA 5C5NA 1ABIH 3PLBA 3P92A 3D62A 4B6EA 4ACBA 1Y5AT 1QBVH 4ZXYH 2WZQA 1TIOA 1FY3A 1DWDH 1GHXH 5GXPA 1GHBF 4P00A 3V0XA 1C2GA 1YKTA 2AERH 4XDEA 4LK4A 3OY5U 1KDQB 3KQBA 3UQVA 1VJAU 1S0QA 5DSFA 3GCOA 1ORFA 4FUHA 1QRZA 1FPHH 2WPKS 3OEHD 3QN7A 2YNBA 4JZDH 5GDSH 2A2XH 5HIYA 3PYHA 1HGTH 1QTFA 3ZVCA 4OGYA 5K0HA 1O3AA 1PPBH 2QXGA 2C8XB 4X6PA 1BMMH 1TPPA 2C8WB 2A31A 1AWFH 4DW2U 1ELCA 2Z6BD 3QWCH 1HDTH 1MD7A 2Y5GA 2GP9B 2XOKD 1V2LT 2HOBA 3BEUA 4RT0A 4GPGA 2F83A 1O3HA 3BTTE 1GBEA 4X2YA 1FMGA 2AYWA 3A7YA 1B7XB 1H9HE 1BTZA 2ZHQH 1O2XA 2A4GA 4FUIA 2RCEA 3S0NA 1TWXB 1BTXA 1DXWA 2A1DB 2A32A 1W3CA 1SGFA 1AVWA 1E34B 4HGCA 4JK5A 5IK2D 2Q6GA 3PB1E 4X8VH 2ODQA 4AG2A 2K1QA 5CDFE 3HATH 3DHKH 2PV9B 2QXHA 1A0JA 2HVYB 3Q3YA 1O3NA 3TK5A 1SGIB 3SUEA 1W10U 3LGVA 1IQIA 4MNWA 1CT2E 4CRFA 4BTUB 1MBQA 2ZGBH 3FP8E 2ODYB 2GZ7A 1E1QD 1TRYA 1GBBA 1GJ7B 2W3KA 4GCHG 2W3IA 1P9UA 1O5EH 4AOQA 4TYDA 5A8XA 1A2CH 5DP5A 1AN1E 2VWLA 3RXAA 5HKKD 1C9TA 2LELA 1JMOH 2FYQA 3ATLA 3MNXA 5EIYA 1QY6A 5HIZA 1O2JA 3EE0B 2C4FH 3P70B 2ZGCA 3VFEA 4NIWA 3DFJA 1RGQA 1AKSA 1M9UA 1TQ0B 5C1XA 1C5VA 3M5NA 5C0UA 1VITH 3PMAB 3EA9A 1DFPA 2OC8A 3MI4A 2XBYA 1WOFA 4MPVA 1B5GH 3U9AH 3PV4A 3QDZB 4MNVA 1B0FA 1ZZZA 1KXBA 1EP5A 1S6LA 1JOUB 2ZPRA 4K1SA 1H9IE 3RXHA 3SU5A 3M5MA 4DURA 5EGMA 2PTCE 1SOTA 4OS5A 2V0BA 1HPGA 1GMDF 3V7TA 3TK9A 1UJ1A 3PMBB 2C90B 4NIYA 3ZVGA 3F9HA 3SV6A 4Y8XA 1GBTA 1QHRB 1SOZA 1W0ZU 3RXTA 3VB7A 8GCHG 2IN2A 5CHBA 4I86A 3W94A 6CHAC 2FYRA 1BBRH 1RJXB 3ZYEA 4DT7B 2BD3A 4D76A 4Q7ZA 1V2VT 2A5AA 3DFLA 2ZU5A 2GDDA 4Y10E 2G52A 2JJ2D 5EU8A 4O3UA 1ZRBA 1C2KA 3I78A 3B9FH 3O8DA 1YPJH 1AFQB 3PO1B 1SQRA 5L2ZH 2VJ1A 4WH8A 1NBMD 4Y7AA 1C5RA 2XC0A 2Z3DA 3OYPA 1Z1IA 3MNSA 6LPRA 5EOKA 2KZ4A 1UTJA 3WY8A 1OYQA 4WMDA 1F0RA 2FX6A 1G2LA 1K1MA 3EA8A 3QTVH 5JYIA 4KTCA 5DJ7A 1Z6EA 1GHVH 3BIUH 1BA8B 4FUDA 1THRH 1YPKH 2THFB 1FX0B 4DT4A 1HXFH 2XYAA 4X8SH 1YLDA 3URCA 5CHAB 1ELGA 5BRRE 2J5UA 4X0WU 1W12U 1SC8U 1GHYH 2ZIQH 3NCLA 3GCTF 1EAWA 1AQ7A 