1W12U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w12U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w12U01
1QRZA 1GJBB 1PPEE 3RXCA 4BAHB 5BRRE 1UCYK 5EU8A 1Q31A 1QBOA 1KXDA 1V2MT 5A0AE 1DFPA 1O32A 1OS8A 3T26A 1MBQA 1RTFB 4ABJA 3LJOA 2NU0E 2QIQA 4AGKA 1P12E 1Y3WA 1HCGA 1SL3A 2Y5FA 3TGKE 1BTXA 1TMTH 1TRMA 3KL6A 3AAUA 4CBNA 2HNTC 4KGAA 3SU0A 3FP6E 1D4PB 1GBBA 3RXTA 4YT6H 1K1OA 2FX6A 1W10U 5JPMH 1GMHF 3SN8A 3A87A 5AFYH 3MH7A 2FI5E 3RXUA 1ZOMA 1O2MA 3BG4C 4MPWA 1A1RA 4UFDH 2BD5A 2VIDA 5E2OA 3SNBA 1EZXC 4XDEA 1SHYA 1EAWA 2CGAA 1O3CA 4ZHLU 1UJ1A 1C5XB 4WY3A 4GCHF 4CRAA 2CF8H 1G32B 3RXHA 2AS9A 3T5FH 4FUDA 1TPSA 4DVAU 1ZJDA 2PUQH 4YOGA 1B0FA 2ALPA 1XXDA 1O3DA 1GBLA 1W14U 1HV7A 2F9UA 2BY9X 2TGDA 2JETB 1AY6H 2SNVA 3V12A 1QIXB 4ABBA 3PMAB 4A92A 3RXVA 1ARBA 3GICB 3M5OA 3V0XA 4XE4A 1HAOH 2ZPRA 3CS0A 5H4IB 4U01A 1MBMA 3K6YA 1O2TA 1IQKA 1ELAA 1N6XA 2UWLA 2J9NA 1PPGE 2OC0A 2OBQA 1K1NA 1C2GA 1AWHB 1V2NT 1NROH 4LZ4B 3P95A 2DUCA 1E36B 2BDIA 2CV3A 1YPKH 4NG9H 1QJ1B 2G00A 4DY7B 1XUIA 5EOKA 2ZCLP 1L4DA 4Z6AH 4ZKOU 2WPIS 4JK5A 4TWWA 5F03A 3SU6A 2ZGJA 3A7WA 3PLBA 1K21H 1QB1A 1SGIB 2F9NA 1F7ZA 3MU0A 3SI3H 1P2OA 2OTVA 4Y7BA 4B74A 2NU1E 1ELEE 3AASA 2BZ6H 3S7HB 3MFJA 1T4VH 3O8BA 1GBIA 1Z1JA 3VEQB 1P0SH 1UTKA 2Q6GA 3LONA 2W3KA 3JZ2B 4OGYA 1W11U 1WSSH 2P59A 2YNBA 1W13U 2B7DH 4MPUA 5FXLA 3KQEA 2YOLA 4O9VA 2ZGXH 3OY5U 4ABFA 4UD9H 2JH5D 4BNRA 3QDZB 1YF4A 3BTKE 2A31A 2ESTE 1GMDG 5IDKA 5E2PA 2FO9A 1UCYE 3NKKA 1BTWA 2Y5GA 1C5NH 4NGAH 1KIGH 1C2DA 3UY9A 2XWAA 4X6PA 3VB3A 3ZYDA 4BXSA 2WINI 3M37A 1IQJA 3LPRA 1TE0A 1EPTC 1LVMA 2BLOA 1IQLA 2ZQ1A 2D26C 2ZDVH 1PQ5A 1TGCA 3RMOH 1EKBB 1TPPA 3PLPA 4D7FA 2ZECA 2ODYB 1Q3XA 3GCHB 4FUJA 2GDDA 3KIDU 1YLCA 2GT7A 4ISOA 4FVBA 1AIXH 1A7SA 1Q2WA 1UTQA 1P2KA 1AU8A 2O8WA 1P9SA 1EB2A 2GX4A 2TGPZ 4X1PU 2GTBA 1H9HE 2PKAB 1BITA 3PROA 2IOTA 1GHYH 4MLFB 2KAIA 1C9PA 2LPRA 1CBWC 1C1RA 1EJAA 5L6NH 4GLYA 1DXPA 1GI7B 1MU6B 4O3TA 3GYLB 4GPGA 1KTTB 1OP2A 3STJA 1E35B 4X6OA 4Q7YA 2BXTH 1V2OT 4YT7H 1BBRE 1HXFH 3SNCA 3W94A 3KN2A 4NZLA 2XW9A 1Y3YA 1EPTB 3DT0H 1SGYE 2F3CE 4BXWA 1TMUH 2A2XH 1J15A 2TRMA 1BQYA 4FUIA 1Z8IB 1YPLH 1GHWH 2XC4A 1DWCH 4OS7A 1PJPA 3RXAA 2HRVA 1CT2E 2CF9H 4UFFH 1MZAA 3ZVEA 2GZ7A 1OX1A 2AGIX 2FOMB 4HI3A 1RFNA 5FX6A 1IOEA 1HPGA 1MCVA 3DHKH 3SGBE 1CGHA 3RP2A 1UTLM 3UQOA 1QL9A 1GL1A 1CBWB 1DUAA 2B8OH 4WMEA 5JB8S 3BEUA 1AE5A 1WQVH 1OWIA 4K8YA 4YM9A 3OTJE 1QQUA 1D6WA 2Y5HA 2ZFSA 1TB6H 3AW1A 5C1XA 4RKJB 4YTAA 4D9RA 3I77A 3V3MA 1ESTA 2BVSH 1C4U2 3LDXH 1AB9B 3QX5H 1FONA 2BQ7B 4ISNA 1SHHB 2G8TA 1W7XH 1BTHH 4U32A 2A5IA 4AG1A 5HGGA 1EASA 1WV7H 1DM4B 3RXBA 1NFXA 1WTHD 1IHTH 2ZU1A 1K1PA 3RU4E 1MKWH 2O8UA 1P04A 5EQSA 3MNCA 2SGFE 2ZTZA 3TGIE 1TALA 1HAPH 1NM6A 2B5TB 1GBTA 2PFEA 4LXBH 3SI4H 4AFZA 2W5EA 3A84A 1HB0B 1SGQE 1VCPA 3ZZ8A 2P94A 1A2CH 2QN5T 3RMNH 1CO7E 1O2VA 1BTUA 1ZSLA 1AFEH 3RXPA 5GPIB 5GDSH 3UIRA 7GCHG 1EAUA 3U9AH 1YPGH 2QXGA 1UVUH 1S83A 4HGCA 1C2MA 3SO3A 1RIWB 4I33A 4ZROA 3SORA 2BY8X 2FM2A 1XKBC 1O2NA 1P57B 4CRDA 3UR9A 3SW2B 3GY3A 2M5TA 1QQ4A 2PSXA 3QZRA 2P3UB 1LMWB 5C5NA 1RGQA 1P01A 2CHAC 1Y8TA 4Y7AA 1S5SA 1EZSC 3TJNA 1HDTH 5DP8A 5F6MA 1SPJA 1UO6A 2RA0A 5J4QA 1PPHE 2BD2A 1DSTA 1BA8B 1A5IA 8KME2 2ZDMA 2ZGHA 3MMGA 1A3BH 1UCYH 1YPEH 2QA9E 5A8YA 3A7XA 1C1OA 1HIAB 3MU8A 2FYRA 1LVYA 3A82A 4FVDA 2EI7A 5I25A 4Q7XA 3E3TA 3M3VA 2WPJS 2CMYA 2OLGA 1CT0E 1A5HA 1FPHH 5E0JA 1V2PT 4TY7A 1YPHE 1LQEA 2GGVB 3ATLA 2ZZUH 3ZZDA 2PR3A 3A7VA 1TPOA 1MTVA 3PB1E 3DA9B 4D9QA 1NRRH 3TK5A 3BSQA 1ESAA 1GGDB 2F83A 1YPMH 2VVUA 3FFGA 9LPRA 2FI3E 1J16A 3F68H 4WVPE 5EPNA 4F4OC 1EPTA 3BN9A 4NCYA 2ZNKH 4A1TA 1J14A 2G51A 3RXFA 4I8JA 2GZ8A 2G55A 3U8OH 3C1KA 1P3CA 1MTUA 1F0RA 1O5EH 3A88A 1OSSA 2HWLB 2ZP0H 1ZR0A 1X7AC 3ITIA 2HPQH 1E34B 1F5RA 3ATKA 3ZVGA 1W2KH 1Y3VA 1NN6A 3WY8A 2HGTH 2ZDAH 1AO5A 3GDUA 4H4FA 2Q6FA 3EGKH 1BTPA 1Y5UT 3Q76A 2A4OA 2V35A 2VIVA 4B73A 5DK1A 1ELDE 4MG3A 4NFEA 1DANH 2TIOA 4WH6A 2SNWA 1W8BH 4CBOA 1V2UT 1TQ7B 1OWKA 1MMJN 1UTOA 5L2ZH 1O3HA 1H9LB 3SUEA 2FTMA 1SQOA 1INCA 1CE5A 2ZF0H 3FP8E 5DP9A 3ZVAA 4HFPB 1NPMA 2GP9B 2ANWA 1C5LH 4K69A 1WOFA 1BMMH 3SBKA 3P6ZB 4FUCA 1KLIH 1UVSH 1SQAA 1BZXE 1V2JT 5EQRA 5T3HA 3ZVFA 4FUBA 1ABIH 5AFZH 5HM9A 3NCLA 1L1JA 2BB4A 2QC2A 1GHAF 1FQ3A 4NWKA 5F8XA 1K1IA 1C5VA 1YYY1 1TBQH 1NRPH 1YCPK 2HNTF 1HAVA 3UPEA 1SLUB 5FX5A 1GCDA 3T25A 3F9GA 3LGWA 1O3OA 2HOBA 1C5TA 2HPPH 3ZZAA 4YO9A 1AVGH 1GDNA 2R2MB 3RXRA 4A1VA 4Y8ZA 4K1EA 5T6GA 1TRYA 1UHBA 1ZMLA 1G3BA 1M9UA 4JZEH 3SJ8A 2SGEE 4ABEA 1LPZB 3ZZ4A 1GCTC 1O36A 3LGIA 1P8VC 1MTSA 2XNIA 1FV9A 4UONA 1BJUA 1J8AA 3HKIB 1CSOE 3EDXB 3K2UA 2QXIA 2RCEA 3LC5A 4ASHA 4XOJA 2H5CA 5EW2H 1EAXA 1A3EH 1AKSB 2V3HH 4FUEA 5E8EH 1F5KU 2W7UA 2C8XB 2Z3EA 2G5VA 3SGAE 3A7YA 1L1NA 5EXLA 4PROA 4TPIZ 