1W10U

Urokinase type plasminogen activator
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w10U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w10U01
4UFDH 1B7XB 1DXPA 4MPUA 1O2JA 1CA0C 4F49A 4I32A 1EPTA 4O3UA 1EATA 2PR3A 4DIIH 2HWLB 4K8YA 4CRDA 4I7YH 2VU8E 3SJ8A 1HIAA 2V6NA 2THFB 3M35A 1V2VT 2QF0A 2SGEE 1HCGA 4X2VA 2ZI2H 1ABIH 2HLCA 4CRGA 7LPRA 1CHOG 3TU7H 5JYIA 4BXSA 1RTKA 2A4QA 1HAVA 1P0SH 2FP7B 4ZH8A 2XCFA 2ZHQH 1O35A 1O2KA 1OKXA 2G55A 2ZU3A 1GI4A 2VH6A 1UTOA 1EZSC 5A09A 3LH1A 1SBWA 1O2WA 4XBBA 4FUBA 5FXLA 1W3CA 1EAUA 1C1NA 1WTHD 3VXFH 1QA7A 4KP0A 2F9NA 2FOHA 5AFYH 1IQLA 2XC5A 3A8BA 3PWCA 2QA9E 3RXMA 1P9UA 1QRWA 1GMCF 1C5OH 2QY0B 3TGJE 2R3YA 1C1MA 2BVXH 2VIPA 1DY9A 5EQRA 3O8DA 5J4QA 2Q1JA 4BAKB 3RXHA 4PROA 1AO5A 3RP2A 1XMNB 1P2NA 2A2XH 3FAOA 4AFZA 2IPHA 5L2YH 1AIXH 1RTFB 2BMGB 2Z3EA 3S0NA 5T6FA 1GDQA 1K1LA 4D9QA 3HKIB 1DDJA 1BTUA 1SLVB 3BTKE 3GYLB 3RXUA 1UTPA 1P01A 1V2WT 1FY5A 5I46H 1SFQB 3VXEH 3U8TH 2A0QB 1NRNH 4F4OC 1PJPA 2V35A 3GCNA 4FUGA 1JOUB 4X8TH 3OYPA 4ABHA 1T32A 4INKA 4NGAH 1DOJA 1EP6A 1C5NH 2RG3A 3MFJA 4VGCC 1U6QA 1A5IA 1FJSA 1UK3A 3UWIA 4IN2A 1F92A 1K1PA 1TRMA 1AFQC 4AFQA 1GWAA 2ESTE 1SGDE 4YESB 4X8VH 1VR1H 2HNTE 3M37A 1HAGE 4K60A 2BQWB 2WPMS 3ELAH 1CBWB 1HGTH 4OS2A 2HNTF 3RXIA 1E37B 4YLUA 2TGAA 4AG1A 2ZDNA 2G5VA 2Y80A 1Y5AT 4IS5A 1O3LA 2BXUH 1D6RA 1CT0E 3PO1C 1GHZA 1HJ9A 3SU1A 3TK5A 2GZ8A 3GCTG 5F8TA 3UREA 2I6SA 1C1TA 1G3CA 3A88A 3SI4H 2QXGA 3LOXA 4E7NA 3B23B 5DJ7A 5H4IB 5JBTA 3Q76A 1UJ1A 2BZAA 1C1UH 3KN2A 3FFGA 1YKTA 1SHHB 2TGTA 3K2UA 1PPCE 2G51A 3MOCA 4IC5A 4WF8A 2GMTC 1Z8GA 1BHXB 1GJ4H 1AN1E 4NIXA 4A92A 1F0UA 2KAIB 1MCTA 1BHXF 3A86A 4ISOA 2B0FA 2UWLA 2VJ1A 1J15A 3ZVFA 5K0HA 1TBZH 1CT2E 4DW2U 5L6NH 1SGQE 1MTVA 3BTQE 4WXVA 1HXEH 1EB2A 1UVUH 1UCYH 4Y6DA 1Y3YA 2K1QA 1Y5BT 3QZQA 2DUCA 1EUFA 1GMDF 1F0SA 1K21H 5C20A 3A7WA 1BRUP 3N7OA 3DD2H 1ZJKA 3KQEA 1Y3WA 1HUTH 1BTWA 1UMAH 3RU4D 2XBXA 1C2IA 3S69A 5HYOA 1RGQA 2Y7XA 2R2WU 4ABFA 4Y8XA 1C1PA 1V2LT 2B9LA 3Q3XA 5GIBA 1WQVH 1QIXB 2A5AA 2ZQ1A 1SR5C 1CU1A 1JIMA 1XVOA 2FOGA 1SQOA 2ZGCA 4Y8YA 5AF9H 5LGOA 3A8DA 1GCDA 1MH0A 1BTHH 1HAVB 3SORA 3TJNA 1BT7A 1M9UA 4ASHA 4SGBE 2O8MA 3SU6A 3OU0A 1FMGA 1DSUA 1O39A 1AVWA 4K5ZA 1KSNA 5GJ4B 1BRCE 2ODYB 3E91A 4K69A 4AB9A 2SGQE 1TIOA 1ELGA 2FLBH 3FVFB 2BD3A 2QXHA 1QA0A 4FU8A 1GCTB 1EZQA 4K1SA 1C2EA 3BEIB 1WQSA 1ZMNA 1C9TA 1K2I1 4O03A 4GVUA 1DPOA 1LPKB 2AMDA 1AVXA 1NFWA 3O8CA 4I8GA 4I8KA 3HGNA 2CF8H 1O3FA 1P3CA 3IITA 9LPRA 4ZXYH 4UEHH 4DG4A 1TOCB 3RC4A 1UCYE 3EYDA 3ATWA 1G2LA 2VWMA 4B1TA 3SW2B 1ZHPA 4MLFB 4OGYA 1JMOH 1SOTA 2FOFA 4JYUH 2QXJA 2FMJA 1C5WB 4MDSA 1MKWH 4I31A 3KF2A 1GBAA 2C93B 1ETTH 1W8BH 4FUJA 1FI8A 1TB6H 4GPGA 1UHBA 5F03A 1RXPA 3SJKA 1ANBA 1TPSA 4R0IA 4WH8A 3KQDA 1YPLH 3F9HA 1ELTA 5FPYA 1P2JA 2P94A 1GJAB 3PO1B 1LTOA 3M5LA 1QL9A 1HFDA 2WINI 1BA8B 1W10U 1K1MA 1V2JT 2DE9A 3S9CA 3M5NA 1OWIA 2J94A 3A7VA 1KDQA 1LMWB 4WVPE 1PQAA 4DURA 3K6ZA 2WPKS 1YP9A 1W11U 2Z9JA 4CBNA 1VITF 4NIVA 2W3IA 4DT7B 1UVTH 3H7TA 3SV6A 4X1RU 1O2HA 1FV9A 1WUNH 2Q6FA 1C4Y2 5DGJA 5FCKA 2XW9A 1UTQA 1SLWB 4BTTB 4GCHG 4THNH 1UTKA 4B76A 4J1YA 1CSOE 3GDSA 3U8OH 4CREA 2SGDE 3D49H 3ATMA 1CVWH 1DANH 1EP5A 1AUJA 2A5IA 3RU4E 3MMGA 3U8RH 3F9FA 5C1YA 3PMHB 1O5DH 2OINA 2RA0A 3SGAE 5L2ZH 1GI9B 4H4FA 4QT8C 3URCA 4AX9H 5TCAA 4AN7A 4B2BA 1GG6B 1AZZA 4U32A 1SGRE 1YLDA 1XUJA 1XM1A 4NWLA 3T5FH 3OX7U 4MNVA 1ZMLA 3TH3H 2P3UB 4ISHH 5T6GA 3JZ1B 1BMNH 2GCHF 1LHDH 4MPXA 1ZOMA 1J16A 1SGNE 1BQYA 1TGSZ 2JH5D 1O5EH 1P3EA 2ZHFH 1BIOA 1MAXA 3GY7A 6LPRA 2Z3CA 2GCHG 1TPOA 1C5PA 2W5EA 1H8DH 1K1NA 1G37A 2A2QH 1GBKA 3SN8A 1KXCA 1W7XH 1EQ9A 1XKBC 1T8LA 3QO6A 4LZ4B 1H8IH 1KLJH 2CF9H 1BTPA 1CE5A 1P09A 1H1BA 3QX5H 1RD3B 2BQ7B 4A1XA 3A81A 1QL7A 1XUGA 1O2MA 1GVKB 3SQHE 3TNTA 5C5NA 4OS1A 1ARCA 1C2MA 4BAMB 4X1SU 1CBWC 1GHVH 1J14A 3AVZA 3ZZ7A 1K1JA 5EW1H 1AMHA 4TPIZ 1TBQH 3QTOH 3GY2A 1MTNC 3PMBB 4NCYA 1S0QA 3ATKA 1VGCB 1V2NT 5PTPA 1OWEA 1IAUA 2H1UA 3M3VA 3RMNH 2HGTH 4GLYA 1VITH 3UQVA 4K3JA 1DWCH 3E3TA 5LH8A 1RFNA 1B5GH 2BDAA 1PQ5A 2J34A 3EAJA 3HK3B 3W94A 1YCPH 3URDA 1Y59T 2WUBA 1EAIA 1XUIA 3VB3A 4IN1A 1CA0B 1E34B 1ZJDA 2AFQB 3SNAA 4GUXA 1AWHB 1F2SE 1AFQB 4FXGH 4X1NU 5TJXA 2VVUA 1GI0A 4TWYA 3KIDU 2JH6D 4CRBA 4JZEH 4I8HA 1O3JA 1QJ6B 2WV5A 1MZAA 1GI2A 1PPZA 2G5NA 1S84A 1G3BA 4GHQA 1PPFE 2AGGX 2FIRH 4JZIA 2PFEA 2OC1A 3RXTA 1C2JA 1WCZA 1KY9A 3GY8A 1Z1JA 2PLXA 1O3AA 3FZZA 1FN6A 1FN8A 1KXDA 3KEEA 3GDUA 2CJIA 5GDSH 1S5SA 1NRSH 3RXSA 2BLWA 2STBE 1Z71A 1EB1H 2PKSC 2ZU1A 1SGEE 2G4TA 1WSSH 2FX6A 3A80A 1GL0E 2C8XB 2IN2A 1SSXA 3LDXH 1P2MA 1ZZZA 2FOCA 3BF6H 2WPJS 4X2YA 4TY6A 2C8WB 4AGJA 4HGCA 5EQSA 1JWTA 1ESAA 4YO9A 1WBGB 1SLXB 3BEFB 3D62A 2XCNA 3PLBA 1OS8A 3DHKH 3NK8A 1DVAH 2FO9A 4ABBA 1D3PB 1UHBB 2BDBA 1YPJH 1DY8A 5IDKA 1YPHE 1LVOA 4CH2B 3UFAA 3M5MA 3RM2H 2OQUA 1A0HB 2Z94A 1PPGE 1CO7E 3V3MA 4MNWA 2FI3E 1OX1A 3UNRA 3BTGE 3R3GB 2QF3A 3SHCH 1Y3UA 1AZ8A 1P57B 1S81A 1TBRH 3FP8E 3RDZA 1OSSA 1ZLRA 2OC8A 1W7GH 3RXDA 2BLVA 1SLUB 1UCYK 2VIWA 1ZGVA 1Q3XA 1TFXA 3ZZ4A 2A31A 1ZSKA 