5AF9H 1AUJA 1YPMH 3PLPA 1L0ZA 1ZSLA 1BTHH 2Z9JA 2VWOA 4ISNA 3LGUA 4FVDA 2P59A 1ZR0A 1SGRE 1LVMA 4X1NU 5F8ZA 1E36B 1A61H 1BHXF 5GJ4B 1O5BB 1DUEA 2W6ID 3CENA 1DM4B 1TBZH 4O3TA 4XE4A 3FZZA 2SGFE 3Q76A 3EE7A 1SPJA 1XX9A 2HNTC 4FUFA 4XOJA 4K2YA 2G81E 1NRSH 2P95A 1J14A 1WTHD 4XRNA 3SNDA 1V2PT 2BLVA 3SJ8A 3M61U 1YY3A 1JRSA 4B2BA 3M37A 3T62A 4NA7A 1YYY1 1NTPA 2AMPA 1MQ6A 1SVPA 1TNHA 3FANA 4A1TA 1MKXH 5J4QA 3URDA 2GT7A 2BQWB 2ASUB 1G36A 1UTLM 1A3EH 4XD7D 1E1RD 1N6XA 1SFQB 5EW2H 4HTCH 1DPOA 1IHSH 4Q7YA 5JDUB 1EOLA 1TNIA 1GBFA 1MUEB 3UB0A 3MMGA 1UTPA 4AZ2B 1WCZA 4RT1A 1QJ6B 3VGCB 1LPGB 3MNCA 2XW9A 4X1PU 3MHWU 4IC6A 1T31A 4I33A 4U32A 2A0QB 3SUGA 1GGDB 1XKBC 3H09A 4DIIH 4AYVB 3Q00A 1KXCA 1TX6A 1C1WH 4JZEH 1TABE 1PQ5A 1W0KD 2KAIB 5GNDA 1QA7A 3RXPA 3KGPA 2LNCA 2XTTB 1G37A 1UK2A 2WPIS 4UEHH 2FESH 1PPZA 1Z1JA 2KCYA 2CK3D 3A7TA 3KIDU 1W7XH 2ZFTA 2BXUH 3RP2A 1HCGA 4Z6AH 5JB8S 2ZEBA 1KLTA 1H8HD 3BSQA 1KSNA 1OXGA 4OM9A 4FXGH 1O3PB 3TH4H 1HUTH 2R3YA 4Y6DA 4INLA 2HLDD 1AB9B 2FOCA 1LDTT 4AYYB 1F7ZA 2YMSB 5FBIA 1V2ST 4MPXA 2ZECA 3FZDA 3BTEE 3GISB 4CR5A 2J97A 3TU7H 5FAHA 2ZPSA 3GCHB 1X7AC 1ETSH 4AFSA 3SV8A 1YWUA 2PR3A 1W0JD 3MQKC 2FOMB 1A46H 2JKHA 1GHAF 4M9FA 1GBIA 5JBBS 3SJIA 3TJNA 2OXSA 1P57B 5EJ1A 1HAVB 1ELVA 1F0SA 3U1IB 1K21H 1EZSC 2PHBA 1O2VA 5EQQA 3VB6A 1TGBA 5HMAA 3BTFE 2JH5D 3RMNH 1NESE 1ZHPA 4Y79A 2WPLS 2H9EH 3P95A 3PTBA 2A5KA 3NWUA 5CMXH 2TRMA 1BCUH 2BDAA 4RN6A 1O2UA 4IN2A 3ZVDA 1G3CA 2DE9A 1O5CB 3E6PH 3UWIA 1P04A 3F9GA 5TJXA 4GSOA 1UVPA 4ABDA 3N99A 1EOJA 2O8LA 1C5UA 3RXVA 1EPTB 2UUJB 1V2NT 4AFQA 3DUXH 2ZI2H 2ZHWH 3LDXH 1RFNA 3M36A 1G3DA 1Z8IB 1AFQC 3PO1C 1CGJE 3P6ZB 1NC6A 3F2HA 4A6LA 3SJ9A 1TB6H 1GMCG 2EQNA 1WU1A 4UE7H 4A7IB 2W6JD 1PQAA 2VGCB 5G4BA 5BPEA 3RC6A 1CHOG 1NN6A 3GICB 1NBME 2F9OA 1FY5A 1O3MA 5C20A 1Y59T 3AASA 5JBCS 1S85A 2ZCKP 1ZSJA 1E37B 4NFFA 1C2IA 2GVFA 4HG6A 4MDSA 1NFUA 5F6MA 3KNXA 1KY9A 1SLUB 4GAWA 1MABB 1FI8A 5L30H 1O3CA 5LPRA 1HAOH 1O3EA 3U69H 3SI3H 3ZZBA 