1BT7A 4FUHA 2DE9A 1YPHC 1PYTD 4K3JA 4I8GA 1OWJA 3SV8A 3RXIA 1GBJA 2SGPE 5JYIA 2P8OC 1DE7H 1TPAE 5GXPA 2V6NA 1UVTH 3TK6A 1TNLA 3MI4A 2A4QA 4B2AA 2IJOB 1AI8H 5PTPA 5A09A 1TGBA 2QYIA 5HMAA 5GWZA 3BTME 3ESTA 3HGPA 1S81A 4CHAC 1GCTB 3RU4D 3UNSA 1O2PA 4YZUA 3OSYA 2EA3A 1Y59T 1BRCE 2Y81A 2G5NA 4J2YB 3SHCH 1GI9B 3MH5A 1Z8GA 2P93A 2QXHA 3F9FA 3I29A 3M61U 4Y0YE 1K22H 3UWJH 2TBSA 3TPIZ 5EODA 2K1QA 4UEHH 4UFEH 4ZHMU 3T2NA 5C5OA 1SC8U 1N1LA 2PGBB 2F9VA 3E1XB 1H4WA 1THPB 2H9EH 1HGTH 2ZDNA 3E0PB 1FNIA 3MH6A 2FYQA 2I6QA 1EB1H 1F0SA 2OXSA 2VNTA 4RN6A 3ZZ5A 3RXKA 4DURA 2ZU3A 1P2QA 1GJ4H 4INLA 2A7JA 3F9HA 1ELGA 4JK6A 5DP3A 1D3PB 4B2CA 1J17T 1JBUH 1NRQH 7ESTE 3PWCA 2RA3A 3S9AA 3LH3A 2VINA 1DY8A 2D8WA 4NIWA 2ZU4A 2LNCA 3PWBA 5GIBA 3VGCB 5A0CA 2A1DB 3SUFA 3V7TA 4CHAB 3S9CA 1S6HA 1OPHB 1KXBA 2ZGBH 2OBOA 1G2LA 1ARCA 3M5MA 4BOHA 2BDCA 3PYHA 1AGJA 2PTCE 1O2QA 5ESBA 1SGEE 4DIHH 1C1VH 2EI6A 1BIOA 2BLVA 2ZHDA 2J4IA 5T6DA 2XBYA 3EYDA 1MKXK 4IN2A 1VZQH 3QUMP 1FAXA 4IS5A 5F8ZA 1ZPBA 2AYWA 3VPKA 3A86A 1RJXB 1HAZB 1O5AB 4Y10E 2P3FH 2XC0A 2WPMS 1IQIA 4MDSA 5BPEA 1JIRA 2A7HA 5EXNA 1A0LA 1TFXA 3RUOA 4MNVA 3UR6A 3M7TA 3ZZCA 5ETXA 3VB5A 2EEKA 1N8OC 3W95A 9ESTA 2C4FH 4WJG2 2Y6TA 2C8WB 2OC7A 3OX7U 4K1SA 1EOJA 5DGJA 2BVXH 1SFQB 2WUBA 4Y8YA 1PYTC 1S0RA 1AB9C 1O2IA 1EATA 3DD2H 3FP7E 1ZMJA 1J9CH 3L3TA 1PQAA 2FXRA 5C2ZA 3U69H 3NXPA 1GMHG 1SVPA 2ZEBA 5C1YA 1HAGE 1KY9A 1Y3UA 1K28D 4LZ1H 1FMGA 2VH6A 1EXFA 1SB1H 3DFJA 2O8TA 2VVVA 3P8NA 2FZZA 1GHBF 1LTOA 3Q3YA 1THRH 4R8TB 1FXYA 3LC3A 2A0QB 3M5NA 2BDGA 1TLDA 1W0ZU 2XXLA 3DFLA 3EA8A 1O5FH 4I7YH 1NFYA 1HJAC 3PM3A 3F6UH 1VITH 1O3JA 3BEIB 5DP7A 3P17H 4ZUHA 2FOEA 3P8OA 1SGFA 3A8CA 1VJ9U 2JH0D 2BY5X 2R2WU 3T28A 1QBNA 2OP9A 3ATMA 1LHFH 1YP9A 3ZZ9A 2Y7XA 4DCDA 1XMNB 4IMZA 2TPIZ 3ELAH 1BMAA 5DKMA 2PSYA 1FAKH 1C2HA 1O33A 1K1MA 2FTLE 1A5GH 1SGCA 5FPYA 1ZGIA 5FAHA 3SU1A 4K8BA 2J34A 5DPAA 2QY0B 1AQ7A 2JH6D 2WV5A 1BTZA 2BD4A 1EJNA 3ODDA 1CQQA 1WCZA 1VITG 1QA0A 1V2LT 1GJ8B 3AVZA 2BX4A 2ZCKP 5EGMA 1QNJA 1UK4A 3BTFE 4WMDA 1O34A 1KXEA 3NK8A 4XBDA 4H6SB 1AUJA 4X1RU 3TH2H 1RTLA 2OD3B 1UTMA 2D2DA 2AMPA 1ANCA 2OCVB 1LDTT 4U30A 2QF3A 3E6PH 2WV4A 4LOYH 4B75A 1LPGB 2OC1A 5FPTA 2PW8H 1BOQA 3H7OA 5JBCS 1XUFA 3MO9A 4OGXA 3HGNA 1C9TA 1SG8B 1E37B 3LGUA 3ZYEA 2AEIH 2FX4A 3TITA 3RMMH 4U2WA 4IMQA 1QR3E 3SV2H 1LHDH 2GKVE 1GGDC 1BCUH 2BX3A 3RXQA 3UNRA 1O3FA 1NY22 1DY9A 1GHBG 2UWOA 5EPYA 4FXGH 1PPBH 5DJ7A 1YPJH 1OYQA 2BY7X 1ANDA 7GCHF 4I8KA 3PMBB 1EUFA 4NA7A 5HXFA 3GY6A 1ABJH 3MH4A 1IQHA 1Z7KA 2FWWA 1XXFA 4B76A 3CS7A 4AYVB 1MKWK 1UK3A 4ISLA 1NESE 1O3NA 1V3XA 1PPFE 2XWBI 2BMGB 2XBWA 3RXMA 4BAKB 6LPRA 1YLDA 1YGCH 2ZU5A 1K1JA 1BBRK 3K65B 3TLOA 5J4SA 1LPKB 4ZKNU 2Z9JA 2Y80A 2STAE 5FBIA 4GHTA 4UFGH 1GJAB 2ASUB 1F2SE 3SJKA 1GI4A 4X1SU 3N7OA 1FZZA 4JCNA 3OU0A 2HLCA 1HUTH 2B0FA 1C5PA 2BYAX 4IBLH 2J2UA 1SOZA 2ZI2H 4X1QU 4ABGA 1GDUA 2BD9A 2G4UA 3BTHE 3MOCA 2C3SA 1V2KT 4KELA 4NFFA 1LO6A 1QTFA 4WH8A 4OS4A 4Q7ZA 1WUNH 1MQ6A 1FY4A 3Q3XA 4Y76A 4Y71A 2GCTB 1V2ST 1KDQA 4E7NA 1D9IA 2BY6X 3BIVH 4X8VH 1SR5C 2NU2E 4WXVA 1FN8A 3ZZ7A 4AGJA 3B8JA 1DXWA 2ZG0H 5ABWA 2TGTA 2H9HA 2A5KA 3NUMA 4A5TS 3ZV8A 1C1WH 1O35A 2BD8A 1QY6A 1VGCB 2Z9KA 2ZIQH 4VGCC 4OS5A 1CU1A 1GVZA 1ETSH 3ZVBA 2XRCA 1SLVB 1RRKA 1Z6JH 2CJIA 1FY3A 5EXMA 5FBEA 4CH8B 1KXAA 3M36A 3RXEA 1U6QA 1ZRBA 2BQWB 8ESTE 2FLRH 2HNTE 2QGRA 4R0IA 3SNAA 1TX7A 1ZJKA 4JZIA 1H8DH 1F92A 2Z6BD 1ANEA 3LU9B 1HJ9A 4AB8A 5F8TA 2VH0A 4ZHAA 4ABAA 1OYTH 3GCTG 1BDAA 2V3OH 1QB6A 3M35A 1GI8B 3MU5A 1VR1H 2GCTC 1A4WH 4TY6A 1C2EA 2BVRH 2BDYA 2QAAA 5JBAS 1O31A 3NWUA 5SGAE 2WPLS 2XBVA 4BAMB 3GY7A 3GOVB 3SQEE 2SGAA 2ZA5A 1FUJA 2AGGX 1C2KA 1MAXA 1VGCC 4ZH8A 4YLUA 3RDZA 1WU1A 1CVWH 1AVWA 3D62A 2YNAA 2C93B 4GAWA 4JZFH 1FLEE 2VVCA 1HXEH 4CR5A 4BTUB 1GDQA 4I31A 4NIVA 5ESTE 5HYOA 1HBTH 1UTNA 3VB4A 2A45B 1GVKB 1DWDH 1XUGA 2J38A 3QZQA 2IPHA 1WYKA 3CP7A 5LPEA 1UTJA 2JKHA 1O3BA 3T29A 1WBGB 1QA7A 1CHOF 2R3YA 3D65E 1O2UA 2UUYA 1TRNA 3EA9A 1YKTA 1P2JA 1O5DH 1FY1A 1ZHRA 2OQ5A 1BB0B 3IWMA 1O3LA 4O3UA 1UHBB 3KCGH 1QRWA 2UUJB 3UNQA 1GG6B 3LGYA 1SLXB 3ODFA 4FU9A 1HIAA 1L2EA 2P3TB 2Q6DA 2SGQE 3MO3A 6CHAB 4ABIA 1B5GH 1IQGA 1ZSJA 4INHA 4NSVA 3T62A 2Q1JA 4KTUA 2GV6A 5FCKA 3MWIU 3QGJA 4IC6A 4X8SH 3TH4H 3TNTA 3MO6A 1O2YA 4K60A 1TBZH 5E0HA 3VFEA 4E05H 1HAVB 3VGCC 1MQ5A 2ZTYA 1P02A 1BTYA 1C5QA 5C20A 1S0QA 2PV9B 1FDPA 2CXVA 1P2MA 1AZZA 2XC5A 1EZQA 1G9IE 6GCHF 3SV9A 3SUGA 5CHAC 2JETC 1K2I1 3KNXA 1O2OA 4MQAA 2F9OA 2H1UA 4AN7A 1KXFA 1GMCF 4Q80A 3PTBA 1JMOH 3LJJA 2HALA 1GHZA 3PMHB 4B2BA 1L4ZA 1Z71A 1AMHA 3M7UA 1NU9A 2BDHA 4RSPA 3TVJB 1IQFA 4X0WU 1XVMA 1KLTA 1PPCE 4ABDA 4BTTB 1YM0A 4X2WA 4ESTE 4ABHA 2BXUH 3IG6B 4ZXYH 1TNIA 3K9XB 1TNJA 5L30H 4GVUA 5JDUB 2FI4E 1NU7B 5DP6A 3TK9A 3KHVA 5IYTA 