3PTNA 3RMOH 5EXLA 1D4PB 4CR5A 1A0LA 1V2OT 4DOQA 3KL6A 2OQ5A 3RXOA 1IQGA 1OXGA 1EJAA 4K1EA 3M3SA 1SMFE 2Q6GA 4YTAA 1IQNA 2AERH 5ETXA 1O2XA 5FAHA 3SGBE 4WJG2 3L3TA 1TNJA 3LJJA 2QC2A 2GV6A 4BAHB 5GCHF 4NA7A 4TY7A 1AU8A 2C4FH 3GY6A 1VCWA 3LC5A 1GI7B 1MBQA 4IBLH 1TONA 4DGJA 4LZ1H 3UNSA 2A5KA 1C2GA 1O3KA 1LHGH 4CHAC 1LHCH 4TPYA 3MO9A 4WH6A 2Y5FA 4XOJA 3ZZDA 4WMEA 5GWZA 2BD4A 3A83A 4MNXA 2Y6TA 3BG4B 3BEUA 3RXVA 3U1IB 1HAHH 2FLRH 3M7TA 4LOYH 5FPTA 1QHRB 3KQBA 4MG3A 2GZ7A 1NTPA 2GZ9A 1C5ZB 3UTUH 3I78A 4FUIA 4B74A 4WMDA 4X6OA 3LGYA 3RXJA 2YNBA 4X8SH 1HJAB 4JZDH 1CA8B 2VWOA 1AVGH 1O5FH 1P06A 2AMQA 2CN0H 1HLTH 1OWKA 2P95A 1AD8H 1TWXB 2ZPRA 3RXBA 1MU8B 2OD3B 3SUGA 1YF4A 1O31A 5FX5A 2FM2A 5AHGH 1O2VA 2ZFFH 4MTBA 3GCHC 5EPNA 2BD2A 2J4IA 3GYMA 1GHYH 1OOKB 1VZQH 4O9VA 2XBVA 2PWXA 1QGFA 4J2YB 3EE0B 1K9OE 3ESTA 1XX9A 1PYTC 2B8OH 5ESBA 4JCNA 3M5OA 1O3MA 2NU0E 1HIAB 1PFXC 3RXEA 1HAOH 3A7ZA 4Y71A 5F8XA 1QB1A 4K1TA 2P16A 1NRRH 2UWOA 4ISIH 3GY5A 1AE8H 2BDGA 3ZVCA 2BD5A 2BYAX 5E0JA 1F7ZA 1ANEA 3AAUA 4NG9H 1O2OA 2FODA 5BPEA 1QB9A 5J4SA 4D76A 1A3BH 3FP6E 2PGQB 1HAIH 1OYTH 5A2MH 1NC6A 3QK1A 2BDYA 3UIRA 3RXKA 4Z0KA 2G52A 1C1WH 2PUXB 4MQAA 2ZIQH 3MHWU 1F5KU 2CV3A 4MPVA 4YOJA 3H5CB 4NWKA 5E8EH 1LVYA 1GHBG 2R0KA 2ZPQA 2AIPA 2HPQH 2GP9B 5JPMH 5L30H 1ZHMA 2FYQA 2NU3E 4HI3A 1W0ZU 3CS7A 1GGDB 3A8AA 1O3PB 1OWHA 3ZV8A 2YOLA 1IQEA 2H5CA 1TQ0B 1P8VC 3TIUA 3AW1A 1XUFA 5CHAB 4I8LA 3BTTE 1LCYA 3EDXB 2ODQA 3SJOA 5GXPA 4X6PA 1N1LA 1KXEA 3Q00A 1HBTH 1C5YB 1YM0A 3F1SB 1S6HA 4E05H 1XVMA 4GAWA 2ZFSA 3FZDA 1GJCB 3JZ2B 1A3EH 1C1VH 3DUXH 2ZWLH 4CH8B 3RLWH 5F6MA 1DWDH 3QLPH 1D3DB 2UWPA 1F5RA 3VB5A 1AB9C 1O32A 1Y5UT 1ZPZA 2H6MA 3KCGH 2C8YB 1HJAC 1O2LA 2A45B 1NZQH 2TGPZ 3UOPA 5EG4A 1TNKA 5I25A 3RMMH 7GCHF 4DCDA 1ESTA 1FPCH 2GCTC 5DG6A 1C5UA 1KTSB 1V2ST 3P92A 1XKAC 2ZCHP 5DP3A 5FHTA 1NPMA 2IJOB 5E0HA 2JETC 2BD9A 1QURH 4JYVH 5DO4H 2B5TB 1XUKA 1AB9B 5HM9A 4CRCA 3S7KB 1CHGA 1V3XA 1MTWA 5HM2A 3LC3A 1GGDC 1J8AA 1YPHC 1C9PA 2VNTA 1C5TA 1FY1A 2OP9A 3BV9B 1XUHA 1LKAA 2F83A 1BRAA 2ZFTA 1ELBA 2UUYA 1MD8A 1GJDB 1TYNA 3PLKA 5EQQA 1J9CH 1SGCA 1A0JA 2M5TA 1BBRE 1SGFA 3IWMA 1Z7KA 1TGNA 3ZZ3A 1A4WH 2WV4A 1JRSA 5F8ZA 1S82A 4FUEA 5DP5A 2ODPA 1BTZA 1V2UT 2D2DA 1SG8B 2R9PA 1GI6A 1W13U 1GHXH 1AHTH 4ABJA 4O97A 2V0BA 2ZPSA 2XBYA 1O0DH 1SI5H 2ALVA 1K1OA 1VGCC 3MH4A 1TABE 1BMAA 5A8ZA 3V13A 2AMPA 2Q6DA 3WY8A 4ABDA 4DVAU 1G36A 2ZCKP 3E8LA 3DFLA 1FIWA 2AEIH 2P8OB 2RCEA 3AW0A 3RMLH 1Y3VA 1D6WA 1SGTA 3LH3A 2SGPE 2EI7A 3QDZB 2BX4A 2P93A 1SC8U 1C1QA 1ZRKA 2Z9IA 1UTNA 1TOMH 4H6SB 1DE7H 1TX6A 2TIOA 3GOVB 2ZGBH 4D7FA 1SGFG 3TGIE 2GDEH 4K8BA 1C2LA 5EXNA 4XDEA 1GL1A 2FXRA 3RXAA 5DP4A 1GMDG 1GI1A 1GDUA 2SNWA 3RC5A 2F9VA 2RDLA 2ILNA 3MNBA 2AGEX 1TGCA 1HYLA 1ABJH 1O2QA 2PW8H 4XBDA 3AAVA 2HVXA 3T2NA 1DWBH 1BB0B 4JK5A 4VGCB 5T3HA 2G4UA 3RC6A 3CP7A 4ABGA 2ZGJA 3UUZA 5HMAA 5IYTA 5EXMA 1INCA 5A8YA 1RIWB 3TK6A 2NWNA 1TGBA 1TAWA 4BTIB 3VGCB 1JBUH 1TRNA 2BQ6B 3ZZ5A 3QGJA 2PKAB 4ZUHA 3V12A 2YNAA 4ZKSU 4BAQB 1ZTLA 3MWIU 5JBAS 2BZ6H 2CHAB 5C5OA 1ZPCA 4NFEA 4B2AA 2BDCA 1P2IA 1SGIB 1RIWC 2J38A 3K9XB 4H6TA 8KME2 1NRQH 3KQCA 1E0FD 5DKMA 1QB6A 3E1XB 4YOGA 4FUFA 1GBMA 3BN9A 2Y7ZA 3ZVBA 5JBCS 1HNEE 1P2KA 3T62A 1RS0A 1SFIA 2VWNA 1TNHA 2OC7A 3BTEE 3V7TA 2ZEBA 2ANWA 1C5VA 1A2CH 2FS8A 2ZU5A 1O2YA 1KDQB 4ZKOU 1GBLA 1ELDE 4Y11E 2P8OC 8LPRA 2VIOA 3DA9B 1ELCA 1P9SA 2NU4E 4BNRA 1W12U 1Z6EA 1QL8A 2QXIA 1Z8RA 3ZZCA 2H9TH 1T4VH 3RXQA 4KKDA 3D23A 4A5TS 3Q77A 3O8BA 3MH5A 3AASA 5C2ZA 1NRPH 1Z1IA 4IW4E 4AOQA 2BOKA 2BB4A 1V2KT 4AORA 1AE5A 2G00A 1DICA 3KGPA 3MU4A 1C5XB 1LHFH 3TITA 4ABEA 1BOQA 3T25A 3ZZBA 1D3QB 5TCCA 1NM6A 2GKVE 2UUFB 4YZUA 2I6QA 4NIYA 2H9EH 2ZC9H 2W7SA 1GHWH 3NWUA 3HK6B 3MNSA 5EW2H 1HV7A 1LKBA 1P05A 2C3SA 4IC6A 1NFXA 2BLQA 2NU1E 4FU9A 3SV7A 3TNSA 1GDNA 2LNCA 2ZFQH 1GBFA 2P59A 2QN5T 4M7GA 3S7HB 1B0EA 1BMMH 1JRTA 1O2GH 3RUOA 2VWLA 1P04A 3TJUA 1O3HA 2GCTB 1RRKA 3O8RA 2A4GA 1G2MA 2ZDLA 3U69H 1FIZA 2ANKH 2HRVA 1FDPA 3DT0H 4UD9H 4BTUB 5A0BA 1P2QA 4OS7A 4OS5A 3RXCA 1LQEA 2AH4X 2ZCLP 1QBNA 1A5GH 4AYYB 1AFEH 1UVPA 1D9IA 2AS9A 1S85A 1DITH 4Q7YA 2PTCE 2ZA5A 1MCVA 3GY4A 4GHTA 2WPLS 3KHVA 1VCPA 4JK6A 1BRBE 1AWFH 2EA3A 3E0PB 1DS2E 1C1RA 1DUAA 1V6DA 2WPIS 1T31A 2XBWA 2ASUB 3PV4A 5FX6A 3C1KA 2GDDA 2A1DB 4WWYA 4NZLA 4B2CA 1DLKB 3ZVGA 1C4U2 5HXFA 1EAWA 1O3EA 5A0AE 1AI8H 1LPZB 2Y81A 1L4ZA 3E6PH 2ZZUH 1N6YA 1SGYE 1O2PA 4Y0YE 4NA8A 5CE1A 4R8TB 1T8NA 3UR9A 3A8CA 1GBHA 4Y79A 2Z9GA 1BJVA 1MKXH 4INLA 4Q7XA 1EXFA 3B8JA 1ZGIA 1ACBE 4ZROA 1TALA 1NT1A 5DPAA 3VB4A 6CHAC 1UTJA 1NN6A 4KTCA 4FUDA 2SGFE 1UTMA 3R0FA 3SI3H 4YM9A 4B73A 3HATH 1QBVH 1P12E 1MTNB 1SGPE 2ZECA 1NY22 3G01A 1AGJA 1L1NA 1NU9A 1SB1H 2FDAA 4X6MA 4Y0ZE 1GJ5H 6GCHG 3SJIA 1LVMA 1GJ8B 3M36A 3PM3A 3SZNA 4D8NA 4INHA 4JYTA 4MVNA 1V2PT 1MAYA 2D1JA 1V2QT 4BXWA 1NO9H 4FUCA 5CMXH 5FPSA 2ALPA 4A1TA 2SFAA 1MQ6A 4BOHA 3ZVDA 1C1SA 3QTVH 3QN7A 5B6OA 1Z8JB 1BTXA 3FP7E 3RXRA 3ODFA 4MPWA 3GISB 2J95A 3RXFA 4DY7B 1DLEA 4Q2KA 1F0TA 1HAYB 1DWEH 1FUJA 1EPTB 6ESTA 2FYRA 4CR9A 3UPEA 