3LJJA 1CU1A 5CHAC 4E7RG 2GCTB 1PPFE 1TX7A 3KQCA 5PTPA 4BXSA 1C1TA 4MNXA 3CNRA 3ZZ4A 2VB0A 1GCTB 1COWD 1CT0E 2WUCA 4KTSA 1TMTH 3F2FA 2BY5X 1ELDE 3I77A 3KYFA 2PSXA 1GI9B 2QA9E 2SNVA 2AMQA 1VITG 3AVZA 3KN2A 1LCYA 1MAXA 1T8MA 1WQVH 1YM0A 2BDYA 3OSYA 1KLIH 2BQ7B 1S81A 5DP4A 1CBWB 4JYTA 1K28D 1CVWH 3U1JB 1QB9A 3VXEH 1V2OT 1BJVA 2F9VA 2H9HA 2IOTA 4BTTB 2Y81A 1PYTD 1MH0A 1V2RT 5GCHG 2H2ZA 1GI1A 1ELBA 2XRCA 3TGJE 1CQQA 3BTDE 1TQ7B 3EDXB 2VNTA 1HAHH 1OS8A 2WUBA 2QF0A 1EJMA 1T4VH 2ZG0H 3MWIU 1QBNA 2TGAA 2RDEA 8KME2 2KAIA 1CGIE 2FOFA 1O2OA 4A92A 2DUCA 2R0KA 1JWTA 1D3PB 1ZHRA 1UHBB 1NS3A 2EI6A 2QF4A 5FPYA 1O39A 3RXMA 3SJKA 2ZZUH 5JB9S 2FI4E 3UR9A 2TIOA 5HM2A 3PV2A 1O2GH 1W11U 5KGOA 3VPKA 1ZPZA 3OU0A 3S9BA 3TGKE 1NFWA 3BTKE 1NRNH 3A7ZA 3H7TA 3DD2H 4F4OC 1A1RA 1UCYE 2BD2A 2GT8A 2TPIZ 4ZUHA 1ZTKA 3RU4D 3VGCC 3ZZAA 3M5LA 3M3TA 3LIWA 2QC2A 1P2JA 1GGDC 4RSPA 4A1VA 1E38B 1L1GA 1Y3XA 1Z8JB 2QF5A 2ZP0H 4WXVA 3LC5A 1GVLA 4LZ1H 1XVMA 3T27A 1A3BH 3LC3A 1GHBG 2ZGJA 1MMJN 3SU4A 1C1VH 2CF8H 1OWJA 4ASUD 1EXFA 1FY8E 1AU8A 1YLNA 1SLVB 2QN5T 2A7HA 2OUAA 2WV4A 4X2WA 4AB9A 1NT1A 5GIBA 1JRTA 1C1RA 1PJPA 2VWNA 1QRWA 1MZDA 2SGEE 2HNTE 4K69A 2VWMA 1ID5H 1PQ7A 2F9PA 1BMLA 1VCQA 2D8WA 3RXUA 1HAVA 4ISOA 1HIAA 1ACBE 1MKWK 3DSGA 1IQNA 1CO7E 1YCPK 3SQHE 1O2PA 1AB9C 2YNAA 4NG9H 2BY9X 2YMSC 3A8CA 4FUCA 4Q80A 3O8CA 1YLCA 2QAAA 4FUEA 4U2WA 3V13A 4AG1A 2A4RA 5DPAA 2AS9A 5ESBA 2V3OH 3RXJA 3S69A 4Y76A 3TH3H 4X6MA 1FXYA 1O2WA 3NUMA 3MFJA 1S84A 2ZTXA 2HPPH 2BD9A 1GBCA 2P94A 2OP9A 1SGFG 1N6YA 2R3UA 2XBVA 2G4UA 3RMMH 3RXLA 3QX5H 4ABFA 5LGOA 2PUQH 2V3HH 3M3SA 1VZQH 1ZMNA 4P02A 1THSH 3VG8A 1JIMA 1XKAC 1A0HB 4YXWD 3MO3A 4M7GA 1ESAA 3E1XB 2GKVE 4X2VA 1QURH 2ZO3H 1JBUH 5AVDA 3RMLH 1O2YA 2ZCLP 3LOXA 4YO9A 1EPTC 1O5AB 4X6OA 2KCPA 3RXDA 2OC1A 5FBEA 2BDIA 1G32B 1C1MA 2FI5E 1W2KH 1C5LH 3ZV9A 1T8OA 4HZHA 2EC9H 1FIZA 1GDNA 2FI3E 1NRPH 2D1JA 1HNEE 1GDUA 1AO5A 2AGGX 1DDJA 4WVPE 1OX1A 2EI7A 1RTKA 2ZCHP 1KLJH 1ZSKA 1GJ9B 1YPLH 