1P2IA 3SHAH 4BTIB 1VJAU 3HPTB 2H5DA 5TJXA 1OKXA 1N8OB 3Q3KA 8GCHG 3FAOA 3BTTE 1GJ5H 1KTSB 2GMTB 2ZPSA 2QF0A 1HFDA 4UE7H 1O3MA 1GBKA 2P95A 2GCHF 2ZTXA 1T8NA 3TJUA 3EE0B 3VXEH 3E8LA 3SNDA 4DIIH 4RKOB 1BRBE 1TGTA 2BD7A 3UOUA 1QB9A 4GHQA 4ISHH 3M7QA 1JRTA 3Q77A 2FOGA 1EX3A 2Z3DA 2VWOA 1W7GH 1XM1A 5B6OA 1HAIH 1MTWA 4AOQA 7KMEH 4BAQB 1TQ0B 1LKBA 4ZXXH 1XKAC 3KQBA 1O3GA 1PFXC 1O2JA 2H9TH 3ZV9A 2ULLA 2ZGCA 3BG8A 4ZKRU 3RM2H 1C5MD 1FY8E 3UWIA 2PLXA 1GBDA 3RC6A 3TH3H 1DVAH 1TONA 1WAYB 3HK3B 2FP7B 2NU3E 2VIQA 2GMTC 4Y8XA 4ZKSU 1FN6A 1W3CA 2VIPA 1PQ7A 2NWNA 4CRBA 2ZPQA 4DOQA 2C90B 1BUIA 1ZHMA 1O2HA 3BTWE 1DLKB 4NIXA 2ZFPH 5EW1H 2BZAA 3UOPA 3A81A 3EQ0H 3GCHC 1P06A 1A0HB 5K7RA 2PKAA 1F0UA 2DE8A 3A8DA 4D8NA 5GCHG 4WWYA 3MNXA 2QV1A 2FDAA 3FZZA 4O97A 2Z9GA 2ZDKA 2FS9A 1Y3XA 5FHTA 2B9LA 2PWXA 3FVFB 1G2MA 1ZHPA 2G81E 1SFIA 2FOCA 4JZ1A 1Y5BT 3OY6U 4CRFA 3H7TA 4AYYB 3U1JB 1C4V2 1A61H 1KSNA 1JIMA 1P3EA 5AF9H 1MH0A 4TPYA 4DJZB 3VB7A 8LPRA 3KEEA 1O2KA 1ZZZA 1O5CB 1AE8H 2XCFA 2Z94A 1ZMNA 2J94A 1XUKA 3PO1C 1NRNH 3KQDA 2O8MA 2PHBA 2SFAA 4MTBA 4OS1A 3U98H 4XFQA 1DDJA 4HTCH 3KF2A 2EC9H 3A80A 3GY5A 3PMJA 1AD8H 1LCYA 4X2XA 5LPFA 3LGVA 2VJ1A 4NIYA 4DGJA 1JOUB 1GBHA 2A5AA 1O2WA 1QRXA 1Y5AT 2FPZA 3U1IB 2FOAA 3RXOA 1K1LA 1FPCH 2BOHB 3A7ZA 2Y7ZA 1FI8A 1YBWA 4YESB 8GCHF 1O5BB 1O2ZA 1O2LA 1FIZA 1QJ6B 1TYNA 2R0LA 3S9BA 1NC6A 1GI6A 1P9UA 2BDBA 4H42U 4BAOB 4X6NA 3BV9B 3PO1B 1TNGA 2GCHG 3URDA 4IC5A 1C5OH 3E16B 4WF8A 2ZU2A 3MNBA 4D76A 1O2XA 1UMAH 1S82A 5A0BA 1QCPA 2AGEX 2Z9IA 3ZVDA 2AIQA 3HK6B 1QHRB 4X2VA 1AWFH 4Y0ZE 3EA7A 3H5CB 4XBBA 1AVXA 1TNHA 1F5LA 4QT8C 6ESTA 1ZTKA 2G4TA 2FMJA 2WYJA 2ANKH 3U8RH 1HYLA 2ZO3H 1GJ6A 4J1YA 3TIUA 1ELCA 2VGCB 3SU4A 1TAWA 3JZ1B 4ZAEA 3B9FH 1D6RA 4YLQH 2GD4B 4JZDH 4CR9A 1C2IA 2ZHWH 2A32A 4LK4A 1O3AA 2R0KA 1GHVH 3RU4T 4CH2B 4X8UH 3SJOA 1DSUA 1ZLRA 3LT3A 1KLJH 4FU8A 1PPZA 1BHXB 2ZDLA 2A7CA 1QL8A 1DLEA 3AAVA 4GCHG 3ATIA 1GMDF 1GBMA 1Z1IA 2GVFA 3BTQE 3QWCH 3GCTF 3QTVH 3SU3A 1G36A 1C1NA 5HM2A 2Z9LA 1ETRH 2CHAB 1K9OE 1C2LA 4ZMAH 3RXGA 1ACBE 1OWHA 1ZRKA 1O38A 3O8RA 2I6SA 1S6FA 4KTCA 1Z8JB 1XVOA 1G3DA 1TIOA 1SGTA 1TOCB 2BM2A 4NWLA 4IW4E 1MTNB 1ELTA 4CRGA 4AZ2B 3FANA 3BG4B 1D3TB 4XSKU 3GY4A 1ANBA 4E7RG 1UVPA 1H8IH 1GWAA 4MNWA 5JBBS 1GVLA 3ENSB 5K0HA 2ZHEH 3P8GA 4A6LA 1C5RA 2ALVA 1BRUP 1D3DB 1CT4E 1RS0A 3TU7H 1C5UA 1GI5A 5DG6A 4KKDA 1O0DH 1HNEE 1NTPA 2Z7FE 2ANMH 4GSOA 2A4GA 2J95A 2EI8A 1BRAA 2ZFTA 3TJOA 1GMCG 2GV7A 1LVOA 2WYGA 3E0NB 4MPXA 3A85A 4MVNA 4DW2U 1D3QB 2C8ZB 1GG6C 1T7CA 1EZUC 3TGJE 2BLQA 1C2FA 3OYPA 3QO6A 4FUGA 4H6TA 1OWDA 1CHGA 1O3PB 1SBWA 3E90B 1GI2A 1MD7A 2NU4E 1C1PA 2WUCA 3UTUH 2F91A 1IHSH 1T32A 2P8OB 3G01A 1AFQC 1HLTH 1MU8B 2VWLA 3QTOH 4D7GA 1P05A 1ZTJA 5TCCA 1KDQB 4MNXA 1A46H 3RMLH 1S85A 4VGCB 3M5LA 2ANYA 1GJDB 3STIA 2AMDA 1GJCB 2ZCHP 2GZ9A 4I8LA 3HKJB 1GHXH 1C5YB 2TGAA 3NZIA 1L1GA 3EAJA 4AORA 4X6MA 3MU4A 3SV7A 1TA6A 1C1SA 3RXDA 1SMFE 4X2YA 1EAIA 3GCNA 3PV4A 5CHAB 3F1SB 3AW0A 3U8TH 4K2YA 1GL0E 1NO9H 1DWEH 2ZC9H 1IQEA 1AN1E 1ESBA 3K6ZA 3A8AA 1O37A 1VCWA 2O9QA 1ORFA 1V2TT 4KP0A 3URCA 1G3EA 4JYTA 4JYUH 1T8OA 3VB6A 4OS2A 2PUXB 4JYVH 1FY5A 5DP4A 1IQNA 5A8ZA 2KAIB 1TGNA 3A7TA 1AFQB 2C8YB 1TA2A 2BQ6B 3QK1A 4I8HA 5AHGH 4WMFA 1OP0A 5DP5A 1TGSZ 1O39A 2ZQ2A 3GDVA 4AFSA 5C1UA 2QXJA 1GBEA 3QLPH 1DITH 4Z0KA 1HAYB 3RLWH 2A2QH 4Y79A 3UFAA 1GI0A 1GPZA 1Z6EA 4NA9H 1C5SA 1SGNE 1ELVA 3PLKA 1NFWA 5E0GA 1GI3A 5LPRA 3B23B 1LHEH 1JRSA 3LH1A 2UUFB 5T6FA 4SGAE 2P16A 1E0FD 4MPVA 2GDEH 1GJ7B 4SGBE 2RG3A 3ZVCA 5GCHF 1MKXH 2ODPA 1VCQA 3QGNB 1G37A 1TOMH 1TX8A 2D1JA 3C27B 2Z3CA 1DWBH 1YC0A 1RTKA 2FS8A 1GBFA 6CHAC 1SI5H 7LPRA 2ZKSA 5FCRA 1V2VT 3RC5A 1JXPA 1OXGA 1DPOA 4UDWH 1LQDB 1P2NA 1HAXB 2VWMA 1C1MA 4KTSA 1F0TA 4NSYA 2CN0H 1H1BA 5JBTA 2F9BH 1BBRH 1KXCA 1OP8A 3P8FA 5EQQA 4K1TA 4THNH 5L2YH 2VB0A 3GDSA 3P70B 3SV6A 3UQVA 4INKA 1TX6A 5C3NA 3SOSA 1YCPH 3A83A 1T31A 1GI1A 2F9PA 1DICA 1DUEA 3LIWA 3O8DA 4A7IB 3S0NA 1P10A 1WTGH 1HAHH 1DS2E 2BLWA 3R0FA 5DO4H 1ID5H 3L33A 3A8BA 1RXPA 1ELFA 1ZPCA 3BIUH 4IN1A 1CA8B 3SJ9A 2J92A 3O8CA 1TABE 3BF6H 1V2WT 1NRSH 5I46H 1LVBA 1MAYA 1C5ZB 3ZZ6A 2HVXA 1CGJE 2PKSC 1O5GH 4B71A 1QJ7B 1W12U 5C67A 4NA8A 4K5ZA 5FPSA 5TCAA 1HJAB 1B0EA 4FUFA 2BD3A 3R3GB 2V0BA 3RLYH 1SOTA 1V2RT 3RC4A 3BEFB 3LKWA 4AG2A 5JB9S 3UUZA 2THFB 4AB9A 3SGQE 2ZFFH 1EQ9A 4CREA 4F49A 4X8TH 1TBRH 1L0ZA 2W3IA 4CRCA 1RD3B 3ZZ3A 1HRTH 2BDAA 2H2ZA 1O3IA 1A0JA 1VITF 1PQ8A 1G30B 1EP5A 3P92A 3FZDA 3TNSA 1P09A 1BJVA 1ZYOA 3KGPA 1G3CA 1ZPZA 1UK2A 1DT2A 2R3UA 3IITA 1BHXF 3RXSA 4I32A 1GBCA 1V6DA 4GUXA 3ATWA 2PGQB 2PKSB 2BOKA 5CE1A 1Z8RA 2UWPA 2FOFA 3PTNA 3M3SA 1N6YA 1UVOA 3SJIA 5EG4A 3GY2A 4MNYA 1O3KA 4AFQA 1OOKB 1TMBH 5A2MH 4M7GA 2FESH 1RIWC 2VIOA 1OWEA 1V2QT 2ZWLH 2XBXA 3SNEA 5LGOA 