2Z3DA 4X8UH 3SV2H 3P8NA 2B7DH 2W3KA 1O5GH 2GV7A 3PLPA 1THSH 1GBDA 3MYWA 1IHTH 3BTFE 4NZQA 3L33A 1O5AB 2VIDA 1MU6B 4X1QU 1GMCG 3S9BA 3VGCC 2XWAA 1O2RA 1PPBH 1DT2A 1EJMA 1QJ1B 2AIQA 5AFZH 5ABWA 5C1XA 3S9AA 3DFJA 2XWBI 1O2TA 2JKHA 1O3BA 1Z6JH 2SGAA 2HPPH 1IQMA 3ZZ6A 3P95A 4Y76A 3IG6B 3SNDA 1FZZA 1C2FA 1GHAF 1SOZA 1UTLM 3BG8A 2GT8A 2FOMB 3E0NB 5SGAE 2ZTYA 1HPGA 3LKWA 2FI4E 1GHAG 4XFQA 1A5HA 2G81E 1EAXA 3STJA 2BY7X 2VGCC 2J2UA 1O2SA 2F91A 3BG4C 3PMAB 3QUMP 3M61U 1OWDA 1F0RA 4E7RG 1O33A 2BTCE 1ZRBA 4ABIA 3V0XA 1KYNA 3ZYEA 2DE8A 1B0FA 2BY9X 2JH0D 2D8WA 2NU2E 3SNBA 1QJ7B 3PTBA 4CHAB 1ETSH 3TVJB 2GVFA 1FY8E 3L6PA 1KXAA 1ANDA 2GD4B 2BM2A 3LIWA 5CHAC 3U98H 1DSTA 1QR3E 1ZSJA 1NROH 3CENA 2BXTH 2FOBA 6GCHF 1YC0A 4GCHF 3HGPA 3SUFA 3UWJH 3TH2H 3ENSB 3TJVA 1OP8A 1BBRH 1WOFA 1FY4A 1MD7A 3LGIA 1S6FA 3SU4A 1CQQA 4UDWH 2FOEA 4K2YA 1TMBH 3SV8A 1DXWA 2Y5HA 2ZQ2A 1WYKA 1FNIA 1MTUA 3SUDA 2EEKA 4XSKU 2FPZA 2J92A 4UONA 2ZTXA 2HNTC 2VGCB 1G3EA 3CS0A 3NUMA 4YT7H 2XRCA 5A0CA 1O36A 2QCYA 4Z6AH 1GBJA 2ZTZA 3NKKA 3SHAH 1C5RA 3ZV9A 3ZVEA 1ELAA 3GY3A 2VVCA 3QGNB 1HXFH 4Y7AA 3SBKA 3SU2A 4FU7A 1QNJA 3GCOA 1ZPBA 1P03A 2PKAA 1O3GA 3BIVH 2WYGA 2O8TA 3VEQB 1IQFA 2VIQA 3LGVA 1LO6A 1FY3A 3VB6A 2FESH 1HAXB 2BDHA 1ZTKA 1FXYA 1TNIA 4RN6A 1ELFA 4YLQH 4LXBH 2ZHEH 1VITG 3OTJE 1O2UA 4IMZA 4BANB 4AGKA 1HDTH 3EQ0H 2VVVA 3P17H 2WYJA 3SO3A 1G9IE 3I77A 1YYY1 1BITA 2PKSB 4LK4A 2F3CE 2KAIA 2ZHWH 1ESBA 1ZTJA 1GI5A 1KLIH 1UO6A 1T7CA 1EOLA 2C90B 3LPRA 2H9HA 2C8ZB 3ZYDA 1GMHF 1O3CA 1THPB 2CMYA 3GDVA 4NFFA 3UQOA 4ZHAA 2VIVA 1GMHG 2XTTB 3ZZAA 1EZUC 1SQAA 1MUEB 4MNYA 2O9QA 1OP2A 3VPKA 1QBOA 4BAOB 1E35B 1UVSH 2PSYA 3MU5A 3SNEA 4DIHH 3MI4A 3A82A 2AGIX 1BZXE 1YPGH 2Y5GA 4ZMAH 2GMTB 1YPKH 1GBCA 3E16B 2FWWA 2XC4A 5HGGA 3PWBA 3MNXA 2A7CA 1C1OA 3QWCH 1H9LB 1P02A 4NSYA 1QCPA 3BSQA 5DP9A 4X2WA 1TPPA 1L4DA 4X1PU 1TX7A 4DJZB 2ZO3H 3LGUA 4ZHMU 1K28D 2ZNKH 6CHAB 3P6ZB 1O30A 1MTSA 3NCLA 2VINA 1WV7H 2PGBB 1H9IE 3EA8A 1LQDB 5JB9S 2FZZA 1CGJE 1O38A 2ANYA 1YPEH 3SQEE 1XXFA 3M7QA 1KXBA 4KTUA 1X7AC 1QQ4A 1SQTA 3NXPA 3B9FH 1OPHB 3TH4H 3P70B 4ZKNU 1IQIA 1C5QA 1A1RA 1P2OA 3Q3YA 1TMUH 4JMYA 2F9PA 1MBMA 5C3NA 3EGKH 3BIUH 3UNQA 2ZDVH 5LPFA 5FBEA 2A4OA 2ZU4A 2ZDKA 3MH7A 2OC0A 1GBTA 4XBCA 2BY8X 1GG6C 3OY6U 1ORFA 1T8OA 4I8JA 1NFYA 2WUCA 3W95A 3BTME 2O8LA 2CHAC 1VCQA 2PHBA 1QRXA 2UUJB 3H7OA 1C2HA 1G30B 1T4UH 2QIQA 1L0ZA 4RKOB 4Q80A 1V2TT 3EA7A 2WPHS 4HZHA 2HOBA 8ESTE 1FONA 2VB0A 3NZIA 3SU0A 1F5LA 1Z8IB 2P3TB 2Y82A 1Y3XA 3P8GA 3MU8A 1O5CB 1LPGB 1NFUA 1E36B 4ZHLU 2BDIA 5GCHG 1KIGH 2PTNA 1IOEA 1NS3A 1RTLA 5JBBS 1GJ6A 2ANMH 1H9HE 1K22H 1P10A 2BVSH 3PYHA 1LHEH 1QRZA 4RKJB 3A89A 3LONA 5BRRE 5EPYA 5FCRA 4FVDA 2FS9A 3ZZ8A 1C5SA 4E06H 3T27A 1W14U 5DP6A 3BTHE 3T28A 1C5MD 1XXDA 3ITIA 1GBIA 1ZHRA 4OS4A 4OS6A 5G4BA 2ZHDA 3BTWE 1HB0B 4B71A 2OBQA 1FAKH 2PV9B 4HTCH 3RU4T 4A6LA 1O2ZA 2BHGA 4WMFA 3PMJA 4NSVA 2FI5E 3OSYA 2UUKB 1GI3A 2CGAA 4CBOA 4JZ1A 3BTDE 2W7UA 1PQ8A 1TLDA 1V2MT 4B75A 3P8FA 4AYVB 2TGDA 1V2RT 1AY6H 1MZDA 1WAYB 1EKBB 1Q2WA 3A84A 1S0RA 1RJXB 2BD8A 2OTVA 4Y10E 4H42U 1N8OC 3MH6A 5E0GA 1TNLA 1O34A 3T29A 1SHYA 2GTBA 2Z6BD 2EC9H 3A87A 2LPRA 4WY3A 4AG2A 4HFPB 3ODDA 2BOHB 4KGAA 1VJ9U 2O8WA 3KNXA 1BUIA 3A7TA 3TK9A 2BLOA 4YT6H 1ZSLA 1ZYOA 5GPIB 3MU0A 2O8UA 5E2OA 3TPIZ 2ZGXH 1SPJA 1TGTA 3RXPA 4KELA 4AFSA 1HRTH 1G3DA 1GHBF 4NIWA 1BTYA 3P8OA 7GCHG 2BY5X 1J17T 3LGWA 5C67A 3SOSA 1GI8B 1TNGA 2ZP0H 4A7IB 2FTLE 3SJ9A 5JDUB 4UFEH 1PPHE 1N8OB 1ELEE 2ZG0H 1PPEE 3RM0H 1O3OA 1ELVA 2Z7FE 1GJ9B 2OUAA 1DM4B 1BJUA 4U01A 1MQ5A 3E90B 3SGQE 1O3IA 5A8XA 4I33A 2EI6A 2TPIZ 2ZGHA 1CGHA 1KLTA 4UFFH 5E2PA 2GX4A 1MKWK 1D3TB 1BCUH 3RXGA 1QTFA 1GJ7B 1NU7B 4RSPA 1CGIE 3F9GA 3EA9A 2P3FH 4NA9H 3ZZ9A 1GJBB 3F9EA 1AUTC 1O2NA 1UK4A 2GT7A 1N6XA 1FAXA 1TX8A 1BBRK 1BMLA 5EODA 9ESTA 7ESTE 1UK2A 2FTMA 2PUQH 2ZF0H 2ZDAH 2PSXA 4IGDA 3RXLA 4XE4A 2Z9LA 2R3UA 1O2IA 1THRH 1YPMH 8GCHG 3HKJB 1UVOA 1L1GA 2F9OA 5LPRA 1OYQA 3FANA 4KTSA 2QAAA 8GCHF 1LVBA 1JXPA 2V3OH 3C27B 3I29A 1ZR0A 4OGXA 3K6YA 4FUHA 1ANCA 1YGCH 1HAPH 3PROA 1TQ7B 3SNCA 1AKSB 2G8TA 2Z9KA 2AYWA 1Q31A 1O3NA 3TGKE 1C2DA 2CXVA 2ZKSA 1TPAE 3A7YA 5FBIA 3F68H 1OP0A 4CRFA 1IQKA 5AVDA 1FQ3A 4D9RA 1YCPK 4GSOA 5T6DA 1QQUA 1C5LH 2H5DA 1WU1A 5DK1A 4TWWA 4TYDA 1GBEA 2F9UA 3UOUA 1TA2A 4U30A 2QV1A 4AZ2B 7KMEH 1MKXK 3RLYH 1DX5M 2J9NA 2OXSA 1FPHH 1IQHA 2V3HH 1SVPA 1Y8TA 3GICB 1SL3A 2QYIA 3LGTA 4ZAEA 3LJOA 2A7HA 4Y7BA 1O37A 4X6NA 1HAZB 1O3DA 1PQ7A 1AQ7A 1W0YH 3VFEA 1WTGH 2R2MB 2OCVB 5EU8A 3SV9A 1A7SA 1C2KA 1QFKH 2VH0A 2ZFPH 3F6UH 3ATIA 2TBSA 4X2XA 3TLOA 2XYAA 5DP7A 4ESTE 1CHOF 1H4WA 2ULLA 5K7RA 4FVBA 1AKSA 3STIA 2HALA 1EOJA 3GCHB 3T26A 3U9AH 1TA6A 4YOIA 1K1IA 1GVLA 1W2KH 2IOTA 2ZDMA 2XNIA 1IHSH 1C4V2 3M7UA 2D26C 2TRMA 4Y8ZA 3UR6A 5ESTE 2BY6X 1VJAU 4AFUA 1A61H 4CRAA 1L2EA 2BD7A 4ZXXH 3U1JB 3A7XA 1GVZA 1TRYA 1ID5H 1QY6A 5EGMA 1GCTC 5DP8A 1KTTB 3MO3A 1PYTD 1HJ8A 2SNVA 2ZU2A 3QZRA 5LPEA 3SUEA 1DUEA 1BDAA 3GCTF 3LT3A 4ISLA 3ZVAA 2JETB 2GGVB 2EI8A 5JB8S 3PB1E 3Q3KA 2A4RA 4ZKRU 1YBWA 4SGAE 1ARBA 3ATLA 4IMQA 1GPZA 1TE0A 2FX4A 1EZXC 4U2WA 4WXIA 3SU3A 1TMTH 2OLGA 1MMJN 3K65B 2W26A 1OWJA 1A46H 1EASA 3HPTB 1LDTT 1T8MA 3MTYA 2FOAA 1EPTC 3OY5U 1L1JA 1ETRH 3A85A 4UE7H 3UY9A 5EOKA 1EJNA 2ZFRH 4Q7ZA 4A1VA 1P11E 1JIRA 1O5BB 2F9BH 1FLEE 4JZFH 2XC0A 2R0LA 2STAE 1KXFA 5C1UA 2H2ZA 3SU5A 4ABAA 2BVRH 1CT4E 3LU9B 1IQJA 3NPSA 1YCPM 3MO6A 1ZMJA 4UFGH 1YLCA 4O3TA 1G32B 4ISNA 2A7JA 3MNCA 2A32A 1GBBA 3VB7A 4D7GA 3MU1A 3M3TA 1DFPA 4AB8A 2RA3A 2QGRA 1NESE 1S83A 1E38B 2BX3A 3TJOA 3D65E 2FEQH 1EX3A 2OBOA 2XXLA 4X0WU