1IQHA 4NWLA 2VGCC 1O36A 1HB0B 1SGQE 1LVYA 1TPAE 1ZOMA 1GDQA 1KTTB 1PPHE 3M35A 1V2WT 1EKBB 1MU8B 1DX5M 3F2GA 1O33A 1C2EA 3F9EA 1XUFA 4YESB 7GCHF 4OS4A 2CHAB 4FUBA 2BX3A 4WF8A 3N7OA 1J8AA 1GBKA 4VGCB 5T6GA 2VVCA 2P3TB 2GCTC 2JIZD 1C5YB 2OINA 1O30A 2V35A 3MNBA 3MO6A 2O8WA 2H9TH 4MPUA 1IQGA 1O2RA 1CHGA 3NPSA 4Q63A 4DCDA 3SI4H 2BZ6H 4IN1A 1QGFA 1GCTC 2R2WU 2F3CE 1DE7H 1O2NA 1RTFB 1S6HA 3MH6A 5C3NA 1BMAA 4TWYA 2PKAB 3BF6H 5A8YA 5DKMA 1SLWB 5CE1A 4JMYA 1K22H 1GI0A 1E79D 2FODA 2XCNA 1N8OB 2JH6D 2WYGA 4TWWA 3TLOA 1O3BA 3HPTB 1ZJKA 5EQRA 4FUJA 3EAJA 1P8VC 1BTYA 3T25A 2GCHF 5I46H 3GY2A 1Y3WA 2QY0B 3M7TA 3ATIA 3BTGE 2PWXA 1MZAA 1QIXB 1TMBH 1FLEE 1OOKB 2ESTE 1KXEA 1UTQA 5A8ZA 4RKOB 4JZ1A 4X1QU 3S9AA 3QK1A 5JBAS 1QCPA 3KHVA 1AMHA 1Y8TA 1GMHF 2YOLA 1YPEH 3FP7E 3A85A 2SGAA 2TGTA 3QLPH 4WY3A 1ZHMA 1QL8A 5C1UA 3BTME 2HALA 2KR7A 2ZFQH 5E0HA 5C0TA 2JDID 5T3HA 1LKBA 1YPHC 1TX8A 4Y8YA 8ESTE 1C1UH 2WINI 2BM2A 1MBMA 4OS7A 2Z9LA 1YPGH 1DWEH 2FX4A 2BOHB 9ESTA 1AFEH 3MH4A 1DS2E 1TRMA 1IAUA 2QIQA 2PP6A 1Y3VA 1DWCH 3QZRA 3VB3A 3RU4E 1MTUA 1BB0B 4I32A 4YM9A 5J4SA 1L1NA 1T8NA 1WBGB 2WPDD 1D4PB 2L74A 1VCWA 4Y8ZA 3ZZ8A 1VCPA 3BTWE 4ABJA 4GCHF 3E0NB 3E90B 1EQ9A 4I8HA 3PTNA 2WPHS 1TNKA 1V3XA 3D65E 3A83A 3TNTA 1GJ8B 4XFQA 2A5IA 2GDEH 3GDSA 2XXLA 5T6DA 4MPWA 1D6RA 3WWFA 1DY8A 1AIXH 3QGJA 1XXDA 2FEQH 2XC5A 4NIXA 4YOGA 5KECA 1O5GH 3F0OA 3A84A 1SGTA 4IW4E 2BY6X 5EXMA 2HNTF 4BAMB 2FS8A 3A8DA 4I8KA 1KDQA 2Z9GA 3TPIZ 2JJ1D 1F2SE 2GZ9A 2ZDVH 2ALVA 4MLFB 2ZNKH 2FMJA 4GVUA 2BD8A 3GCNA 4WXIA 1T32A 2IJOB 3UOUA 1BUIA 1OWEA 1SI5H 1H8ED 3FOAA 4YLQH 1O2HA 3JZ2B 3A88A 3VB5A 3ZV8A 3W1EA 1WAYB 3RXCA 3E0PB 4ASHA 1NFYA 4B73A 4OGXA 1UK4A 5DP6A 2RG3A 2ULLA 2JH0D 3M5OA 2ZC9H 3SNBA 3ZVAA 3T28A 1F0UA 1SQTA 1OSSA 4F49A 4B6FA 1KMHB 2K0QA 1HAYB 2ZFSA 2W26A 1KYNA 3MH7A 2QXIA 3RXKA 3SW2B 1DOJA 4Z0KA 2OK5A 1DXPA 1VKYA 1T8LA 3B8JA 1SHHB 1GJDB 1VGCB 3TVJB 1V2QT 1TBQH 1P09A 3K6ZA 4H6SB 5JPMH 1OYTH 2ZDKA 5F8TA 1EASA 1GJ4H 3UAIC 7KMEH 4XBBA