4YOIA 3S69A 1S84A 2VWNA 2Y82A 3LOXA 2ILNA 1THSH 1O30A 1SGRE 1EJMA 4AX9H 2XCNA 3V13A 1LHGH 4FU7A 1NFUA 1T8MA 1P03A 3GCOA 3SZNA 3QN7A 1XUJA 2AH4X 1SQTA 3RM0H 3TJVA 1T4UH 2FEQH 2RDLA 2R9PA 1NS3A 3MYWA 1H9IE 4BANB 4B1TA 1CA0C 1XUHA 2H6MA 2OQUA 1CHOG 3I78A 3LGTA 4TWYA 1CGIE 1QBVH 1SGPE 4A1XA 1O2RA 2SGDE 1C5WB 1LKAA 1IQMA 1FIWA 2VIWA 1B7XB 1C1UH 6GCHG 1ELBA 1AUTC 3D23A 3MNSA 4Q2KA 2A4RA 1MUEB 3MTYA 1TNKA 3HATH 3GYMA 2ZFQH 2FLBH 3GISB 5LH8A 2QCYA 1W0YH 1AZ8A 1SGDE 3KQCA 1AHTH 1P11E 2WPKS 3NPSA 5GJ4B 3BTEE 1C1QA 2AMQA 1ZSKA 3T27A 1NZQH 1SSXA 1EOLA 2XTTB 1O2SA 2O8LA 4IGDA 1JWTA 1HJ8A 4HZHA 3S7KB 2W26A 3BTDE 4DT7B 5CMXH 4OS6A 1C4Y2 3GY8A 1LHCH 1C1TA 2FOHA 2W7SA 2OUAA 3D49H 3A89A 3CENA 4Y6DA 3SQHE 3ZZBA 3DUXH 4XBCA 4E06H 1CA0B 4NZQA 1QL7A 3UREA 1MTNC 3VXFH 1TWXB 1MCTA 2FODA 3F9EA 2UUKB 4AFUA 1EP6A 2OINA 5AVDA 2VU8E 1WQSA 2PTNA 3SUDA 1GHAG 4WXIA 1FJSA 2FOBA 1YCPM 2OC8A 2ZHQH 3E91A 3RXJA 2BTCE 1MD8A 1O3EA 2IN2A 1AKSA 1ZTLA 3MHWU 1BMLA 1O2GH 4JMYA 2STBE 2AIPA 1QURH 1GJ9B 1C2JA 2FIRH 1SGFG 1UTPA 1ZGVA 5G4BA 1DX5M 1GBAA 1QFKH 3SU2A 1E38B 4O03A 1DOJA 4X1NU 1T8LA 2AFQB 4TYDA 1ETTH 1IAUA 3L6PA 2XYAA 5A8XA 2VGCC 3SU5A 4DG4A 2ZHFH 3M3TA 3RXLA 2GT8A 1SLWB 2G52A 4Y11E 1QGFA 2ZFRH 2AERH 4ISIH 1XX9A 1KYNA 1NT1A 2ODQA 3BTGE 2WPHS 2BHGA 1BMNH 4YOJA 3Q00A 3MU1A 1MZDA
chains in the Genus database with same CATH superfamily
1QRZA 1GJBB 1PPEE 3RXCA 4BAHB 5BRRE 1UCYK 5EU8A 1Q31A 1QBOA 1KXDA 1V2MT 5A0AE 1DFPA 1O32A 1OS8A 3T26A 5C0UA 1MBQA 1RTFB 4ABJA 1H8HD 3LJOA 2NU0E 2QIQA 4AGKA 1P12E 1Y3WA 1HCGA 1SL3A 2Y5FA 3TGKE 1BTXA 1NBMD 1TMTH 1TRMA 3KL6A 4AC9A 3AAUA 4CBNA 2EY4C 2HNTC 4KGAA 3SU0A 3FP6E 1D4PB 1GBBA 3RXTA 4YT6H 1K1OA 2FX6A 1W10U 5JPMH 1GMHF 3SN8A 3A87A 5AFYH 3MH7A 2FI5E 3RXUA 3VG8A 2KR7A 1ZOMA 1O2MA 3BG4C 4MPWA 1A1RA 4UFDH 2BD5A 2VIDA 5E2OA 3SNBA 1EZXC 4XDEA 1SHYA 1EAWA 2CGAA 1O3CA 4ZHLU 1UJ1A 1C5XB 4WY3A 4GCHF 4CRAA 2CF8H 1G32B 3RXHA 2AS9A 3T5FH 4FUDA 1TPSA 4DVAU 1ZJDA 2PUQH 4YOGA 1B0FA 2ALPA 1XXDA 1O3DA 1GBLA 1W14U 1HV7A 2F9UA 2BY9X 2TGDA 2JETB 1AY6H 2SNVA 3V12A 1QIXB 4ABBA 3PMAB 4A92A 3RXVA 1ARBA 3GICB 3M5OA 3V0XA 4XE4A 1HAOH 2ZPRA 3CS0A 5H4IB 4U01A 1MBMA 3K6YA 1O2TA 1IQKA 1ELAA 1N6XA 2UWLA 2J9NA 1PPGE 2OC0A 2OBQA 3PV5A 1K1NA 1C2GA 1AWHB 1V2NT 1NROH 4LZ4B 2L6OA 3P95A 2DUCA 1E36B 2BDIA 2CV3A 1YPKH 2W6ID 4NG9H 3NRLA 1QJ1B 2G00A 3F2FA 4DY7B 1XUIA 5EOKA 2ZCLP 1L4DA 4Z6AH 4ZKOU 2WPIS 4JK5A 4TWWA 5F03A 3SU6A 2ZGJA 4P00A 3A7WA 3PLBA 1K21H 2YMSB 1QB1A 1SGIB 2F9NA 1F7ZA 3MU0A 3SI3H 1P2OA 2OTVA 4Y7BA 4B74A 2NU1E 1ELEE 3AASA 2BZ6H 1QZ8A 3S7HB 3MFJA 1T4VH 3O8BA 1GBIA 1Z1JA 1NBME 3VEQB 1P0SH 1UTKA 1E1QD 2Q6GA 3LONA 2W3KA 3JZ2B 4OGYA 1W11U 1WSSH 3PV2A 2P59A 2YNBA 1W13U 2B7DH 4MPUA 5FXLA 3KQEA 2YOLA 4O9VA 2ZGXH 3OY5U 4ABFA 2LP6A 4UD9H 2JH5D 4BNRA 3QDZB 5HKKD 1YF4A 3BTKE 1EFRD 2A31A 2ESTE 1GMDG 5IDKA 5E2PA 2FO9A 1UCYE 3NKKA 1BTWA 2Y5GA 1C5NH 4NGAH 1KIGH 1C2DA 3UY9A 2XWAA 4X6PA 3VB3A 3ZYDA 4BXSA 2WINI 3M37A 1IQJA 3LPRA 1TE0A 1EPTC 1LVMA 2BLOA 3GS9A 1IQLA 2ZQ1A 2D26C 2ZDVH 1PQ5A 1TGCA 2J98B 3RMOH 1EKBB 1TPPA 3PLPA 4D7FA 2ZECA 2ODYB 1Q3XA 3GCHB 4FUJA 2GDDA 3KIDU 1YLCA 2GT7A 4ISOA 4FVBA 1AIXH 2JJ2D 1A7SA 1Q2WA 3OE7D 1UTQA 1P2KA 1AU8A 2O8WA 1P9SA 1EB2A 2GX4A 2TGPZ 4X1PU 2GTBA 1H9HE 2PKAB 1BITA 3PROA 2IOTA 1GHYH 4MLFB 2KAIA 1C9PA 2LPRA 1CBWC 1C1RA 1EJAA 5L6NH 4GLYA 1DXPA 1GI7B 1MU6B 4O3TA 1YLNA 3GYLB 4GPGA 2WV9A 1KTTB 1OP2A 3STJA 1E35B 4X6OA 4Q7YA 2BXTH 1V2OT 4YT7H 1BBRE 1HXFH 1YWUA 3SNCA 3W94A 3KN2A 4NZLA 2XW9A 1Y3YA 1EPTB 3DT0H 1SGYE 2F3CE 4BXWA 1TMUH 2A2XH 2PP6A 1J15A 2TRMA 1BQYA 4FUIA 1Z8IB 1YPLH 1GHWH 2XC4A 1DWCH 4OS7A 1PJPA 3RXAA 2HRVA 1CT2E 2CF9H 4UFFH 1MZAA 3ZVEA 2GZ7A 1OX1A 2AGIX 2FOMB 4HI3A 1RFNA 5FX6A 1IOEA 1HPGA 1MCVA 3DHKH 3SGBE 1CGHA 3RP2A 1UTLM 3UQOA 1QL9A 1GL1A 1CBWB 1DUAA 2B8OH 4WMEA 5JB8S 3BEUA 1AE5A 1WQVH 3FOAA 1OWIA 4K8YA 4YM9A 3OTJE 1QQUA 1D6WA 3EE7A 4YXWD 2Y5HA 2ZFSA 1TB6H 3AW1A 5C1XA 4RKJB 4F48B 4YTAA 4D9RA 3I77A 3V3MA 1ESTA 2BVSH 1C4U2 3LDXH 1AB9B 3QX5H 1FONA 2BQ7B 4ISNA 1SHHB 2G8TA 1W7XH 1BTHH 4U32A 4F55A 2A5IA 4AG1A 5HGGA 1EASA 1WV7H 2F43B 1DM4B 3RXBA 1NFXA 1WTHD 1IHTH 2ZU1A 1K1PA 3RU4E 1MKWH 2O8UA 1P04A 1FX0B 5EQSA 3MNCA 2SGFE 2ZTZA 3TGIE 1TALA 1HAPH 1NM6A 2B5TB 1GBTA 2PFEA 4LXBH 3SI4H 4AFZA 2W5EA 3A84A 4P02A 1HB0B 1SGQE 1W0JD 1VCPA 3ZZ8A 2P94A 1A2CH 4I86A 2QN5T 3RMNH 1CO7E 1O2VA 1ZSLA 1BTUA 1AFEH 3RXPA 5GPIB 5GDSH 3UIRA 7GCHG 1EAUA 3U9AH 1YPGH 2QXGA 1UVUH 1S83A 4HGCA 1C2MA 3SO3A 1RIWB 4I33A 4ZROA 3SORA 2BY8X 2FM2A 1XKBC 3F2GA 1O2NA 1P57B 4CRDA 3UR9A 3SW2B 3GY3A 2M5TA 1QQ4A 2PSXA 3QZRA 2P3UB 1LMWB 5C5NA 1RGQA 1P01A 2CHAC 1Y8TA 4Y7AA 1S5SA 1EZSC 3TJNA 1HDTH 5DP8A 5F6MA 1SPJA 1UO6A 2RA0A 5J4QA 2W6JD 1PPHE 2BD2A 1DSTA 1BA8B 1A5IA 8KME2 2ZDMA 