chains in the Genus database with same CATH superfamily
4UFDH 1B7XB 4Q4LA 1DXPA 4MPUA 1O2JA 1CA0C 4F49A 4I32A 1EPTA 4O3UA 1EATA 2PR3A 4DIIH 2HWLB 4K8YA 4CRDA 2VBCA 2VU8E 4I7YH 3SJ8A 1HIAA 2V6NA 2THFB 3M35A 2HVYB 1V2VT 2QF0A 2SGEE 1HCGA 4X2VA 2ZI2H 1ABIH 2HLCA 4CRGA 7LPRA 1CHOG 3TU7H 5JYIA 4BXSA 1RTKA 2A4QA 1HAVA 1P0SH 2FP7B 4ZH8A 2XCFA 2ZHQH 1O35A 1O2KA 1OKXA 2G55A 2ZU3A 1GI4A 2VH6A 1UTOA 1EZSC 2KCAA 5A09A 3LH1A 1SBWA 1O2WA 4XBBA 4FUBA 5FXLA 1W3CA 1EAUA 1C1NA 1WTHD 3VXFH 1QA7A 4KP0A 2F9NA 2FOHA 5AFYH 1IQLA 2XC5A 3A8BA 3PWCA 2QA9E 3RXMA 1P9UA 1QRWA 1GMCF 1C5OH 4FOUC 2QY0B 3TGJE 2R3YA 2M2AA 1C1MA 2BVXH 2VIPA 1DY9A 5EQRA 3O8DA 5EJLA 5J4QA 2Q1JA 4BAKB 3RXHA 4PROA 1AO5A 3RP2A 1XMNB 1P2NA 2A2XH 3FAOA 4AFZA 2IPHA 5L2YH 3DSPA 1AIXH 1RTFB 2BMGB 2Z3EA 3S0NA 5T6FA 1GDQA 1K1LA 5DN6D 4D9QA 3HKIB 1VKYA 1DDJA 1BTUA 1SLVB 3BTKE 3GYLB 3RXUA 1UTPA 1P01A 1V2WT 1FY5A 5I46H 3PV2A 1SFQB 3VXEH 3U8TH 2A0QB 1NRNH 4F4OC 1PJPA 2V35A 3GCNA 4FUGA 1JOUB 4X8TH 3OYPA 4ABHA 1T32A 4INKA 4NGAH 3FOAA 1DOJA 1EP6A 3WWFA 1C5NH 2RG3A 3MFJA 4VGCC 5EIYA 1U6QA 1A5IA 1FJSA 1UK3A 3UWIA 4IN2A 1F92A 1K1PA 1TRMA 1AFQC 4AFQA 1GWAA 2ESTE 1SGDE 4YESB 4X8VH 1VR1H 2HNTE 3M37A 1HAGE 4K60A 2BQWB 2WPMS 3ELAH 3UB0A 1CBWB 1HGTH 4OS2A 2HNTF 3RXIA 1E37B 4YLUA 2TGAA 4AG1A 2ZDNA 2G5VA 2Y80A 1Y5AT 4IS5A 1O3LA 2BXUH 1D6RA 1CT0E 3PO1C 1W0JD 1GHZA 1HJ9A 3SU1A 3TK5A 2GZ8A 3GCTG 5F8TA 3UREA 2I6SA 1C1TA 1G3CA 3A88A 3SI4H 2QXGA 3LOXA 4E7NA 3B23B 5DJ7A 5H4IB 5JBTA 3Q76A 1UJ1A 2BZAA 1C1UH 3KN2A 3FFGA 1YKTA 1SHHB 2TGTA 3K2UA 1PPCE 2G51A 3DSGA 3MOCA 4IC5A 4WF8A 2GMTC 1Z8GA 1BHXB 1GJ4H 4OM9A 1AN1E 4NIXA 4A92A 1F0UA 2KAIB 3W1EA 1MCTA 1BHXF 3A86A 4ISOA 2B0FA 2UWLA 2VJ1A 1J15A 3ZVFA 5K0HA 1TBZH 1CT2E 4DW2U 5L6NH 1SGQE 1MTVA 3BTQE 4WXVA 1HXEH 1EB2A 1UVUH 1UCYH 4Y6DA 1Y3YA 2K1QA 1Y5BT 3QZQA 2DUCA 1EUFA 5HIZA 1GMDF 1F0SA 1K21H 4TSFD 3A7WA 5C20A 1BMFD 1BRUP 3N7OA 3DD2H 1ZJKA 3KQEA 5GNDA 1Y3WA 1HUTH 1BTWA 1UMAH 3RU4D 2XBXA 1C2IA 3S69A 5HYOA 1RGQA 2Y7XA 2R2WU 4ABFA 4Y8XA 1C1PA 1V2LT 2B9LA 3Q3XA 5GIBA 1WQVH 2HLDD 1QIXB 2A5AA 2ZQ1A 1SR5C 1CU1A 1JIMA 4ASUD 1XVOA 2FOGA 1SQOA 2ZGCA 4Y8YA 5AF9H 5LGOA 3A8DA 1GCDA 3PRDA 1MH0A 1BTHH 1HAVB 3SORA 3TJNA 1BT7A 1M9UA 4ASHA 4SGBE 2O8MA 3SU6A 3OU0A 1FMGA 1DSUA 1O39A 1AVWA 4K5ZA 1KSNA 5GJ4B 5B6LA 1BRCE 2ODYB 3E91A 4K69A 4I86A 4AB9A 2SGQE 1TIOA 1ELGA 2FLBH 3FVFB 3UAIC 2BD3A 2QXHA 1QA0A 1YY3A 1GCTB 4FU8A 1EZQA 4K1SA 1C2EA 3BEIB 1WQSA 1ZMNA 1C9TA 1K2I1 4O03A 4GVUA 1DPOA 1LPKB 2AMDA 1AVXA 1NFWA 3O8CA 3PRBA 4I8GA 4I8KA 3SZEA 3HGNA 2CF8H 4ACAA 1O3FA 1P3CA 3IITA 9LPRA 4ZXYH 4UEHH 4DG4A 1TOCB 3RC4A 1EFRD 1UCYE 3EYDA 3ATWA 1G2LA 2VWMA 3F0OA 4B1TA 3SW2B 1ZHPA 4MLFB 4OGYA 1JMOH 1SOTA 2FOFA 4JYUH 2QXJA 2FMJA 1C5WB 4MDSA 1MKWH 4I31A 3KF2A 1GBAA 2C93B 1ETTH 1W8BH 4FUJA 1FI8A 1TB6H 4GPGA 1UHBA 5F03A 1RXPA 3SJKA 1ANBA 1TPSA 4R0IA 4WH8A 3KQDA 1YPLH 3F9HA 1ELTA 5FPYA 1P2JA 2P94A 1GJAB 3PO1B 1LTOA 3M5LA 1QL9A 1HFDA 2WINI 1BA8B 1W10U 3SYJA 1K1MA 1SQRA 1V2JT 2DE9A 3S9CA 3M5NA 1OWIA 2J94A 3A7VA 1KDQA 1LMWB 4WVPE 1PQAA 4DURA 3K6ZA 2WPKS 1YP9A 1W11U 2Z9JA 4CBNA 1VITF 4NIVA 2W3IA 4DT7B 1UVTH 3H7TA 3SV6A 4X1RU 1O2HA 1FV9A 1WUNH 2Q6FA 1C4Y2 5DGJA 5FCKA 2XW9A 1UTQA 1SLWB 4BTTB 4GCHG 4THNH 1UTKA 4B76A 4J1YA 1CSOE 3GDSA 3U8OH 4CREA 2SGDE 3D49H 3ATMA 1CVWH 1DANH 1EP5A 1AUJA 2A5IA 3RU4E 3MMGA 3U8RH 3F9FA 5C1YA 3PMHB 1O5DH 2OINA 2RA0A 3SGAE 3OEED 5L2ZH 1GI9B 4H4FA 4QT8C 3URCA 4AX9H 5TCAA 4AN7A 4B2BA 1GG6B 1AZZA 4U32A 1SGRE 1YLDA 1XUJA 1XM1A 4NWLA 3T5FH 3OX7U 4MNVA 1ZMLA 3TH3H 2P3UB 4ISHH 5T6GA 3JZ1B 1BMNH 2GCHF 1LHDH 3F2FA 4MPXA 1ZOMA 1J16A 1SGNE 1BQYA 1TGSZ 2JH5D 1O5EH 1P3EA 2ZHFH 1BIOA 1MAXA 3GY7A 6LPRA 2Z3CA 2GCHG 1TPOA 1C5PA 2W5EA 1H8DH 1K1NA 1G37A 2A2QH 1GBKA 3SN8A 1KXCA 2WZQA 1W7XH 1EQ9A 1XKBC 1T8LA 3QO6A 1MABB 4LZ4B 1H8IH 1KLJH 2CF9H 1BTPA 1CE5A 1P09A 1H1BA 3QX5H 1RD3B 2BQ7B 4A1XA 3A81A 1QL7A 1XUGA 1O2MA 1GVKB 3SQHE 3TNTA 5C5NA 4OS1A 1ARCA 1C2MA 4BAMB 4X1SU 1CBWC 1GHVH 1J14A 3AVZA 3ZZ7A 1K1JA 2J5UA 5EW1H 1AMHA 4TPIZ 1TBQH 3QTOH 3GY2A 1MTNC 3PMBB 4NCYA 1S0QA 3ATKA 1VGCB 1V2NT 5PTPA 1OWEA 1IAUA 2H1UA 3M3VA 3RMNH 2HGTH 3PV5A 4GLYA 1VITH 3UQVA 4K3JA 1DWCH 3E3TA 5LH8A 1RFNA 1B5GH 2BDAA 1PQ5A 2J34A 3EAJA 3HK3B 3W94A 1YCPH 3URDA 1Y59T 2WUBA 1EAIA 1XUIA 3VB3A 4IN1A 1CA0B 1E34B 1ZJDA 2AFQB 3SNAA 4GUXA 1AWHB 1F2SE 1AFQB 4FXGH 4X1NU 5TJXA 2VVUA 1GI0A 4TWYA 3KIDU 2JH6D 4CRBA 4JZEH 4I8HA 1O3JA 1QJ6B 2WV5A 1MZAA 1GI2A 4P02A 1PPZA 2V3MA 2G5NA 1S84A 1G3BA 4GHQA 1PPFE 2AGGX 2FIRH 4JZIA 