chains in the Genus database with same CATH topology
1UMAH 1OWHA 3UY9A 1SFIA 4OS6A 1GHAG 4K1TA 2BXTH 3A89A 4AN7A 4CBOA 1EZXC 5A09A 2W7SA 1F5LA 2GV7A 1F92A 1NO9H 4B76A 4J1YA 1Y3UA 2ZQ2A 1GI4A 4JZFH 1XUKA 4D7GA 3A7XA 3BEIB 1GJ6A 1O5FH 1NZQH 2G5VA 1INCA 1HRTH 4KELA 2VIQA 1KXAA 2AGEX 1SSXA 2CHAC 4Y71A 1K1OA 1TOCB 2Z7FE 3P17H 2WYJA 1C2JA 1FN8A 2PGBB 6GCHF 1GBHA 5DO4H 2NWNA 4VGCC 4K8BA 3RMOH 3ZZDA 1GJBB 4I8JA 5FCKA 1CA0B 1EAUA 1SL3A 2ZTYA 1O31A 4KTUA 3TGIE 1BRAA 2EEKA 3HGNA 4ABAA 3KQEA 1W13U 4SGBE 1P2IA 1P2KA 4AX9H 2RDLA 2QF3A 3A8BA 3E16B 3A7WA 4FU9A 4UONA 1THPB 1ELEE 2Y7ZA 4MVNA 1SGPE 1DITH 3RXGA 1OP0A 4DY7B 4ESTE 1XUGA 3U98H 1N8OC 1RIWB 1BZXE 1BBRK 1OWDA 4TY7A 2RA3A 1CA8B 1P02A 1GJ5H 2BMGB 1NPMA 2EA3A 1TGSZ 2CF9H 4UFDH 3RC4A 2HPQH 1MTNB 3A81A 1UCYH 5E8EH 2ZDMA 2VINA 3K2UA 3M7UA 1W8BH 3ENSB 2AIPA 1Z8GA 2CN0H 1LTOA 1NROH 1SGYE 2ZA5A 2C93B 2WPJS 1O3OA 4NA9H 3TITA 5A0BA 1C5OH 4ZROA 4YZUA 2FZZA 1ANCA 5ESTE 2PGQB 2PTNA 2P3FH 4AB8A 1L2EA 4U30A 2B0FA 1BMNH 1BTUA 3UNQA 3V3MA 1BJUA 3LKWA 1DICA 1H8DH 1MKWH 2OD3B 1ARCA 4GLYA 1DUAA 2ZGHA 1Q31A 2J4IA 1SQOA 5FPSA 2CV3A 1ZJDA 3SHCH 1HBTH 2V6NA 3CP7A 4FVBA 3GYMA 2HWLB 3PLKA 3RXIA 4GUXA 2FOAA 1B0EA 2J94A 2M5TA 1GHZA 1EZUC 3UNSA 2Y6TA 3TJOA 2STAE 1KIGH 2UUKB 1SGEE 2ZU3A 3T2NA 4WMFA 1TNGA 1J15A 3PWBA 6ESTA 2WV5A 5I25A 2A7JA 2CMYA 5ETXA 2F9BH 4IS5A 2BLOA 2OLGA 1MD8A 1GBJA 4ZHAA 1ABJH 1AE8H 1P10A 3AW0A 4XBDA 1MKXK 1TPSA 1OP2A 1TRNA 4OS1A 3HK3B 1O5DH 1LPKB 3BIVH 1L4ZA 3GYLB 1BIOA 3R0FA 5HXFA 2BB4A 1HJ8A 4IGDA 1TGTA 3ZZ6A 2P16A 1J9CH 3ZZ7A 2Q6FA 4X2XA 2BQ6B 1GL1A 2RA0A 1JIRA 4X1RU 1AZ8A 1DWBH 3BN9A 1C1SA 2BDGA 2BDBA 2R0LA 4SGAE 3ZZ9A 3BG8A 3HK6B 2O8MA 5B6OA 1YBWA 1NRRH 3UTUH 1W7GH 3RC5A 4ZKNU 1O32A 4THNH 4NIVA 4MTBA 4NWKA 1ESTA 3K6YA 2J92A 4ZXXH 1C2LA 1NFXA 5E2PA 1VGCC 2FM2A 3DT0H 5FXLA 1HJAB 2BLWA 1O3DA 1YC0A 1MTVA 5DP9A 2F9UA 3JZ1B 3P8FA 1SG8B 3C1KA 1O3IA 1O3GA 1SBWA 5DK1A 1TNJA 1YF4A 1DY9A 3EYDA 2ODPA 1WYKA 2ZHDA 1F0TA 