2ZGHA 3MMGA 1A3BH 1UCYH 1YPEH 2QA9E 5A8YA 3A7XA 1C1OA 1HIAB 3MU8A 2FYRA 1LVYA 3A82A 4FVDA 2EI7A 5I25A 4Q7XA 3E3TA 3M3VA 2WPJS 2CMYA 2OLGA 1CT0E 1A5HA 1FPHH 5E0JA 1V2PT 4TY7A 1YPHE 1LQEA 2GGVB 3ATLA 2ZZUH 3ZZDA 2PR3A 3A7VA 1TPOA 1MTVA 3PB1E 3DA9B 4D9QA 1NRRH 3TK5A 3BSQA 1ESAA 1GGDB 2F83A 1YPMH 2VVUA 3FFGA 9LPRA 2FI3E 1J16A 3F68H 4WVPE 5EPNA 4F4OC 1EPTA 3BN9A 4NCYA 2ZNKH 4A1TA 1J14A 2G51A 3RXFA 4I8JA 2GZ8A 2G55A 2YMSD 3U8OH 3C1KA 2KCPA 1P3CA 1MTUA 1F0RA 1O5EH 3A88A 3F0PA 1OSSA 2HWLB 2ZP0H 1ZR0A 1X7AC 3ITIA 2HPQH 1E34B 2QF4A 1F5RA 3ATKA 3ZVGA 1W2KH 1Y3VA 1NN6A 3MQKC 3WY8A 2J98A 2HGTH 2ZDAH 1AO5A 3GDUA 4H4FA 2Q6FA 3EGKH 4ZCNA 1BTPA 1Y5UT 3Q76A 2A4OA 2V35A 2VIVA 4B73A 5DK1A 1ELDE 4MG3A 4NFEA 1DANH 2TIOA 4WH6A 2SNWA 1W8BH 4CBOA 1V2UT 1TQ7B 4Z1MD 1OWKA 1MMJN 1UTOA 5L2ZH 1O3HA 1H9LB 3SUEA 2FTMA 1SQOA 1INCA 1CE5A 2ZF0H 3FP8E 5DP9A 3ZVAA 4HFPB 1NPMA 2GP9B 2ANWA 1C5LH 4K69A 1WOFA 1BMMH 3SBKA 3P6ZB 4FUCA 2KCOA 1KLIH 1UVSH 1SQAA 1BZXE 1V2JT 5EQRA 5T3HA 3ZVFA 3OAAD 4FUBA 1ABIH 5AFZH 5HM9A 3NCLA 5CHBA 1L1JA 2BB4A 2QC2A 1GHAF 1FQ3A 2EQNA 4NWKA 1K1IA 5F8XA 1C5VA 1YYY1 1TBQH 1NRPH 1YCPK 2HNTF 1HAVA 3UPEA 1SLUB 5FX5A 1GCDA 3T25A 3F9GA 3LGWA 1O3OA 2HOBA 1C5TA 2HPPH 3ZZAA 4YO9A 1MABB 4RT1A 1AVGH 1GDNA 2R2MB 3RXRA 4A1VA 4Y8ZA 4K1EA 5T6GA 1TRYA 1UHBA 1ZMLA 1G3BA 1M9UA 4JZEH 3SJ8A 2SGEE 5EIYA 4ABEA 1LPZB 3ZZ4A 1GCTC 1O36A 3LGIA 1P8VC 1MTSA 2YMSC 2XNIA 2WZQA 1FV9A 4UONA 1BJUA 1J8AA 3HKIB 1CSOE 3EDXB 3K2UA 4TSFD 2QXIA 2RCEA 3LC5A 4ASHA 4XOJA 2H5CA 5EW2H 1EAXA 1A3EH 1AKSB 2V3HH 4FUEA 5E8EH 1F5KU 2W7UA 2C8XB 2Z3EA 2G5VA 3SGAE 3A7YA 1L1NA 4FETA 5EXLA 4PROA 4TPIZ 1BT7A 4FUHA 2DE9A 1YPHC 1PYTD 4K3JA 4I8GA 1OWJA 3SV8A 5DSFA 3WWFA 3RXIA 1GBJA 2SGPE 5JYIA 2P8OC 1DE7H 1TPAE 5GXPA 2V6NA 5EJZA 1UVTH 3TK6A 1TNLA 3MI4A 2A4QA 4B2AA 2IJOB 1AI8H 5PTPA 5A09A 1TGBA 2QYIA 5HMAA 5GWZA 3BTME 3ESTA 3HGPA 1S81A 4CHAC 1GCTB 3RU4D 3UNSA 1O2PA 4YZUA 3OSYA 2EA3A 1Y59T 1BRCE 2Y81A 2G5NA 4J2YB 3SHCH 1GI9B 3MH5A 1Z8GA 1BMFD 2P93A 2QXHA 3F9FA 3I29A 3M61U 4Y0YE 1K22H 3UWJH 2TBSA 3TPIZ 5EODA 2K1QA 4UEHH 4UFEH 4ZHMU 3T2NA 5C5OA 1SC8U 1N1LA 2PGBB 2QF5A 2F9VA 3E1XB 1H4WA 1THPB 2H9EH 1HGTH 2ZDNA 3E0PB 1FNIA 3MH6A 2FYQA 2I6QA 1EB1H 1F0SA 2OXSA 2VNTA 4RN6A 3ZZ5A 3RXKA 4DURA 2ZU3A 1P2QA 2V7QD 1GJ4H 4INLA 2A7JA 3F9HA 1ELGA 4JK6A 5DP3A 1D3PB 4B2CA 1J17T 1JBUH 1NRQH 7ESTE 3PWCA 2RA3A 3S9AA 3LH3A 2VINA 1DY8A 2D8WA 4NIWA 2ZU4A 2LNCA 3PWBA 5GIBA 3VGCB 5A0CA 2A1DB 3SUFA 3V7TA 4CHAB 3S9CA 1S6HA 1OPHB 1KXBA 2ZGBH 2OBOA 1G2LA 1ARCA 3M5MA 4BOHA 2BDCA 3PYHA 1AGJA 2PTCE 1O2QA 5ESBA 5KECA 1SGEE 4DIHH 1C1VH 2EI6A 1BIOA 2BLVA 2ZHDA 2J4IA 5T6DA 2XBYA 3EYDA 1MKXK 4IN2A 3W1EA 1VZQH 3QUMP 1FAXA 4IS5A 5F8ZA 1ZPBA 2AYWA 3VPKA 3A86A 1RJXB 1HAZB 1O5AB 4Y10E 2P3FH 2WPMS 2XC0A 1IQIA 4MDSA 5BPEA 1JIRA 1WDIA 2A7HA 5EXNA 1A0LA 1TFXA 3RUOA 4MNVA 3UR6A 3M7TA 2RDEA 3ZZCA 5ETXA 3VB5A 2EEKA 1N8OC 3W95A 5EJLA 2C4FH 9ESTA 4WJG2 2Y6TA 2C8WB 2OC7A 3OX7U 4K1SA 1EOJA 5DGJA 2BVXH 1SFQB 2WUBA 4Y8YA 1PYTC 1S0RA 1AB9C 1O2IA 3CNRA 1EATA 3DD2H 3FP7E 1ZMJA 1J9CH 3L3TA 1PQAA 3AK5A 2FXRA 5C2ZA 3U69H 3NXPA 1GMHG 2LELA 1SVPA 2ZEBA 5C1YA 1HAGE 1KY9A 1Y3UA 1K28D 4LZ1H 1FMGA 2VH6A 1EXFA 1SB1H 3DFJA 2O8TA 2VVVA 3P8NA 2FZZA 1GHBF 1LTOA 3Q3YA 1THRH 4R8TB 1FXYA 2JJ1D 3LC3A 2F4LA 2A0QB 3M5NA 2BDGA 1TLDA 1W0ZU 2XXLA 3DFLA 3EA8A 1O5FH 4I7YH 1NFYA 1HJAC 3PM3A 3F6UH 1VITH 1O3JA 3BEIB 5DP7A 3P17H 3N7DA 4ZUHA 2FOEA 3P8OA 1SGFA 3A8CA 1VJ9U 2JH0D 2BY5X 3DSPA 2R2WU 1VKYA 3T28A 1QBNA 2OP9A 3ATMA 1LHFH 1YP9A 3ZZ9A 2Y7XA 4DCDA 1XMNB 4IMZA 2TPIZ 3ELAH 1BMAA 5DKMA 2PSYA 1FAKH 1C2HA 1O33A 1K1MA 2FTLE 2KCYA 3FN8A 1A5GH 1SGCA 5FPYA 1ZGIA 5FAHA 3SU1A 4K8BA 2J34A 5DPAA 2QY0B 1AQ7A 2JH6D 2WV5A 1BTZA 2BD4A 1EJNA 3ODDA 1CQQA 1WCZA 1VITG 1QA0A 1V2LT 2WSSD 1GJ8B 3AVZA 2BX4A 2ZCKP 5EGMA 1QNJA 1UK4A 3BTFE 4WMDA 1O34A 1KXEA 3NK8A 4XBDA 4H6SB 1AUJA 4X1RU 3TH2H 1RTLA 2OD3B 1UTMA 2D2DA 2AMPA 1ANCA 2OCVB 1LDTT 4U30A 2QF3A 3E6PH 2WV4A 4LOYH 4B75A 1LPGB 2OC1A 5FPTA 2PW8H 1BOQA 3H7OA 5JBCS 1XUFA 3MO9A 4OGXA 3HGNA 1C9TA 1SG8B 1E37B 3LGUA 3ZYEA 2AEIH 2FX4A 3TITA 3RMMH 4U2WA 4IMQA 1QR3E 3SV2H 1LHDH 2GKVE 1GGDC 1BCUH 2BX3A 5GNDA 3RXQA 3UNRA 1O3FA 1NY22 1DY9A 1GHBG 2UWOA 5EPYA 4FXGH 1PPBH 5DJ7A 1YPJH 1OYQA 2BY7X 1ANDA 7GCHF 4I8KA 3PMBB 1EUFA 4NA7A 5HXFA 3GY6A 1ABJH 3MH4A 1IQHA 1Z7KA 2FWWA 1XXFA 4B76A 3CS7A 4AYVB 1MKWK 1UK3A 4ISLA 1NESE 1O3NA 1V3XA 1PPFE 2BMGB 2XWBI 2XBWA 3KYGA 3OFND 3RXMA 1YLDA 1YGCH 4BAKB 6LPRA 2ZU5A 1K1JA 1BBRK 3K65B 3TLOA 5J4SA 1LPKB 4ZKNU 2Z9JA 2Y80A 2STAE 5IK2D 3OEHD 5FBIA 4GHTA 4UFGH 1GJAB 2ASUB 1F2SE 3SJKA 1GI4A 4X1SU 3N7OA 1FZZA 4JCNA 3OU0A 2HLCA 1HUTH 2B0FA 1C5PA 2BYAX 4IBLH 2J2UA 1SOZA 2ZI2H 2IJD1 4X1QU 4ABGA 1GDUA 2BD9A 2G4UA 3BTHE 3MOCA 2C3SA 1V2KT 4Q63A 4KELA 