2PFEA 2OC1A 3RXTA 1C2JA 1WCZA 1KY9A 3GY8A 1Z1JA 2PLXA 1O3AA 3FZZA 1FN6A 1FN8A 1KXDA 3KEEA 3GDUA 2CJIA 5GDSH 1S5SA 1NRSH 3RXSA 2BLWA 2STBE 1Z71A 1EB1H 2PKSC 2ZU1A 1SGEE 2G4TA 1WSSH 2FX6A 3A80A 1GL0E 2C8XB 2W6ID 2IN2A 1SSXA 3LDXH 1P2MA 1ZZZA 2FOCA 5C94A 3BF6H 2WPJS 4X2YA 4TY6A 2C8WB 4AGJA 4HGCA 5EQSA 1JWTA 1ESAA 1H8HD 4YO9A 1WBGB 1SLXB 3BEFB 3D62A 2XCNA 3PLBA 1OS8A 3DHKH 2JJ1D 3AK5A 3NK8A 1DVAH 2FO9A 4ABBA 1D3PB 1UHBB 2BDBA 1YPJH 1DY8A 5IDKA 3MQKC 2RDEA 1YPHE 2WV9A 1LVOA 4CH2B 3UFAA 3M5MA 2PP6A 3RM2H 2OQUA 1A0HB 2Z94A 1PPGE 1CO7E 3V3MA 4MNWA 2FI3E 1OX1A 3UNRA 3BTGE 3R3GB 2QF3A 3SHCH 1Y3UA 1AZ8A 5HKKD 1P57B 1S81A 1TBRH 3FP8E 3RDZA 1OSSA 1ZLRA 2OC8A 1W7GH 3RXDA 2BLVA 1SLUB 1UCYK 2VIWA 1ZGVA 1Q3XA 1TFXA 3GS9A 3ZZ4A 2A31A 1ZSKA 3H09A 3PTNA 3RMOH 5EXLA 1D4PB 4CR5A 1A0LA 1V2OT 4DOQA 3KL6A 2OQ5A 3RXOA 1IQGA 1OXGA 1EJAA 4K1EA 3M3SA 1SMFE 2Q6GA 4YTAA 1IQNA 2AERH 5ETXA 1O2XA 5FAHA 3SGBE 4WJG2 3L3TA 1TNJA 3LJJA 2QC2A 2GV6A 4BAHB 5GCHF 3OAAD 4NA7A 4TY7A 1AU8A 2C4FH 3GY6A 1VCWA 3LC5A 1GI7B 1MBQA 4IBLH 1TONA 4DGJA 4LZ1H 3UNSA 2A5KA 1C2GA 1O3KA 1LHGH 4CHAC 1LHCH 4TPYA 3MO9A 4WH6A 2Y5FA 4XOJA 3ZZDA 4WMEA 5GWZA 2BD4A 3A83A 4MNXA 2Y6TA 3BG4B 3BEUA 3RXVA 3U1IB 1HAHH 2FLRH 3M7TA 4LOYH 5FPTA 1QHRB 3KQBA 4MG3A 2GZ7A 1NTPA 2GZ9A 1C5ZB 3UTUH 3I78A 4FUIA 4B74A 4WMDA 4X6OA 3LGYA 3RXJA 2YNBA 4X8SH 1HJAB 4JZDH 1CA8B 2QF4A 2VWOA 1AVGH 1O5FH 1P06A 2AMQA 2CN0H 1HLTH 1OWKA 2P95A 1AD8H 1TWXB 3WW7A 1KMHB 2ZPRA 3RXBA 1MU8B 2OD3B 3SUGA 1YF4A 1O31A 5FX5A 2FM2A 5AHGH 1O2VA 2ZFFH 4MTBA 3GCHC 5EPNA 2BD2A 2J4IA 3GYMA 1GHYH 1OOKB 1VZQH 4O9VA 2XBVA 2PWXA 1QGFA 4J2YB 3EE0B 1K9OE 3ESTA 1XX9A 1PYTC 2B8OH 5ESBA 4JCNA 3M5OA 1O3MA 2NU0E 1HIAB 1PFXC 3RXEA 1HAOH 3A7ZA 4Y71A 5F8XA 1QB1A 4K1TA 2P16A 1NRRH 2UWOA 4ISIH 3GY5A 1AE8H 2BDGA 3ZVCA 2BD5A 2BYAX 5E0JA 1F7ZA 1ANEA 2K8IA 3AAUA 4NG9H 1O2OA 2FODA 5BPEA 1QB9A 5J4SA 1NBME 4D76A 2YMSC 1A3BH 3FP6E 1COWD 2PGQB 1HAIH 1OYTH 5A2MH 1NC6A 3QK1A 2BDYA 3UIRA 3RXKA 4Z0KA 2JDID 2G52A 1C1WH 2PUXB 4MQAA 2ZIQH 3MHWU 4B6FA 1F5KU 2CV3A 4MPVA 4YOJA 1UW7A 2YMSD 3H5CB 4NWKA 5E8EH 1LVYA 1GHBG 2R0KA 2ZPQA 2AIPA 2HPQH 2GP9B 5JPMH 5L30H 1ZHMA 2NU3E 2FYQA 4HI3A 1W0ZU 3CS7A 1GGDB 3A8AA 3FKSD 1O3PB 1OWHA 3ZV8A 2YOLA 1IQEA 2H5CA 1TQ0B 1P8VC 3TIUA 1E1QD 3AW1A 1XUFA 5CHAB 4I8LA 3BTTE 1LCYA 3EDXB 2ODQA 2KR7A 3SJOA 3OEHD 5GXPA 4X6PA 1N1LA 1KXEA 3Q00A 1HBTH 1C5YB 1YM0A 3F1SB 1S6HA 4E05H 2CK3D 1XVMA 4GAWA 2ZFSA 3FZDA 1GJCB 3JZ2B 1A3EH 1C1VH 3DUXH 2ZWLH 4CH8B 3RLWH 5F6MA 1DWDH 3QLPH 1D3DB 2UWPA 1F5RA 3VB5A 1AB9C 1O32A 1Y5UT 1ZPZA 2H6MA 4RT1A 3KCGH 2C8YB 1HJAC 1O2LA 2A45B 1NZQH 2TGPZ 3UOPA 5EG4A 1TNKA 5I25A 3RMMH 7GCHF 4DCDA 1ESTA 1FPCH 2GCTC 5DG6A 1C5UA 1KTSB 1V2ST 4F48B 3P92A 1XKAC 2ZCHP 5DP3A 5FHTA 1NPMA 2IJOB 5E0HA 2JETC 2BD9A 1QURH 4JYVH 5DO4H 2B5TB 1XUKA 1AB9B 5HM9A 4CRCA 3S7KB 1NBMD 1CHGA 4XD7D 1V3XA 1MTWA 5HM2A 3LC3A 1GGDC 1J8AA 1YPHC 1C9PA 2VNTA 1C5TA 1FY1A 2OP9A 3BV9B 1XUHA 1LKAA 2F83A 1BRAA 2ZFTA 1ELBA 2UUYA 1MD8A 1GJDB 1TYNA 3PLKA 5EQQA 1J9CH 1SGCA 1A0JA 2M5TA 1BBRE 1SGFA 3IWMA 1Z7KA 1TGNA 3ZZ3A 1A4WH 2WV4A 1JRSA 5F8ZA 1S82A 4FUEA 5DP5A 2ODPA 5HIYA 1BTZA 1V2UT 2D2DA 1SG8B 2R9PA 1GI6A 1W13U 1GHXH 1AHTH 4ABJA 4O97A 2V0BA 2ZPSA 2XBYA 1O0DH 1SI5H 2ALVA 1K1OA 1VGCC 3MH4A 1TABE 1BMAA 5A8ZA 3V13A 2AMPA 2Q6DA 3WY8A 4ABDA 4DVAU 5C17A 1G36A 2ZCKP 3E8LA 3DFLA 1FIWA 2AEIH 2P8OB 2RCEA 3AW0A 3RMLH 1Y3VA 1D6WA 1SGTA 3LH3A 2SGPE 2EI7A 3QDZB 2BX4A 2P93A 1C1QA 1SC8U 1ZRKA 2Z9IA 1UTNA 1TOMH 4H6SB 1DE7H 1TX6A 2TIOA 3GOVB 2ZGBH 4D7FA 1SGFG 3TGIE 2GDEH 4K8BA 1C2LA 5EXNA 4XDEA 1GL1A 2FXRA 3RXAA 3KYGA 5DP4A 1GMDG 1GI1A 1GDUA 3DCLA 2SNWA 3RC5A 2F9VA 2RDLA 2ILNA 3MNBA 2AGEX 1TGCA 1HYLA 1ABJH 1O2QA 2PW8H 4XBDA 3AAVA 2HVXA 3T2NA 1DWBH 1BB0B 4JK5A 4VGCB 5T3HA 2G4UA 3RC6A 3CP7A 4ABGA 2ZGJA 3UUZA 5HMAA 5IYTA 5EXMA 1INCA 5A8YA 1RIWB 3TK6A 2NWNA 1TGBA 2JJ2D 1TAWA 3OE7D 4BTIB 3VGCB 1JBUH 1TRNA 2BQ6B 4YXWD 3ZZ5A 2QE7D 3QGJA 2PKAB 4ZUHA 3V12A 2YNAA 4ZKSU 4BAQB 1ZTLA 3MWIU 5JBAS 2BZ6H 2CHAB 5C5OA 1ZPCA 4NFEA 4B2AA 2BDCA 1P2IA 2OK5A 1SGIB 1RIWC 2J38A 3K9XB 4H6TA 8KME2 1NRQH 3KQCA 2QF5A 1E0FD 1W0KD 5DKMA 1QB6A 3E1XB 4YOGA 4FUFA 1GBMA 3BN9A 2Y7ZA 1K0HA 3ZVBA 5JBCS 1HNEE 2EQNA 1P2KA 3T62A 1RS0A 3FO8D 1SFIA 2VWNA 2K0QA 1TNHA 2OC7A 3BTEE 3V7TA 2ZEBA 2ANWA 1C5VA 1A2CH 2FS8A 2ZU5A 1O2YA 4XRNA 1KDQB 4ZKOU 1GBLA 1ELDE 4Y11E 2P8OC 8LPRA 2VIOA 3DA9B 1ELCA 1P9SA 2NU4E 4BNRA 1W12U 1Z6EA 1QL8A 2QXIA 1Z8RA 3ZZCA 2H9TH 1T4VH 3RXQA 4KKDA 3D23A 4A5TS 3Q77A 3O8BA 3MH5A 3AASA 5C2ZA 1NRPH 1Z1IA 4IW4E 3F2GA 4AOQA 2BOKA 2BB4A 1V2KT 4AORA 1AE5A 2G00A 1DICA 3KGPA 3MU4A 1C5XB 1LHFH 3TITA 4ABEA 1BOQA 3T25A 3ZZBA 1D3QB 5TCCA 1NM6A 2GKVE 2UUFB 4YZUA 2I6QA 4NIYA 2H9EH 2ZC9H 2W7SA 1GHWH 2F4LA 3NWUA 3HK6B 3MNSA 5EW2H 1HV7A 1LKBA 1P05A 2C3SA 4IC6A 1NFXA 2BLQA 2NU1E 4FU9A 3SV7A 3TNSA 1GDNA 2LNCA 2ZFQH 1GBFA 2P59A 2QN5T 4M7GA 3KQ5A 3S7HB 1B0EA 1BMMH 1JRTA 1O2GH 3RUOA 2VWLA 1P04A 3TJUA 1O3HA 2GCTB 1RRKA 3O8RA 2A4GA 1G2MA 2ZDLA 3U69H 1FIZA 2ANKH 2HRVA 1FDPA 3DT0H 4UD9H 4BTUB 5A0BA 1P2QA 