4I7YH 4YT6H 1FNIA 1GI7B 4ABGA 2BLQA 5EG4A 2BX4A 2FWWA 3W95A 1WV7H 2QCYA 1MAYA 1BRBE 1TPOA 2BOKA 3UQOA 2B8OH 1AGJA 1J16A 2H5DA 3MU4A 2QV1A 1MU6B 1AKSB 1C2DA 4JZIA 3SV2H 4E7NA 1QR3E 5JBTA 2FDAA 1C2FA 1G2MA 1P06A 4X1SU 5F03A 4KGAA 1GBAA 1PFXC 1PPCE 2Z3CA 1TAWA 3SQEE 4ZHLU 2BVXH 1FONA 1KXDA 3GOVB 3DA9B 1CA0C 1HFDA 2J34A 1QNJA 2NU2E 3CS0A 4CHAB 2BY8X 1QRXA 1GBDA 3A87A 5EQSA 1D3QB 3L3TA 4FUGA 1C4V2 4TY6A 1K9OE 1XUIA 4CH8B 2ZQ1A 4NA8A 4FU7A 1LQDB 2I6SA 3RXRA 7ESTE 2ZTZA 3D49H 1EJAA 1LPZB 1G3BA 1RIWC 5EPNA 2XWBI 1N1LA 3GCHC 5GCHF 5K7RA 4BNRA 3LH1A 1GG6B 7LPRA 3P8OA 4MNYA 4LOYH 1Z7KA 3RXFA 3HKJB 1FDPA 3RLWH 2AFQB 3SUFA 4DJZB 1ANBA 2AMDA 1EUFA 1YGCH 1GBMA 2ANKH 1NU7B 4D9RA 1EPTA 4DIHH 1AVGH 1LHCH 1MTNC 1QL7A 1TFXA 2VH0A 1A5HA 2ZPQA 5DG6A 3G01A 4J2YB 1LQEA 1EAIA 5HYOA 3SGAE 1ELAA 2GTBA 1ZLRA 2PKSB 2O8TA 1W0YH 2LPRA 1UTKA 4H6TA 3SU6A 3KF2A 3FVFB 1LHDH 3TIUA 4A1XA 1AUTC 3LGWA 3NKKA 4O97A 4B71A 1TALA 1IHTH 4WH6A 1EZQA 1TLDA 1V6DA 4AGJA 3SOSA 4K1EA 4B2CA 1LVBA 2P8OB 3UOPA 2C8ZB 4I8LA 5HM9A 1ETRH 1EP6A 2BZAA 3QZQA 3V12A 3LT3A 4ZMAH 1BHXB 3L6PA 4BAQB 1NRQH 3NK8A 1K1LA 2BTCE 5E2OA 1LMWB 1O3JA 4ZKSU 2XC4A 2HRVA 1GVKB 1RTLA 1GI2A 2XBXA 1Q2WA 3FP6E 5TCCA 1GJAB 3SUDA 2GCHG 4DVAU 1IQMA 2TGDA 3E3TA 1FQ3A 3SV9A 1K2I1 2BHGA 1S0RA 4UFFH 2TBSA 1GI6A 1KXFA 3ATWA 3SBKA 2PUXB 1IQJA 4XBCA 3LH3A 1GMHG 1GMDG 3SNAA 4BXWA 1O37A 1QA0A 2FIRH 4NZLA 1S83A 3UNRA 3I29A 1SGNE 1OPHB 2SGPE 3GY8A 4YOIA 3LU9B 1XVOA 3LGTA 1C5QA 2VIDA 3U8RH 1EB1H 4Y0ZE 4YTAA 2H5CA 3GY4A 3OTJE 4WJG2 2FPZA 2PW8H 2J9NA 3QUMP 4ABBA 1CGHA 2J38A 3UREA 1QQUA 2FTMA 4CRAA 5L6NH 2HLCA 5L2YH 1TE0A 2DE8A 3U8TH 3SORA 1D6WA 1IQFA 1CE5A 1G9IE 2ANMH 2XBWA 1LKAA 3ESTA 4B2AA 1ELFA 1UHBA 1ZPCA 1SB1H 3MU8A 3AAVA 1WQSA 1AE5A 1CBWC 4R0IA 2UUYA 2ZDAH 1UVOA 4IC5A 1Y5UT 4GHQA 1OWKA 3GY6A 2J2UA 1BOQA 1Z6JH 2C8YB 1IQEA 4X8UH 4YLUA 4K60A 1EX3A 2O8UA 3U8OH 4E06H 4GHTA 3O8RA 1T7CA 1UTOA 4LXBH 4UFEH 4Q2KA 1NM6A 2GV6A 5AFYH 1O2KA 3ZVBA 3GCTG 1ZYOA 