4NFFA 1LO6A 1QTFA 3N7EA 4WH8A 4OS4A 4Q7ZA 1WUNH 1MQ6A 1FY4A 3Q3XA 4Y76A 4Y71A 2GCTB 1V2ST 1KDQA 4E7NA 1D9IA 2BY6X 3BIVH 3H09A 4X8VH 1SR5C 2NU2E 4WXVA 1FN8A 3ZZ7A 4AGJA 3B8JA 1DXWA 2ZG0H 5ABWA 3DSOA 2TGTA 2H9HA 4ASUD 2A5KA 3NUMA 4A5TS 3ZV8A 1C1WH 1O35A 2CK3D 2BD8A 1QY6A 1VGCB 2Z9KA 2ZIQH 4VGCC 4OS5A 1CU1A 1GVZA 1ETSH 3ZVBA 2XRCA 1SLVB 1RRKA 1Z6JH 2CJIA 1FY3A 5EXMA 5FBEA 4CH8B 1KXAA 3M36A 3RXEA 1U6QA 1ZRBA 2BQWB 3PRBA 8ESTE 2FLRH 2HNTE 2QGRA 3F3BA 4R0IA 3SNAA 1TX7A 1ZJKA 4JZIA 1H8DH 1F92A 2Z6BD 3N99A 1ANEA 3LU9B 1HJ9A 4AB8A 5F8TA 2VH0A 4ZHAA 4ABAA 1OYTH 3GCTG 1BDAA 2KM0A 1QB6A 2V3OH 3M35A 1GI8B 3MU5A 1VR1H 2GCTC 1A4WH 4TY6A 1WXRA 1C2EA 2BVRH 2BDYA 2QAAA 5JBAS 1O31A 3NWUA 4B6EA 5SGAE 2WPLS 2XBVA 4BAMB 3GY7A 3GOVB 3WW7A 3SQEE 2SGAA 2ZA5A 4RT0A 1FUJA 2AGGX 1C2KA 1MAXA 1VGCC 4ZH8A 4YLUA 3RDZA 2JIZD 1WU1A 2KFWA 1CVWH 1AVWA 3D62A 2YNAA 2C93B 4GAWA 4JZFH 1FLEE 2VVCA 1HXEH 4CR5A 4BTUB 1GDQA 4I31A 4NIVA 5ESTE 5HYOA 1HBTH 1UTNA 3VB4A 2A45B 1GVKB 1DWDH 1XUGA 2J38A 3QZQA 2IPHA 1WYKA 3CP7A 5LPEA 1UTJA 2JKHA 1O3BA 3T29A 1WBGB 1QA7A 1CHOF 2R3YA 3D65E 1O2UA 2UUYA 1TRNA 3EA9A 1YKTA 1P2JA 1O5DH 1FY1A 1ZHRA 2OQ5A 1BB0B 3IWMA 1O3LA 4O3UA 1UHBB 3KCGH 1QRWA 2UUJB 3UNQA 1GG6B 3LGYA 1SLXB 3ODFA 4FU9A 1HIAA 2RFKC 1L2EA 2P3TB 2Q6DA 2SGQE 3MO3A 6CHAB 4ABIA 2K0QA 1B5GH 3PRDA 1IQGA 1ZSJA 4INHA 4NSVA 3T62A 2Q1JA 4KTUA 2GV6A 5FCKA 3MWIU 3QGJA 4IC6A 4X8SH 3TH4H 3TNTA 3MO6A 1O2YA 5DN6D 4K60A 1TBZH 5E0HA 3VFEA 4E05H 1HAVB 3VGCC 1MQ5A 2ZTYA 5T1VA 1P02A 1BTYA 1C5QA 5C20A 1S0QA 2PV9B 1FDPA 2CXVA 1P2MA 1AZZA 2XC5A 1EZQA 1G9IE 6GCHF 3SV9A 3SUGA 5CHAC 2JETC 1K2I1 3KNXA 5KEDA 5F53A 5EJ1A 1O2OA 4MQAA 2F9OA 2H1UA 4AN7A 1KXFA 1GMCF 4Q80A 3PTBA 1JMOH 3LJJA 2KCAA 2HALA 1GHZA 3PMHB 4B2BA 1L4ZA 1Z71A 1AMHA 2J5UA 3M7UA 5FL7D 1NU9A 2BDHA 4RSPA 3TVJB 1IQFA 4X0WU 1XVMA 1KLTA 1PPCE 4ABDA 4BTTB 1YM0A 5CDFE 4X2WA 4ESTE 4ABHA 2BXUH 3IG6B 4ZXYH 1TNIA 3K9XB 1TNJA 5L30H 4GVUA 5JDUB 2FI4E 1NU7B 5DP6A 3TK9A 3KHVA 5IYTA 1P2IA 3SHAH 4BTIB 1VJAU 3HPTB 2H5DA 5TJXA 1OKXA 1N8OB 3Q3KA 8GCHG 3FAOA 4DT4A 3BTTE 1GJ5H 1KTSB 2GMTB 2ZPSA 2QF0A 1HFDA 4UE7H 1O3MA 1GBKA 2P95A 2GCHF 2ZTXA 1T8NA 2KX4A 3TJUA 3EE0B 3VXEH 3E8LA 3SNDA 2L74A 4DIIH 4RKOB 1BRBE 1TGTA 2BD7A 4XD7D 3UOUA 1QB9A 4GHQA 4ISHH 3M7QA 4RI0A 1JRTA 3Q77A 2FOGA 2AHME 1EX3A 2Z3DA 2VWOA 1W7GH 1XM1A 5B6OA 1HAIH 1MTWA 4AOQA 7KMEH 4BAQB 1TQ0B 1LKBA 4ZXXH 1XKAC 3KQBA 1O3GA 1PFXC 2M2AA 1O2JA 2H9TH 3ZV9A 2ULLA 2ZGCA 3BG8A 4ZKRU 3RM2H 1C5MD 1FY8E 3UWIA 2PLXA 1GBDA 3RC6A 3TH3H 1DVAH 1TONA 1WAYB 3HK3B 2FP7B 5KGOA 2NU3E 2VIQA 2GMTC 4Y8XA 4ZKSU 1FN6A 1W3CA 2VIPA 1PQ7A 2NWNA 4CRBA 2ZPQA 4DOQA 2C90B 1BUIA 1ZHMA 1O2HA 3BTWE 1DLKB 4NIXA 2ZFPH 5C17A 5EW1H 2BZAA 3UOPA 3A81A 3EQ0H 3GCHC 1P06A 1A0HB 5K7RA 2PKAA 1F0UA 2DE8A 3A8DA 4D8NA 5GCHG 4WWYA 1S6LA 3MNXA 2QV1A 2FDAA 3FZZA 4O97A 2Z9GA 2ZDKA 2FS9A 1Y3XA 5FHTA 1W0KD 2B9LA 2PWXA 3FVFB 1G2MA 1ZHPA 2G81E 1SFIA 2FOCA 4JZ1A 1Y5BT 3OY6U 4CRFA 3H7TA 4AYYB 3U1JB 1C4V2 1A61H 1KSNA 1JIMA 1P3EA 5AF9H 1MH0A 4TPYA 4DJZB 3VB7A 8LPRA 4XRNA 3KEEA 1O2KA 3UB0A 1ZZZA 5HIYA 1O5CB 1AE8H 2XCFA 2Z94A 1ZMNA 2J94A 1XUKA 3PO1C 1NRNH 3KQDA 2O8MA 2PHBA 2SFAA 4MTBA 1KMHB 3U28C 3KYFA 4OS1A 2HLDD 3U98H 4XFQA 1DDJA 4HTCH 3KF2A 2EC9H 3A80A 3GY5A 3PMJA 1AD8H 1LCYA 4X2XA 5LPFA 3LGVA 2VJ1A 4NIYA 4DGJA 1JOUB 1GBHA 2A5AA 1O2WA 1QRXA 1Y5AT 2FPZA 3U1IB 2FOAA 3RXOA 1K1LA 1FPCH 1E1RD 2BOHB 3A7ZA 2Y7ZA 1FI8A 1YBWA 4YESB 8GCHF 1O5BB 1O2ZA 1O2LA 1FIZA 1QJ6B 1TYNA 2R0LA 3S9BA 1NC6A 1GI6A 1P9UA 2BDBA 4H42U 4BAOB 4X6NA 3BV9B 3PO1B 1TNGA 2GCHG 3URDA 3FKSD 4IC5A 1C5OH 3E16B 4WF8A 2ZU2A 3MNBA 4D76A 2IPQX 1O2XA 1UMAH 1S82A 5A0BA 1QCPA 2AGEX 2Z9IA 3ZVDA 2AIQA 3HK6B 1QHRB 4X2VA 1AWFH 4Y0ZE 3EA7A 3H5CB 4XBBA 1AVXA 1TNHA 1F5LA 4QT8C 6ESTA 1ZTKA 2G4TA 2FMJA 2WYJA 2ANKH 3U8RH 1HYLA 2ZO3H 1GJ6A 4J1YA 3TIUA 1ELCA 2VGCB 3SU4A 1TAWA 3JZ1B 4ZAEA 3B9FH 1D6RA 4YLQH 2GD4B 4JZDH 4Q4LA 4CR9A 1C2IA 2ZHWH 2A32A 4LK4A 1O3AA 2R0KA 1GHVH 3RU4T 3DCLA 4CH2B 4X8UH 3SJOA 1DSUA 1ZLRA 3LT3A 1KLJH 4FU8A 1PPZA 1BHXB 2ZDLA 2A7CA 1QL8A 1DLEA 3AAVA 4GCHG 3ATIA 1GMDF 1GBMA 1Z1IA 2GVFA 3BTQE 3QWCH 3GCTF 3QTVH 2VBCA 3SU3A 1G36A 1C1NA 5HM2A 2Z9LA 1ETRH 2CHAB 1K9OE 1C2LA 4HG6A 4ZMAH 3RXGA 1ACBE 1OWHA 1ZRKA 1O38A 3O8RA 2I6SA 1S6FA 4KTCA 1Z8JB 1XVOA 1G3DA 1TIOA 1SGTA 1TOCB 2BM2A 4NWLA 4IW4E 1MTNB 1ELTA 4CRGA 4AZ2B 3FANA 3BG4B 1D3TB 4XSKU 3GY4A 1ANBA 4E7RG 1UVPA 1H8IH 1GWAA 4MNWA 5JBBS 1GVLA 3ENSB 5K0HA 2ZHEH 3P8GA 4A6LA 1C5RA 2ALVA 1BRUP 2XOKD 1D3DB 1CT4E 1RS0A 3TU7H 1C5UA 1H8ED 1GI5A 5DG6A 4KKDA 1O0DH 1HNEE 1NTPA 2Z7FE 2ANMH 4GSOA 2A4GA 2J95A 2EI8A 1BRAA 2ZFTA 1SKYE 3TJOA 1GMCG 2GV7A 1LVOA 2WYGA 3E0NB 4MPXA 3A85A 4MVNA 4FOUC 4DW2U 1D3QB 2C8ZB 1GG6C 1T7CA 1EZUC 3TGJE 2BLQA 1C2FA 3OYPA 3QO6A 4FUGA 