3KYFA 4OS7A 4OS5A 3RXCA 1LQEA 2AH4X 2ZCLP 1QBNA 1A5GH 4AYYB 1AFEH 1UVPA 1D9IA 2AS9A 1S85A 1DITH 4Q7YA 2PTCE 2ZA5A 1MCVA 3GY4A 4GHTA 2WPLS 3KHVA 1VCPA 4JK6A 1BRBE 1AWFH 2EA3A 3E0PB 1DS2E 1C1RA 1DUAA 1V6DA 5C0UA 4DT4A 2WPIS 1T31A 2XBWA 5EJ1A 2ASUB 3PV4A 5FX6A 3C1KA 2GDDA 2A1DB 4WWYA 4NZLA 4B2CA 1DLKB 2IPQX 3ZVGA 1C4U2 5HXFA 1EAWA 1O3EA 5A0AE 1AI8H 1LPZB 2Y81A 1L4ZA 3E6PH 2ZZUH 1N6YA 1SGYE 1O2PA 4Y0YE 4NA8A 5CE1A 4R8TB 1T8NA 3UR9A 3A8CA 1GBHA 4Y79A 2Z9GA 1BJVA 1MKXH 4INLA 4Q7XA 1EXFA 3B8JA 1ZGIA 1ACBE 4ZROA 1TALA 1NT1A 5DPAA 3VB4A 6CHAC 1UTJA 1NN6A 4KTCA 5C0TA 4FUDA 2SGFE 1UTMA 3R0FA 3SI3H 2JIZD 4YM9A 4B73A 3HATH 1QBVH 1P12E 1MTNB 1SGPE 2ZECA 1NY22 3G01A 1AGJA 1L1NA 1NU9A 1SB1H 2FDAA 4X6MA 4Y0ZE 2GJGA 1GJ5H 6GCHG 2KM0A 3SJIA 1LVMA 1GJ8B 3M36A 3PM3A 3SZNA 4D8NA 4INHA 4JYTA 4MVNA 1V2PT 1MAYA 2D1JA 1V2QT 4BXWA 2YMSB 1NO9H 4FUCA 5CMXH 5FPSA 2ALPA 4A1TA 2SFAA 1MQ6A 4BOHA 3ZVDA 1C1SA 3QTVH 3QN7A 2L6OA 5B6OA 1Z8JB 1BTXA 3FP7E 3RXRA 3ODFA 4MPWA 3GISB 2J95A 3RXFA 4AC9A 4DY7B 1DLEA 4Q2KA 1F0TA 1HAYB 1DWEH 1FUJA 1EPTB 6ESTA 2FYRA 4CR9A 3UPEA 2Z3DA 4X8UH 3SV2H 3P8NA 2B7DH 2W3KA 4Z1MD 1O5GH 2GV7A 3PLPA 1THSH 1GBDA 3MYWA 1IHTH 3BTFE 4NZQA 3L33A 2LP6A 1O5AB 2VIDA 1MU6B 4X1QU 1GMCG 3S9BA 3VGCC 2XWAA 1O2RA 1PPBH 1DT2A 1EJMA 1QJ1B 2AIQA 3NRLA 5AFZH 5ABWA 5C1XA 3S9AA 3DFJA 2XWBI 1O2TA 2JKHA 1O3BA 1Z6JH 2SGAA 2HPPH 1IQMA 3ZZ6A 5EJZA 3P95A 4Y76A 3IG6B 3SNDA 1FZZA 1C2FA 1GHAF 1SOZA 1UTLM 4P00A 3BG8A 2GT8A 2W6JD 2FOMB 3E0NB 5SGAE 2ZTYA 1HPGA 3LKWA 2FI4E 1GHAG 4XFQA 1A5HA 5KGOA 4B6EA 2G81E 1EAXA 3STJA 2BY7X 2VGCC 2J2UA 1O2SA 2F91A 3BG4C 3PMAB 3QUMP 3M61U 1OWDA 1F0RA 5KEDA 2KZ4A 4E7RG 2EY4C 1O33A 2BTCE 1ZRBA 2WPDD 4ABIA 3V0XA 1KYNA 3ZYEA 2DE8A 2JH0D 1B0FA 2BY9X 2D8WA 2NU2E 1YWUA 3SNBA 1QJ7B 3PTBA 4CHAB 1ETSH 3F3BA 3TVJB 2GVFA 1FY8E 3L6PA 1KXAA 1ANDA 2GD4B 2BM2A 1WXRA 3LIWA 5CHAC 3U98H 1DSTA 4FETA 1QR3E 1ZSJA 1NROH 3CENA 2BXTH 2FOBA 6GCHF 1YC0A 4GCHF 3HGPA 3SUFA 3UWJH 3TH2H 3ENSB 3TJVA 1OP8A 1BBRH 1WOFA 1FY4A 1MD7A 3LGIA 1S6FA 3SU4A 1CQQA 4UDWH 2FOEA 4K2YA 1TMBH 3SV8A 1DXWA 2Y5HA 2ZQ2A 1WYKA 1FNIA 1MTUA 3SUDA 2EEKA 4XSKU 2FPZA 2J92A 4UONA 2ZTXA 2HNTC 3N7EA 2VGCB 1G3EA 3CS0A 3NUMA 4YT7H 2XRCA 5A0CA 1O36A 2QCYA 4Z6AH 1GBJA 2ZTZA 3NKKA 3SHAH 1C5RA 3ZV9A 3ZVEA 1ELAA 3GY3A 2VVCA 3QGNB 1HXFH 4Y7AA 3SBKA 3SU2A 2L74A 4FU7A 1QNJA 3GCOA 1ZPBA 1P03A 2PKAA 1O3GA 3BIVH 5T1VA 2XOKD 2WYGA 2O8TA 2V7QD 3VEQB 1IQFA 2VIQA 3LGVA 1LO6A 1FY3A 3VB6A 2FESH 1HAXB 2BDHA 1ZTKA 1FXYA 1TNIA 4RN6A 3F0PA 1ELFA 4YLQH 4LXBH 2ZHEH 1VITG 1S6LA 3OTJE 1O2UA 4IMZA 4BANB 4AGKA 1HDTH 3EQ0H 2VVVA 3P17H 2WYJA 3F2HA 3SO3A 1G9IE 3I77A 1YYY1 1BITA 2PKSB 4LK4A 2F3CE 2KAIA 1H8ED 1ESBA 2ZHWH 1ZTJA 1GI5A 1KLIH 1UO6A 1T7CA 1EOLA 2C90B 3LPRA 2H9HA 2C8ZB 3ZYDA 1GMHF 1O3CA 1THPB 2CMYA 3GDVA 4NFFA 3UQOA 3FN8A 3CNRA 4ZHAA 2VIVA 1GMHG 2XTTB 3ZZAA 1EZUC 1SQAA 1MUEB 4MNYA 2O9QA 1OP2A 3VPKA 1QBOA 4BAOB 1E35B 1UVSH 2PSYA 3MU5A 3SNEA 4DIHH 3MI4A 3A82A 2AGIX 1BZXE 3ZIAD 1YPGH 2Y5GA 4ZMAH 2GMTB 1YPKH 1GBCA 3E16B 2FWWA 2XC4A 5HGGA 3PWBA 3MNXA 2A7CA 1C1OA 3QWCH 1H9LB 1P02A 4NSYA 1QCPA 3BSQA 5DP9A 4X2WA 1TPPA 1L4DA 4X1PU 1TX7A 4DJZB 2ZO3H 3LGUA 4ZHMU 1K28D 2ZNKH 6CHAB 3P6ZB 1O30A 1MTSA 3NCLA 2VINA 1WV7H 2PGBB 1H9IE 3EA8A 1LQDB 5JB9S 3EE7A 2FZZA 1CGJE 1O38A 2ANYA 1YPEH 3SQEE 1XXFA 3M7QA 1KXBA 4KTUA 1X7AC 1QQ4A 1SQTA 3NXPA 3B9FH 1OPHB 3TH4H 5CHBA 3P70B 4ZKNU 1IQIA 1C5QA 1A1RA 1P2OA 3Q3YA 5F53A 1TMUH 2J98A 4JMYA 2F9PA 1MBMA 5C3NA 5IK2D 3EGKH 3BIUH 3UNQA 2ZDVH 5LPFA 5FBEA 2A4OA 2ZU4A 2ZDKA 3MH7A 2OC0A 1GBTA 4XBCA 2BY8X 1GG6C 3OY6U 1ORFA 1T8OA 4I8JA 1NFYA 2WUCA 3W95A 3BTME 2O8LA 2CHAC 1VCQA 2PHBA 1QRXA 2UUJB 3H7OA 1C2HA 1G30B 1T4UH 2QIQA 1L0ZA 4RKOB 4Q80A 1V2TT 3EA7A 2WPHS 4HZHA 2HOBA 8ESTE 1FONA 2VB0A 3NZIA 3SU0A 1F5LA 1Z8IB 2P3TB 2Y82A 1Y3XA 3P8GA 3MU8A 1O5CB 1LPGB 1NFUA 1E36B 4ZHLU 2BDIA 5GCHG 1KIGH 2PTNA 1IOEA 1NS3A 1RTLA 5JBBS 4TT3D 1GJ6A 2ANMH 1H9HE 1K22H 1P10A 2BVSH 3PYHA 1LHEH 1QRZA 4RKJB 3A89A 3LONA 5BRRE 5EPYA 5FCRA 4FVDA 5FL7D 2WHXA 2FS9A 3VG8A 3ZZ8A 1C5SA 4E06H 3T27A 1W14U 5DP6A 3BTHE 3T28A 1C5MD 1XXDA 3ITIA 1GBIA 1ZHRA 4OS4A 4OS6A 5G4BA 2ZHDA 3BTWE 1HB0B 4B71A 2OBQA 1FAKH 2PV9B 4HTCH 3RU4T 4A6LA 1O2ZA 2BHGA 4WMFA 3PMJA 1WDIA 4NSVA 2FI5E 3OSYA 2UUKB 1GI3A 2CGAA 4CBOA 4JZ1A 3BTDE 2W7UA 1PQ8A 1TLDA 1V2MT 2KCPA 3P8FA 4B75A 5CDFE 4AYVB 2TGDA 1V2RT 1AY6H 1MZDA 1WAYB 1EKBB 1Q2WA 3A84A 1S0RA 1RJXB 2BD8A 2OTVA 4Y10E 4H42U 1N8OC 3MH6A 5E0GA 1TNLA 1O34A 3T29A 1SHYA 2GTBA 2Z6BD 2EC9H 3A87A 2LPRA 3WWBA 4WY3A 4AG2A 3OTPA 4HFPB 3ODDA 2BOHB 4KGAA 1VJ9U 2O8WA 3KNXA 1BUIA 3A7TA 3TK9A 2BLOA 4YT6H 1ZSLA 1ZYOA 5GPIB 3MU0A 2WSSD 2O8UA 5E2OA 3TPIZ 2ZGXH 2AHME 1SPJA 1TGTA 3RXPA 4KELA 4AFSA 1HRTH 3OFND 1G3DA 1GHBF 4F55A 4NIWA 1BTYA 3N99A 3P8OA 7GCHG 2BY5X 2XNDD 1J17T 3LGWA 5C67A 3SOSA 1GI8B 1TNGA 2ZP0H 4A7IB 2FTLE 3SJ9A 5JDUB 4Q63A 4UFEH 1PPHE 1N8OB 1ELEE 2ZG0H 1PPEE 3RM0H 1O3OA 1ELVA 2Z7FE 1GJ9B 1OHHD 2OUAA 1DM4B 1BJUA 4U01A 1MQ5A 3E90B 3SGQE 5DSFA 1O3IA 5A8XA 4I33A 2EI6A 2TPIZ 2ZGHA 3U28C 1CGHA 