1LHFH 2G4TA 4OS2A 4D9QA 3VXFH 1HJAC 3BG4B 2G51A 4K3JA 3SHAH 1IOEA 1C5MD 5FX6A 5EXLA 2B5TB 2NU4E 3TK6A 5LPFA 1C4U2 1GCDA 1ARBA 3Q3KA 1AY6H 2BD5A 3SU3A 4I31A 3A7VA 2GD4B 2OC0A 3RXEA 2FLRH 1C1OA 1HAIH 2G00A 1FZZA 2GMTB 3A8AA 3PMJA 1G30B 4JCNA 3SZNA 3STJA 1TYNA 3OX7U 1FAKH 2HVXA 1TMUH 1ZTJA 4INKA 2UUFB 5LPEA 1UTMA 1C1QA 4AGKA 2HGTH 2BYAX 2Z3EA 3ATMA 2FXRA 1QBOA 3ODFA 3GY3A 3LGYA 1OKXA 1O3LA 1P12E 1XUJA 3GDVA 1YP9A 1P3CA 1HAZB 4JYUH 4ZH8A 3RM0H 4CHAC 4NGAH 1BRCE 2Y7XA 5FPTA 1QB6A 2BDCA 3UIRA 1C9PA 1HAXB 1SLXB 1QB1A 3UR6A 3E8LA 5DP3A 2R9PA 3STIA 1QQ4A 3EQ0H 2Y80A 1H9LB 4DG4A 1RS0A 5FX5A 2G55A 1H8IH 9LPRA 2ANWA 1S6FA 5EW1H 4CRCA 2F91A 4CRGA 1GG6C 3HGPA 1TOMH 4AORA 4UDWH 4BAOB 2NU3E 3ELAH 5EXNA 3ZZCA 1S82A 1JXPA 3S7HB 3K65B 1MCTA 1TGCA 3SU2A 2XCFA 3T5FH 1HAPH 4UFGH 2WPMS 2NU1E 3F9FA 3P8NA 6GCHG 1HJ9A 1P03A 3T29A 1SQAA 1O0DH 3NZIA 2TGPZ 2FP7B 3PMHB 2PKSC 2AEIH 4JYVH 3EA7A 3SO3A 4Y7BA 3SJOA 8GCHF 1GVZA 4H42U 1O34A 3ITIA 5IYTA 1XM1A 3F1SB 1K1IA 1HXEH 1T4UH 2GGVB 5FHTA 2SGQE 1QJ7B 3KL6A 1K1JA 4ZHMU 3CS7A 3ZVFA 1ETTH 2O9QA 2P8OC 2VIPA 1A7SA 1ESBA 4BANB 3SNEA 2BY7X 2OBQA 1UVTH 5GWZA 2OQ5A 2OCVB 1WSSH 2SNWA 3H7OA 2GX4A 2ILNA 1NY22 4E05H 1IQKA 1EATA 1GWAA 3E91A 3SU1A 1TGNA 1FUJA 3SU0A 1V2UT 1G3EA 4U01A 3P8GA 5DP8A 2VIVA 2ZKSA 3RU4T 2QYIA 3F68H 3SN8A 3GDUA 2BDHA 4X8TH 4KKDA 1O35A 1V2MT 4PROA 5EPYA 3TNSA 4CH2B 1SR5C 3FAOA 1RD3B 1P05A 2OC7A 2PKAA 1P11E 1BT7A 3MYWA 4Y11E 3GY5A 2UWOA 3D23A 2W7UA 3KQDA 4XSKU 4INHA 2UWLA 5DP7A 2PFEA 5A2MH 1OP8A 1GHWH 3MU0A 1TONA 4FU8A 2VVUA 2PLXA 2Z9IA 1PPEE 1XXFA 4CRBA 3AW1A 1HLTH 2STBE 2Z9KA 2Z94A 2B9LA 2ZHFH 2ZF0H 1ANDA 2JETB 3VB4A 4B75A 1Y5BT 4DGJA 1BQYA 4HFPB 1O2ZA 4KP0A 1GJCB 3MOCA 3K9XB 4LZ4B 1P3EA 1SMFE 1BBRE 2FS9A 1P2NA 3ZVEA 3S9CA 2BD4A 2F9NA 3S7KB 5F8XA 1SHYA 1LVOA 1AD8H 1VJ9U 3EGKH 1C5WB 4K8YA 2FOHA 1NU9A 1ZGVA 1Z8RA 3NXPA 1GI8B 1K1PA 4TPYA 1C2MA 1GL0E 1O38A 2C3SA 2GZ8A 1WTGH 4BTIB 4Y0YE 1Q3XA 1PPGE 2QXJA 4B1TA 1V2KT 5EODA 1CT4E 3RXQA 