4H6TA 1OWDA 1CHGA 1O3PB 1SBWA 3E90B 1GI2A 1MD7A 2NU4E 1C1PA 2WUCA 3UTUH 2F91A 1IHSH 1T32A 2P8OB 3G01A 1AFQC 1HLTH 1MU8B 2VWLA 1K0HA 3QTOH 4D7GA 1P05A 1ZTJA 5TCCA 1KDQB 4MNXA 1A46H 2OK5A 1S85A 4VGCB 3RMLH 3M5LA 2ANYA 1GJDB 3STIA 2AMDA 1GJCB 2ZCHP 2GZ9A 4I8LA 3HKJB 1UW7A 1GHXH 1C5YB 2TGAA 3NZIA 1L1GA 3EAJA 4AORA 4X6MA 3MU4A 3SV7A 1TA6A 1C1SA 3RXDA 1SMFE 4X2YA 1EAIA 3GCNA 3PV4A 5CHAB 3F1SB 3AW0A 3U8TH 4K2YA 1GL0E 1NO9H 1DWEH 2ZC9H 1IQEA 1AN1E 1ESBA 3K6ZA 3A8AA 1O37A 5C0TA 1VCWA 2O9QA 1ORFA 1V2TT 4KP0A 3URCA 3OTPA 1G3EA 3F0OA 4JYTA 4JYUH 1T8OA 3VB6A 4OS2A 2PUXB 4JYVH 1FY5A 5DP4A 1YY3A 1IQNA 5A8ZA 2KAIB 1TGNA 3A7TA 1AFQB 2C8YB 1TA2A 2BQ6B 3QK1A 4I8HA 5AHGH 4WMFA 1OP0A 5DP5A 1TGSZ 1O39A 2ZQ2A 3GDVA 4AFSA 5C1UA 2QXJA 1GBEA 3QLPH 3F2HA 1DITH 4Z0KA 1HAYB 3RLWH 2A2QH 4Y79A 3UFAA 1GI0A 1GPZA 1Z6EA 4NA9H 1C5SA 2KZ4A 1SGNE 1ELVA 3PLKA 4ACAA 1NFWA 5E0GA 1GI3A 5LPRA 3B23B 1LHEH 1JRSA 3LH1A 2UUFB 5T6FA 4SGAE 2P16A 1E0FD 4MPVA 2GDEH 1GJ7B 4SGBE 2RG3A 3ZVCA 5GCHF 1MKXH 2ODPA 1VCQA 3QGNB 1G37A 1TOMH 1TX8A 2D1JA 3C27B 2Z3CA 1DWBH 1YC0A 1RTKA 2FS8A 1GBFA 6CHAC 1SI5H 7LPRA 2ZKSA 5FCRA 1V2VT 3RC5A 1JXPA 1OXGA 1DPOA 4UDWH 1LQDB 1P2NA 1HAXB 2VWMA 1C1MA 4KTSA 1F0TA 4NSYA 2CN0H 1H1BA 3DSGA 5JBTA 2F9BH 1BBRH 1KXCA 1OP8A 3KQ5A 3P8FA 5EQQA 4K1TA 1E79D 4THNH 5L2YH 1OHHD 2VB0A 3GDSA 3P70B 3SV6A 3UQVA 4INKA 1TX6A 5C3NA 3SOSA 1YCPH 3A83A 2WPDD 1T31A 1GI1A 2F9PA 1DICA 1DUEA 3LIWA 3O8DA 4A7IB 3S0NA 1P10A 1WTGH 1HAHH 1DS2E 2BLWA 3R0FA 5DO4H 1ID5H 3L33A 3A8BA 1RXPA 1ELFA 1ZPCA 3BIUH 4IN1A 1CA8B 2V3MA 3SJ9A 2J92A 3O8CA 1TABE 3BF6H 1V2WT 1NRSH 5I46H 1LVBA 1MAYA 1C5ZB 3ZZ6A 2HVXA 1CGJE 2PKSC 1O5GH 2HVYB 4B71A 1QJ7B 1W12U 3UAIC 5C67A 4NA8A 4K5ZA 5FPSA 5TCAA 1HJAB 1B0EA 4FUFA 2BD3A 3R3GB 4B6FA 2V0BA 3RLYH 1SOTA 1V2RT 3RC4A 3BEFB 3LKWA 4AG2A 5JB9S 3UUZA 2THFB 4AB9A 3SGQE 2ZFFH 1EQ9A 4CREA 4F49A 4X8TH 1TBRH 1L0ZA 2W3IA 4CRCA 1RD3B 3ZZ3A 1HRTH 2BDAA 2H2ZA 1O3IA 1A0JA 1VITF 1PQ8A 2J97A 1G30B 1EP5A 3P92A 3FZDA 3TNSA 1P09A 1BJVA 1ZYOA 3KGPA 3ZIAD 1G3CA 1ZPZA 1UK2A 2K8IA 1DT2A 2R3UA 3IITA 1BHXF 3RXSA 4I32A 1GBCA 1V6DA 4GUXA 3ATWA 2PGQB 2PKSB 2BOKA 5CE1A 1Z8RA 2UWPA 2FOFA 3PTNA 3M3SA 1N6YA 1UVOA 3SJIA 5EG4A 1COWD 3GY2A 4MNYA 1O3KA 4AFQA 1OOKB 1TMBH 5A2MH 4M7GA 2FESH 1RIWC 2VIOA 1OWEA 1V2QT 2ZWLH 2XBXA 3SNEA 5LGOA 4YOIA 3S69A 1S84A 2VWNA 2Y82A 3LOXA 2ILNA 1THSH 1O30A 1SGRE 5HIZA 1EJMA 4AX9H 2XCNA 3V13A 1LHGH 4FU7A 1NFUA 1T8MA 1P03A 3GCOA 3SZNA 3QN7A 2WHXA 1XUJA 3OEED 2AH4X 1SQTA 5B6LA 3RM0H 3TJVA 1T4UH 2FEQH 2RDLA 3SYJA 2R9PA 1NS3A 3MYWA 1H9IE 4BANB 4B1TA 4ACBA 1CA0C 1XUHA 2H6MA 2OQUA 1CHOG 3I78A 3LGTA 4TWYA 1CGIE 3WWBA 1SQRA 1QBVH 1SGPE 4A1XA 1O2RA 2SGDE 1C5WB 1LKAA 1IQMA 1FIWA 2VIWA 1B7XB 1C1UH 6GCHG 1ELBA 1AUTC 3D23A 3MNSA 2QE7D 4Q2KA 2A4RA 1MUEB 3MTYA 1TNKA 3HATH 3GYMA 2ZFQH 2FLBH 3GISB 5LH8A 2QCYA 1W0YH 1AZ8A 1SGDE 3KQCA 1AHTH 1P11E 2WPKS 3NPSA 5GJ4B 3BTEE 1C1QA 2AMQA 1ZSKA 3T27A 1NZQH 1SSXA 1EOLA 1O2SA 2O8LA 2XTTB 4IGDA 1JWTA 1HJ8A 4HZHA 3S7KB 2W26A 3BTDE 4DT7B 5CMXH 4OS6A 1C4Y2 3GY8A 2GJGA 1LHCH 1C1TA 2FOHA 2W7SA 2OUAA 3D49H 3A89A 3CENA 4Y6DA 3SQHE 3ZZBA 3DUXH 4XBCA 4E06H 1CA0B 4NZQA 1QL7A 2XNDD 3UREA 1MTNC 3VXFH 1TWXB 1MCTA 2FODA 3F9EA 3FO8D 2UUKB 4AFUA 1EP6A 2OINA 5AVDA 2VU8E 1WQSA 2PTNA 3SUDA 1GHAG 4WXIA 1FJSA 2FOBA 1YCPM 2OC8A 2ZHQH 3E91A 3RXJA 2BTCE 1MD8A 1O3EA 2IN2A 1AKSA 1ZTLA 3MHWU 1BMLA 4TT3D 1O2GH 5C94A 4JMYA 2STBE 2AIPA 1QURH 1GJ9B 1C2JA 3SZEA 2FIRH 1SGFG 1UTPA 1ZGVA 4OM9A 5G4BA 1DX5M 1GBAA 1QFKH 3SU2A 1E38B 4O03A 1DOJA 2JDID 4X1NU 1T8LA 2AFQB 4TYDA 1ETTH 1IAUA 3L6PA 4M9FA 2XYAA 5A8XA 2VGCC 3SU5A 4DG4A 2ZHFH 3M3TA 3RXLA 2GT8A 1SLWB 2G52A 4Y11E 1QGFA 2ZFRH 2AERH 4ISIH 1XX9A 1KYNA 1NT1A 2ODQA 3BTGE 2WPHS 2BHGA 1BMNH 4YOJA 3Q00A 3MU1A 1MZDA
chains in the Genus database with same CATH topology
1QRZA 1GJBB 1PPEE 3RXCA 4BAHB 5BRRE 1UCYK 5EU8A 1Q31A 1QBOA 1KXDA 1V2MT 5A0AE 1DFPA 1O32A 1OS8A 3T26A 1MBQA 1RTFB 4ABJA 3LJOA 2NU0E 2QIQA 4AGKA 1P12E 1Y3WA 1HCGA 1SL3A 2Y5FA 3TGKE 1BTXA 1TMTH 1TRMA 3KL6A 3AAUA 4CBNA 2HNTC 4KGAA 3SU0A 3FP6E 1D4PB 1GBBA 3RXTA 4YT6H 1K1OA 2FX6A 1W10U 5JPMH 1GMHF 3SN8A 3A87A 5AFYH 3MH7A 2FI5E 3RXUA 1ZOMA 1O2MA 3BG4C 4MPWA 1A1RA 4UFDH 2BD5A 2VIDA 5E2OA 3SNBA 1EZXC 4XDEA 1SHYA 1EAWA 2CGAA 1O3CA 4ZHLU 1UJ1A 1C5XB 4WY3A 4GCHF 4CRAA 2CF8H 1G32B 3RXHA 2AS9A 3T5FH 4FUDA 1TPSA 4DVAU 1ZJDA 2PUQH 4YOGA 1B0FA 2ALPA 1XXDA 1O3DA 1GBLA 1W14U 1HV7A 2F9UA 2BY9X 2TGDA 2JETB 1AY6H 2SNVA 3V12A 1QIXB 4ABBA 3PMAB 4A92A 3RXVA 1ARBA 3GICB 3M5OA 3V0XA 4XE4A 1HAOH 2ZPRA 3CS0A 5H4IB 4U01A 1MBMA 3K6YA 1O2TA 1IQKA 1ELAA 1N6XA 2UWLA 2J9NA 1PPGE 2OC0A 2OBQA 1K1NA 1C2GA 1AWHB 1V2NT 1NROH 4LZ4B 3P95A 2DUCA 1E36B 2BDIA 2CV3A 1YPKH 4NG9H 1QJ1B 2G00A 4DY7B 1XUIA 5EOKA 2ZCLP 