1KLTA 4UFFH 5E2PA 2GX4A 1MKWK 1D3TB 1BCUH 3RXGA 1QTFA 1GJ7B 1NU7B 4RSPA 1CGIE 3F9GA 3EA9A 2P3FH 4NA9H 3ZZ9A 1GJBB 3F9EA 1AUTC 1O2NA 1UK4A 2GT7A 1N6XA 2F43B 1FAXA 1TX8A 1BBRK 1BMLA 5EODA 9ESTA 7ESTE 1UK2A 2FTMA 2PUQH 2ZF0H 2ZDAH 1FX0B 2PSXA 4IGDA 3RXLA 4XE4A 2Z9LA 2R3UA 1O2IA 1THRH 1YPMH 8GCHG 1YLNA 3HKJB 1UVOA 1L1GA 2F9OA 5LPRA 1OYQA 3FANA 4KTSA 2QAAA 8GCHF 1LVBA 1JXPA 2V3OH 3C27B 3I29A 1ZR0A 4OGXA 3K6YA 4FUHA 1ANCA 1YGCH 2J98B 1HAPH 4M9FA 3PROA 4ACBA 1TQ7B 3SNCA 1AKSB 2G8TA 2Z9KA 2KCYA 2AYWA 1Q31A 1O3NA 3TGKE 1C2DA 2CXVA 2ZKSA 1TPAE 3A7YA 5FBIA 3F68H 1E1RD 1OP0A 4CRFA 2KCOA 1IQKA 5AVDA 1FQ3A 4D9RA 1YCPK 4GSOA 5T6DA 1QQUA 1C5LH 2H5DA 1WU1A 2RFKC 5DK1A 4TWWA 4TYDA 1GBEA 2F9UA 3UOUA 4RT0A 1TA2A 4U30A 2QV1A 4AZ2B 7KMEH 1MKXK 3RLYH 1E79D 1DX5M 2J9NA 2OXSA 1FPHH 1IQHA 2V3HH 1SVPA 1Y8TA 3GICB 2KFWA 1SL3A 2QYIA 3LGTA 4ZAEA 3LJOA 2A7HA 2KX4A 4Y7BA 1O37A 4X6NA 1HAZB 2IJD1 1O3DA 1PQ7A 1AQ7A 1W0YH 3VFEA 1WTGH 2R2MB 2OCVB 5EU8A 3SV9A 1A7SA 1C2KA 1QFKH 2VH0A 2ZFPH 3F6UH 3ATIA 2TBSA 4X2XA 3TLOA 2XYAA 5DP7A 4ESTE 1CHOF 1H4WA 2ULLA 5K7RA 4FVBA 4HG6A 1AKSA 3STIA 2HALA 1EOJA 3GCHB 3T26A 3U9AH 1TA6A 4YOIA 1K1IA 1GVLA 1W2KH 2IOTA 2ZDMA 2XNIA 1IHSH 1C4V2 3M7UA 2D26C 2TRMA 4Y8ZA 3UR6A 5ESTE 2BY6X 1VJAU 4AFUA 1A61H 4CRAA 1L2EA 2BD7A 4ZXXH 3U1JB 3A7XA 1GVZA 1TRYA 1ID5H 1QY6A 5EGMA 3N7DA 1GCTC 5DP8A 1KTTB 3MO3A 1PYTD 1HJ8A 2SNVA 2ZU2A 3QZRA 5LPEA 3SUEA 1DUEA 1BDAA 3GCTF 3LT3A 4ISLA 3ZVAA 2JETB 2GGVB 2EI8A 5JB8S 3PB1E 3Q3KA 2A4RA 4ZKRU 1YBWA 4SGAE 1ARBA 3ATLA 4IMQA 1GPZA 1TE0A 2FX4A 1EZXC 4U2WA 4WXIA 3SU3A 1TMTH 2OLGA 1MMJN 3K65B 2W26A 1OWJA 1A46H 1EASA 3HPTB 1LDTT 3DSOA 1T8MA 3MTYA 2FOAA 1EPTC 4ZCNA 3OY5U 1L1JA 1ETRH 3A85A 4UE7H 3UY9A 5EOKA 1EJNA 2ZFRH 4Q7ZA 4A1VA 1P11E 1JIRA 1O5BB 2F9BH 1FLEE 4JZFH 2R0LA 2XC0A 2STAE 1KXFA 5C1UA 1SKYE 2H2ZA 3SU5A 4ABAA 2BVRH 1CT4E 3LU9B 1IQJA 3NPSA 1YCPM 4RI0A 3MO6A 1ZMJA 4UFGH 1YLCA 4O3TA 1G32B 4ISNA 1QZ8A 2A7JA 3MNCA 2J97A 2A32A 1GBBA 3VB7A 4D7GA 3MU1A 3M3TA 1DFPA 4AB8A 2RA3A 2QGRA 1NESE 1S83A 5KECA 1E38B 2BX3A 3TJOA 3D65E 2FEQH 1EX3A 2OBOA 2LELA 2XXLA 4X0WU
chains in the Genus database with same CATH topology
4UFDH 1B7XB 1DXPA 4MPUA 1O2JA 1CA0C 4F49A 4I32A 1EPTA 4O3UA 1EATA 2PR3A 4DIIH 2HWLB 4K8YA 4CRDA 4I7YH 2VU8E 3SJ8A 1HIAA 2V6NA 2THFB 3M35A 1V2VT 2QF0A 2SGEE 1HCGA 4X2VA 2ZI2H 1ABIH 2HLCA 4CRGA 7LPRA 1CHOG 3TU7H 5JYIA 4BXSA 1RTKA 2A4QA 1HAVA 1P0SH 2FP7B 4ZH8A 2XCFA 2ZHQH 1O35A 1O2KA 1OKXA 2G55A 2ZU3A 1GI4A 2VH6A 1UTOA 1EZSC 5A09A 3LH1A 1SBWA 1O2WA 4XBBA 4FUBA 5FXLA 1W3CA 1EAUA 1C1NA 1WTHD 3VXFH 1QA7A 4KP0A 2F9NA 2FOHA 5AFYH 1IQLA 2XC5A 3A8BA 3PWCA 2QA9E 3RXMA 1P9UA 1QRWA 1GMCF 1C5OH 2QY0B 3TGJE 2R3YA 1C1MA 2BVXH 2VIPA 1DY9A 5EQRA 3O8DA 5J4QA 2Q1JA 4BAKB 3RXHA 4PROA 1AO5A 3RP2A 1XMNB 1P2NA 2A2XH 3FAOA 4AFZA 2IPHA 5L2YH 1AIXH 1RTFB 2BMGB 2Z3EA 3S0NA 5T6FA 1GDQA 1K1LA 4D9QA 3HKIB 1DDJA 1BTUA 1SLVB 3BTKE 3GYLB 3RXUA 1UTPA 1P01A 1V2WT 1FY5A 5I46H 1SFQB 3VXEH 3U8TH 2A0QB 1NRNH 4F4OC 1PJPA 2V35A 3GCNA 4FUGA 1JOUB 4X8TH 3OYPA 4ABHA 1T32A 4INKA 4NGAH 1DOJA 1EP6A 1C5NH 2RG3A 3MFJA 4VGCC 1U6QA 1A5IA 1FJSA 1UK3A 3UWIA 4IN2A 1F92A 1K1PA 1TRMA 1AFQC 4AFQA 1GWAA 2ESTE 1SGDE 4YESB 4X8VH 1VR1H 2HNTE 3M37A 1HAGE 4K60A 2BQWB 2WPMS 3ELAH 1CBWB 1HGTH 4OS2A 2HNTF 3RXIA 1E37B 4YLUA 2TGAA 4AG1A 2ZDNA 2G5VA 2Y80A 1Y5AT 4IS5A 1O3LA 2BXUH 1D6RA 1CT0E 3PO1C 1GHZA 1HJ9A 3SU1A 3TK5A 2GZ8A 3GCTG 5F8TA 3UREA 2I6SA 1C1TA 1G3CA 3A88A 3SI4H 2QXGA 3LOXA 4E7NA 3B23B 5DJ7A 5H4IB 5JBTA 3Q76A 1UJ1A 2BZAA 1C1UH 3KN2A 3FFGA 1YKTA 1SHHB 2TGTA 3K2UA 1PPCE 2G51A 3MOCA 4IC5A 4WF8A 2GMTC 1Z8GA 1BHXB 1GJ4H 1AN1E 4NIXA 4A92A 1F0UA 2KAIB 1MCTA 1BHXF 3A86A 4ISOA 2B0FA 2UWLA 2VJ1A 1J15A 3ZVFA 5K0HA 1TBZH 1CT2E 4DW2U 5L6NH 1SGQE 1MTVA 3BTQE 4WXVA 1HXEH 1EB2A 1UVUH 1UCYH 4Y6DA 1Y3YA 2K1QA 1Y5BT 3QZQA 2DUCA 1EUFA 1GMDF 1F0SA 1K21H 5C20A 3A7WA 1BRUP 3N7OA 3DD2H 1ZJKA 3KQEA 1Y3WA 1HUTH 1BTWA 1UMAH 3RU4D 2XBXA 1C2IA 3S69A 5HYOA 1RGQA 2Y7XA 2R2WU 4ABFA 4Y8XA 1C1PA 1V2LT 2B9LA 3Q3XA 5GIBA 1WQVH 1QIXB 2A5AA 2ZQ1A 1SR5C 1CU1A 1JIMA 1XVOA 2FOGA 1SQOA 2ZGCA 4Y8YA 5AF9H 5LGOA 3A8DA 1GCDA 1MH0A 1BTHH 1HAVB 3SORA 3TJNA 1BT7A 1M9UA 4ASHA 4SGBE 2O8MA 3SU6A 3OU0A 1FMGA 1DSUA 1O39A 1AVWA 4K5ZA 1KSNA 5GJ4B 1BRCE 2ODYB 3E91A 4K69A 4AB9A 2SGQE 1TIOA 1ELGA 2FLBH 3FVFB 2BD3A 2QXHA 1QA0A 4FU8A 1GCTB 1EZQA 4K1SA 1C2EA 3BEIB 1WQSA 1ZMNA 1C9TA 1K2I1 4O03A 4GVUA 1DPOA 1LPKB 2AMDA 1AVXA 1NFWA 3O8CA 4I8GA 4I8KA 3HGNA 2CF8H 1O3FA 1P3CA 3IITA 9LPRA 4ZXYH 4UEHH 4DG4A 1TOCB 3RC4A 1UCYE 3EYDA 3ATWA 1G2LA 2VWMA 4B1TA 3SW2B 1ZHPA 4MLFB 4OGYA 1JMOH 1SOTA 2FOFA 4JYUH 2QXJA 2FMJA 1C5WB 4MDSA 1MKWH 4I31A 3KF2A 1GBAA 2C93B 1ETTH 1W8BH 4FUJA 1FI8A 1TB6H 4GPGA 1UHBA 5F03A 1RXPA 3SJKA 1ANBA 1TPSA 4R0IA 4WH8A 3KQDA 1YPLH 3F9HA 1ELTA 5FPYA 1P2JA 2P94A 1GJAB 3PO1B 1LTOA 3M5LA 1QL9A 1HFDA 2WINI 1BA8B 1W10U 1K1MA 1V2JT 2DE9A 3S9CA 3M5NA 1OWIA 2J94A 3A7VA 1KDQA 1LMWB 4WVPE 1PQAA 4DURA 3K6ZA 2WPKS 1YP9A 1W11U 2Z9JA 4CBNA 1VITF 4NIVA 2W3IA 4DT7B 1UVTH 3H7TA 3SV6A 4X1RU 1O2HA 