2D26C 1C5XB 2A2QH 2A45B 5C1YA 4IMQA 3H5CB 2Y5HA 2B7DH 4CREA 1ELTA 3MH5A 1OWIA 3IG6B 4BOHA 2SGDE 4WWYA 1HV7A 1GI5A 3GY7A 1A5GH 2ZU4A 3UWJH 1FJSA 1ZMJA 2VVVA 5E0GA 3RDZA 2G8TA 1MCVA 3LONA 4YOJA 8LPRA 2FOGA 1J17T 1HIAB 3BG4C 1L4DA 1S5SA 1FAXA 2ZFPH 1FIWA 1ZPBA 2Q1JA 5AFZH 2D2DA 2FLBH 4WMEA 5LH8A 3L33A 1C5ZB 3TH2H 2Q6DA 1F5KU 4O9VA 4TPIZ 1YCPH 1C5NH 1DLEA 3B23B 1BTPA 3RM2H 1BRUP 2FOBA 3PROA 1ZRKA 2H1UA 2SFAA 4A5TS 4D8NA 3MO9A 4ABHA 2GMTC 3RUOA 1CSOE 4NFEA 3QGNB 1F5RA 1HYLA 3MU1A 3KCGH 1V2JT 1C5TA 2VH6A 1GI3A 2IPHA 2FTLE 2PSYA 1UO6A 3M7QA 1LO6A 2UWPA 1QJ1B 4QT8C 4ABIA 1FN6A 1BITA 1QFKH 1D9IA 4DOQA 2Y82A 3BEFB 3IWMA 5IDKA 1ANEA 1PYTC 1UVUH 1UK3A 1TBRH 2A4OA 1MQ5A 1D3TB 1LHEH 1P2MA 3RLYH 4CR9A 5E0JA 1H1BA 4CBNA 1O3KA 4MG3A 2OTVA 2ANYA 3HKIB 2VIWA 3A82A 4H4FA 1A4WH 1EJNA 2XWAA 1FY1A 3A86A 1DSUA 2P93A 1C1NA 2ZGXH 4ISLA 5C2ZA 3AAUA 3UPEA 4YT7H 1P9SA 2ALPA 2ZHEH 3QTOH 2CXVA 2AH4X 1YPHE 3TJVA 1K1NA 3ZYDA 4ZAEA 1O2QA 2ZDLA 2ZDNA 2BVSH 4UD9H 3ZZ5A 1D3DB 1RRKA 1Z71A 1VR1H 1O3FA 2J95A 4IMZA 3RXSA 3SNCA 1ZTLA 2W5EA 1O2IA 5A0AE 2AIQA 4X6NA 3RXOA 1DT2A 2A4QA 1UVSH 5DGJA 1ZGIA 1A5IA 3SGQE 1W14U 5GPIB 1BTWA 1GPZA 2OQUA 1UTNA 3ODDA 1E0FD 1EB2A 1GBLA 1Y3YA 4K5ZA 1GMCF 1AHTH 4O03A 1C4Y2 1KTSB 1IQLA 1H4WA 4ZKRU 4BAHB 4AFZA 3SGBE 1CHOF 4BAKB 2H6MA 1P0SH 2EI8A 1V2TT 1SGDE 1QL9A 2R2MB 4ISIH 3TJUA 2ZU1A 5ABWA 2NU0E 3BV9B 4RKJB 2QGRA 1O2TA 2ZWLH 1MTSA 2G5NA 3VEQB 1FY4A 5HGGA 2I6QA 3O8BA 1FPCH 6CHAB 1O2LA 3LGIA 1E35B 1O2SA 3ZZ3A 5C67A 3BTQE 4NCYA 1P2QA 3KEEA 4NSVA 3UFAA 2XNIA 2ZFRH 4ABEA 3A80A 5TCAA 2Y5FA 3BTHE 1DVAH 2P3UB 2ZFFH 2ZU2A 3Q3XA 1TNLA 3PM3A 1A0LA 4R8TB 3FFGA 1UCYK 1C5SA 1C5PA 1TA6A 1VITF 4ZKOU 4IBLH 1AZZA 2JETC 1ZMLA 1XUHA 1LHGH 5AHGH 1P2OA 2BVRH 1YCPM 4MQAA 1BDAA 4ISHH 4B74A 3R3GB 3OY6U 1XMNB 2CJIA 1EAXA 3T26A 3ATKA 3LJOA 5SGAE 4HI3A 1FV9A 1AWHB 2OBOA 3RXBA 1PQ8A 1C1PA 2VIOA 1HAGE 1O2MA 1RXPA 4NZQA 1U6QA 5H4IB 1DANH 1AI8H 2BD7A 1DLKB 4AFUA 4I8GA 5A0CA 4Q7XA 3QO6A 3UUZA 3M3VA