1FV9A 1WUNH 2Q6FA 1C4Y2 5DGJA 5FCKA 2XW9A 1UTQA 1SLWB 4BTTB 4GCHG 4THNH 1UTKA 4B76A 4J1YA 1CSOE 3GDSA 3U8OH 4CREA 2SGDE 3D49H 3ATMA 1CVWH 1DANH 1EP5A 1AUJA 2A5IA 3RU4E 3MMGA 3U8RH 3F9FA 5C1YA 3PMHB 1O5DH 2OINA 2RA0A 3SGAE 5L2ZH 1GI9B 4H4FA 4QT8C 3URCA 4AX9H 5TCAA 4AN7A 4B2BA 1GG6B 1AZZA 4U32A 1SGRE 1YLDA 1XUJA 1XM1A 4NWLA 3T5FH 3OX7U 4MNVA 1ZMLA 3TH3H 2P3UB 4ISHH 5T6GA 3JZ1B 1BMNH 2GCHF 1LHDH 4MPXA 1ZOMA 1J16A 1SGNE 1BQYA 1TGSZ 2JH5D 1O5EH 1P3EA 2ZHFH 1BIOA 1MAXA 3GY7A 6LPRA 2Z3CA 2GCHG 1TPOA 1C5PA 2W5EA 1H8DH 1K1NA 1G37A 2A2QH 1GBKA 3SN8A 1KXCA 1W7XH 1EQ9A 1XKBC 1T8LA 3QO6A 4LZ4B 1H8IH 1KLJH 2CF9H 1BTPA 1CE5A 1P09A 1H1BA 3QX5H 1RD3B 2BQ7B 4A1XA 3A81A 1QL7A 1XUGA 1O2MA 1GVKB 3SQHE 3TNTA 5C5NA 4OS1A 1ARCA 1C2MA 4BAMB 4X1SU 1CBWC 1GHVH 1J14A 3AVZA 3ZZ7A 1K1JA 5EW1H 1AMHA 4TPIZ 1TBQH 3QTOH 3GY2A 1MTNC 3PMBB 4NCYA 1S0QA 3ATKA 1VGCB 1V2NT 5PTPA 1OWEA 1IAUA 2H1UA 3M3VA 3RMNH 2HGTH 4GLYA 1VITH 3UQVA 4K3JA 1DWCH 3E3TA 5LH8A 1RFNA 1B5GH 2BDAA 1PQ5A 2J34A 3EAJA 3HK3B 3W94A 1YCPH 3URDA 1Y59T 2WUBA 1EAIA 1XUIA 3VB3A 4IN1A 1CA0B 1E34B 1ZJDA 2AFQB 3SNAA 4GUXA 1AWHB 1F2SE 1AFQB 4FXGH 4X1NU 5TJXA 2VVUA 1GI0A 4TWYA 3KIDU 2JH6D 4CRBA 4JZEH 4I8HA 1O3JA 1QJ6B 2WV5A 1MZAA 1GI2A 1PPZA 2G5NA 1S84A 1G3BA 4GHQA 1PPFE 2AGGX 2FIRH 4JZIA 2PFEA 2OC1A 3RXTA 1C2JA 1WCZA 1KY9A 3GY8A 1Z1JA 2PLXA 1O3AA 3FZZA 1FN6A 1FN8A 1KXDA 3KEEA 3GDUA 2CJIA 5GDSH 1S5SA 1NRSH 3RXSA 2BLWA 2STBE 1Z71A 1EB1H 2PKSC 2ZU1A 1SGEE 2G4TA 1WSSH 2FX6A 3A80A 1GL0E 2C8XB 2IN2A 1SSXA 3LDXH 1P2MA 1ZZZA 2FOCA 3BF6H 2WPJS 4X2YA 4TY6A 2C8WB 4AGJA 4HGCA 5EQSA 1JWTA 1ESAA 4YO9A 1WBGB 1SLXB 3BEFB 3D62A 2XCNA 3PLBA 1OS8A 3DHKH 3NK8A 1DVAH 2FO9A 4ABBA 1D3PB 1UHBB 2BDBA 1YPJH 1DY8A 5IDKA 1YPHE 1LVOA 4CH2B 3UFAA 3M5MA 3RM2H 2OQUA 1A0HB 2Z94A 1PPGE 1CO7E 3V3MA 4MNWA 2FI3E 1OX1A 3UNRA 3BTGE 3R3GB 2QF3A 3SHCH 1Y3UA 1AZ8A 1P57B 1S81A 1TBRH 3FP8E 3RDZA 1OSSA 1ZLRA 2OC8A 1W7GH 3RXDA 2BLVA 1SLUB 1UCYK 2VIWA 1ZGVA 1Q3XA 1TFXA 3ZZ4A 2A31A 1ZSKA 3PTNA 3RMOH 5EXLA 1D4PB 4CR5A 1A0LA 1V2OT 4DOQA 3KL6A 2OQ5A 3RXOA 1IQGA 1OXGA 1EJAA 4K1EA 3M3SA 1SMFE 2Q6GA 4YTAA 1IQNA 2AERH 5ETXA 1O2XA 5FAHA 3SGBE 4WJG2 3L3TA 1TNJA 3LJJA 2QC2A 2GV6A 4BAHB 5GCHF 4NA7A 4TY7A 1AU8A 2C4FH 3GY6A 1VCWA 3LC5A 1GI7B 1MBQA 4IBLH 1TONA 4DGJA 4LZ1H 3UNSA 2A5KA 1C2GA 1O3KA 1LHGH 4CHAC 1LHCH 4TPYA 3MO9A 4WH6A 2Y5FA 4XOJA 3ZZDA 4WMEA 5GWZA 2BD4A 3A83A 4MNXA 2Y6TA 3BG4B 3BEUA 3RXVA 3U1IB 1HAHH 2FLRH 3M7TA 4LOYH 5FPTA 1QHRB 3KQBA 4MG3A 2GZ7A 1NTPA 2GZ9A 1C5ZB 3UTUH 3I78A 4FUIA 4B74A 4WMDA 4X6OA 3LGYA 3RXJA 2YNBA 4X8SH 1HJAB 4JZDH 1CA8B 2VWOA 1AVGH 1O5FH 1P06A 2AMQA 2CN0H 1HLTH 1OWKA 2P95A 1AD8H 1TWXB 2ZPRA 3RXBA 1MU8B 2OD3B 3SUGA 1YF4A 1O31A 5FX5A 2FM2A 5AHGH 1O2VA 2ZFFH 4MTBA 3GCHC 5EPNA 2BD2A 2J4IA 3GYMA 1GHYH 1OOKB 1VZQH 4O9VA 2XBVA 2PWXA 1QGFA 4J2YB 3EE0B 1K9OE 3ESTA 1XX9A 1PYTC 2B8OH 5ESBA 4JCNA 3M5OA 1O3MA 2NU0E 1HIAB 1PFXC 3RXEA 1HAOH 3A7ZA 4Y71A 5F8XA 1QB1A 4K1TA 2P16A 1NRRH 2UWOA 4ISIH 3GY5A 1AE8H 2BDGA 3ZVCA 2BD5A 2BYAX 5E0JA 1F7ZA 1ANEA 3AAUA 4NG9H 1O2OA 2FODA 5BPEA 1QB9A 5J4SA 4D76A 1A3BH 3FP6E 2PGQB 1HAIH 1OYTH 5A2MH 1NC6A 3QK1A 2BDYA 3UIRA 3RXKA 4Z0KA 2G52A 1C1WH 2PUXB 4MQAA 2ZIQH 3MHWU 1F5KU 2CV3A 4MPVA 4YOJA 3H5CB 4NWKA 5E8EH 1LVYA 1GHBG 2R0KA 2ZPQA 2AIPA 2HPQH 2GP9B 5JPMH 5L30H 1ZHMA 2FYQA 2NU3E 4HI3A 1W0ZU 3CS7A 1GGDB 3A8AA 1O3PB 1OWHA 3ZV8A 2YOLA 1IQEA 2H5CA 1TQ0B 1P8VC 3TIUA 3AW1A 1XUFA 5CHAB 4I8LA 3BTTE 1LCYA 3EDXB 2ODQA 3SJOA 5GXPA 4X6PA 1N1LA 1KXEA 3Q00A 1HBTH 1C5YB 1YM0A 3F1SB 1S6HA 4E05H 1XVMA 4GAWA 2ZFSA 3FZDA 1GJCB 3JZ2B 1A3EH 1C1VH 3DUXH 2ZWLH 4CH8B 3RLWH 5F6MA 1DWDH 3QLPH 1D3DB 2UWPA 1F5RA 3VB5A 1AB9C 1O32A 1Y5UT 1ZPZA 2H6MA 3KCGH 2C8YB 1HJAC 1O2LA 2A45B 1NZQH 2TGPZ 3UOPA 5EG4A 1TNKA 5I25A 3RMMH 7GCHF 4DCDA 1ESTA 1FPCH 2GCTC 5DG6A 1C5UA 1KTSB 1V2ST 3P92A 1XKAC 2ZCHP 5DP3A 5FHTA 1NPMA 2IJOB 5E0HA 2JETC 2BD9A 1QURH 4JYVH 5DO4H 2B5TB 1XUKA 1AB9B 5HM9A 4CRCA 3S7KB 1CHGA 1V3XA 1MTWA 5HM2A 3LC3A 1GGDC 1J8AA 1YPHC 1C9PA 2VNTA 1C5TA 1FY1A 2OP9A 3BV9B 1XUHA 1LKAA 2F83A 1BRAA 2ZFTA 1ELBA 2UUYA 1MD8A 1GJDB 1TYNA 3PLKA 5EQQA 1J9CH 1SGCA 1A0JA 2M5TA 1BBRE 1SGFA 3IWMA 1Z7KA 1TGNA 3ZZ3A 1A4WH 2WV4A 1JRSA 5F8ZA 1S82A 4FUEA 5DP5A 2ODPA 1BTZA 1V2UT 2D2DA 1SG8B 2R9PA 1GI6A 1W13U 1GHXH 1AHTH 4ABJA 4O97A 2V0BA 2ZPSA 2XBYA 1O0DH 1SI5H 2ALVA 1K1OA 1VGCC 3MH4A 1TABE 1BMAA 5A8ZA 3V13A 2AMPA 2Q6DA 3WY8A 4ABDA 4DVAU 1G36A 2ZCKP 3E8LA 3DFLA 1FIWA 2AEIH 2P8OB 2RCEA 3AW0A 3RMLH 1Y3VA 1D6WA 1SGTA 3LH3A 2SGPE 2EI7A 3QDZB 2BX4A 2P93A 1SC8U 1C1QA 1ZRKA 2Z9IA 1UTNA 1TOMH 4H6SB 1DE7H 1TX6A 2TIOA 3GOVB 2ZGBH 4D7FA 1SGFG 3TGIE 2GDEH 4K8BA 1C2LA 5EXNA 4XDEA 1GL1A 2FXRA 3RXAA 5DP4A 1GMDG 1GI1A 1GDUA 2SNWA 3RC5A 2F9VA 2RDLA 2ILNA 3MNBA 2AGEX 1TGCA 1HYLA 1ABJH 1O2QA 2PW8H 4XBDA 3AAVA 2HVXA 3T2NA 1DWBH 1BB0B 4JK5A 4VGCB 5T3HA 2G4UA 3RC6A 3CP7A 4ABGA 2ZGJA 3UUZA 5HMAA 5IYTA 5EXMA 1INCA 5A8YA 1RIWB 3TK6A 2NWNA 1TGBA 1TAWA 4BTIB 3VGCB 1JBUH 1TRNA 2BQ6B 3ZZ5A 3QGJA 2PKAB 4ZUHA 3V12A 2YNAA 4ZKSU 4BAQB 1ZTLA 3MWIU 5JBAS </