1L4DA 4Z6AH 4ZKOU 2WPIS 4JK5A 4TWWA 5F03A 3SU6A 2ZGJA 3A7WA 3PLBA 1K21H 1QB1A 1SGIB 2F9NA 1F7ZA 3MU0A 3SI3H 1P2OA 2OTVA 4Y7BA 4B74A 2NU1E 1ELEE 3AASA 2BZ6H 3S7HB 3MFJA 1T4VH 3O8BA 1GBIA 1Z1JA 3VEQB 1P0SH 1UTKA 2Q6GA 3LONA 2W3KA 3JZ2B 4OGYA 1W11U 1WSSH 2P59A 2YNBA 1W13U 2B7DH 4MPUA 5FXLA 3KQEA 2YOLA 4O9VA 2ZGXH 3OY5U 4ABFA 4UD9H 2JH5D 4BNRA 3QDZB 1YF4A 3BTKE 2A31A 2ESTE 1GMDG 5IDKA 5E2PA 2FO9A 1UCYE 3NKKA 1BTWA 2Y5GA 1C5NH 4NGAH 1KIGH 1C2DA 3UY9A 2XWAA 4X6PA 3VB3A 3ZYDA 4BXSA 2WINI 3M37A 1IQJA 3LPRA 1TE0A 1EPTC 1LVMA 2BLOA 1IQLA 2ZQ1A 2D26C 2ZDVH 1PQ5A 1TGCA 3RMOH 1EKBB 1TPPA 3PLPA 4D7FA 2ZECA 2ODYB 1Q3XA 3GCHB 4FUJA 2GDDA 3KIDU 1YLCA 2GT7A 4ISOA 4FVBA 1AIXH 1A7SA 1Q2WA 1UTQA 1P2KA 1AU8A 2O8WA 1P9SA 1EB2A 2GX4A 2TGPZ 4X1PU 2GTBA 1H9HE 2PKAB 1BITA 3PROA 2IOTA 1GHYH 4MLFB 2KAIA 1C9PA 2LPRA 1CBWC 1C1RA 1EJAA 5L6NH 4GLYA 1DXPA 1GI7B 1MU6B 4O3TA 3GYLB 4GPGA 1KTTB 1OP2A 3STJA 1E35B 4X6OA 4Q7YA 2BXTH 1V2OT 4YT7H 1BBRE 1HXFH 3SNCA 3W94A 3KN2A 4NZLA 2XW9A 1Y3YA 1EPTB 3DT0H 1SGYE 2F3CE 4BXWA 1TMUH 2A2XH 1J15A 2TRMA 1BQYA 4FUIA 1Z8IB 1YPLH 1GHWH 2XC4A 1DWCH 4OS7A 1PJPA 3RXAA 2HRVA 1CT2E 2CF9H 4UFFH 1MZAA 3ZVEA 2GZ7A 1OX1A 2AGIX 2FOMB 4HI3A 1RFNA 5FX6A 1IOEA 1HPGA 1MCVA 3DHKH 3SGBE 1CGHA 3RP2A 1UTLM 3UQOA 1QL9A 1GL1A 1CBWB 1DUAA 2B8OH 4WMEA 5JB8S 3BEUA 1AE5A 1WQVH 1OWIA 4K8YA 4YM9A 3OTJE 1QQUA 1D6WA 2Y5HA 2ZFSA 1TB6H 3AW1A 5C1XA 4RKJB 4YTAA 4D9RA 3I77A 3V3MA 1ESTA 2BVSH 1C4U2 3LDXH 1AB9B 3QX5H 1FONA 2BQ7B 4ISNA 1SHHB 2G8TA 1W7XH 1BTHH 4U32A 2A5IA 4AG1A 5HGGA 1EASA 1WV7H 1DM4B 3RXBA 1NFXA 1WTHD 1IHTH 2ZU1A 1K1PA 3RU4E 1MKWH 2O8UA 1P04A 5EQSA 3MNCA 2SGFE 2ZTZA 3TGIE 1TALA 1HAPH 1NM6A 2B5TB 1GBTA 2PFEA 4LXBH 3SI4H 4AFZA 2W5EA 3A84A 1HB0B 1SGQE 1VCPA 3ZZ8A 2P94A 1A2CH 2QN5T 3RMNH 1CO7E 1O2VA 1BTUA 1ZSLA 1AFEH 3RXPA 5GPIB 5GDSH 3UIRA 7GCHG 1EAUA 3U9AH 1YPGH 2QXGA 1UVUH 1S83A 4HGCA 1C2MA 3SO3A 1RIWB 4I33A 4ZROA 3SORA 2BY8X 2FM2A 1XKBC 1O2NA 1P57B 4CRDA 3UR9A 3SW2B 3GY3A 2M5TA 1QQ4A 2PSXA 3QZRA 2P3UB 1LMWB 5C5NA 1RGQA 1P01A 2CHAC 1Y8TA 4Y7AA 1S5SA 1EZSC 3TJNA 1HDTH 5DP8A 5F6MA 1SPJA 1UO6A 2RA0A 5J4QA 1PPHE 2BD2A 1DSTA 1BA8B 1A5IA 8KME2 2ZDMA 2ZGHA 3MMGA 1A3BH 1UCYH 1YPEH 2QA9E 5A8YA 3A7XA 1C1OA 1HIAB 3MU8A 2FYRA 1LVYA 3A82A 4FVDA 2EI7A 5I25A 4Q7XA 3E3TA 3M3VA 2WPJS 2CMYA 2OLGA 1CT0E 1A5HA 1FPHH 5E0JA 1V2PT 4TY7A 1YPHE 1LQEA 2GGVB 3ATLA 2ZZUH 3ZZDA 2PR3A 3A7VA 1TPOA 1MTVA 3PB1E 3DA9B 4D9QA 1NRRH 3TK5A 3BSQA 1ESAA 1GGDB 2F83A 1YPMH 2VVUA 3FFGA 9LPRA 2FI3E 1J16A 3F68H 4WVPE 5EPNA 4F4OC 1EPTA 3BN9A 4NCYA 2ZNKH 4A1TA 1J14A 2G51A 3RXFA 4I8JA 2GZ8A 2G55A 3U8OH 3C1KA 1P3CA 1MTUA 1F0RA 1O5EH 3A88A 1OSSA 2HWLB 2ZP0H 1ZR0A 1X7AC 3ITIA 2HPQH 1E34B 1F5RA 3ATKA 3ZVGA 1W2KH 1Y3VA 1NN6A 3WY8A 2HGTH 2ZDAH 1AO5A 3GDUA 4H4FA 2Q6FA 3EGKH 1BTPA 1Y5UT 3Q76A 2A4OA 2V35A 2VIVA 4B73A 5DK1A 1ELDE 4MG3A 4NFEA 1DANH 2TIOA 4WH6A 2SNWA 1W8BH 4CBOA 1V2UT 1TQ7B 1OWKA 1MMJN 1UTOA 5L2ZH 1O3HA 1H9LB 3SUEA 2FTMA 1SQOA 1INCA 1CE5A 2ZF0H 3FP8E 5DP9A 3ZVAA 4HFPB 1NPMA 2GP9B 2ANWA 1C5LH 4K69A 1WOFA 1BMMH 3SBKA 3P6ZB 4FUCA 1KLIH 1UVSH 1SQAA 1BZXE 1V2JT 5EQRA 5T3HA 3ZVFA 4FUBA 1ABIH 5AFZH 5HM9A 3NCLA 1L1JA 2BB4A 2QC2A 1GHAF 1FQ3A 4NWKA 5F8XA 1K1IA 1C5VA 1YYY1 1TBQH 1NRPH 1YCPK 2HNTF 1HAVA 3UPEA 1SLUB 5FX5A 1GCDA 3T25A 3F9GA 3LGWA 1O3OA 2HOBA 1C5TA 2HPPH 3ZZAA 4YO9A 1AVGH 1GDNA 2R2MB 3RXRA 4A1VA 4Y8ZA 4K1EA 5T6GA 1TRYA 1UHBA 1ZMLA 1G3BA 1M9UA 4JZEH 3SJ8A 2SGEE 4ABEA 1LPZB 3ZZ4A 1GCTC 1O36A 3LGIA 1P8VC 1MTSA 2XNIA 1FV9A 4UONA 1BJUA 1J8AA 3HKIB 1CSOE 3EDXB 3K2UA 2QXIA 2RCEA 3LC5A 4ASHA 4XOJA 2H5CA 5EW2H 1EAXA 1A3EH 1AKSB 2V3HH 4FUEA 5E8EH 1F5KU 2W7UA 2C8XB 2Z3EA 2G5VA 3SGAE 3A7YA 1L1NA 5EXLA 4PROA 4TPIZ 1BT7A 4FUHA 2DE9A 1YPHC 1PYTD 4K3JA 4I8GA 1OWJA 3SV8A 3RXIA 1GBJA 2SGPE 5JYIA 2P8OC 1DE7H 1TPAE 5GXPA 2V6NA 1UVTH 3TK6A 1TNLA 3MI4A 2A4QA 4B2AA 2IJOB 1AI8H 5PTPA 5A09A 1TGBA 2QYIA 5HMAA 5GWZA 3BTME 3ESTA 3HGPA 1S81A 4CHAC 1GCTB 3RU4D 3UNSA 1O2PA 4YZUA 3OSYA 2EA3A 1Y59T 1BRCE 2Y81A 2G5NA 4J2YB 3SHCH 1GI9B 3MH5A 1Z8GA 2P93A 2QXHA 3F9FA 3I29A 3M61U 4Y0YE 1K22H 3UWJH 2TBSA 3TPIZ 5EODA 2K1QA 4UEHH 4UFEH 4ZHMU 3T2NA 5C5OA 1SC8U 1N1LA 2PGBB 2F9VA 3E1XB 1H4WA 1THPB 2H9EH 1HGTH 2ZDNA 3E0PB 1FNIA 3MH6A 2FYQA 2I6QA 1EB1H 1F0SA 2OXSA 2VNTA 4RN6A 3ZZ5A 3RXKA 4DURA 2ZU3A 1P2QA 1GJ4H 4INLA 2A7JA 3F9HA 1ELGA 4JK6A 5DP3A 1D3PB 4B2CA 1J17T 1JBUH 1NRQH 7ESTE 3PWCA 2RA3A 3S9AA 3LH3A 2VINA 1DY8A 2D8WA 4NIWA 2ZU4A 2LNCA 3PWBA 5GIBA 3VGCB 5A0CA 2A1DB 3SUFA 3V7TA 4CHAB 3S9CA 1S6HA 1OPHB 1KXBA 2ZGBH 2OBOA 1G2LA 1ARCA 3M5MA 4BOHA 2BDCA 3PYHA 1AGJA 2PTCE 1O2QA 5ESBA 1SGEE 4DIHH 1C1VH 2EI6A 1BIOA 2BLVA 2ZHDA 2J4IA 5T6DA 2XBYA 3EYDA 1MKXK 4IN2A 1VZQH 3QUMP 1FAXA 4IS5A 5F8ZA 1ZPBA 2AYWA 3VPKA 3A86A 1RJXB 1HAZB 1O5AB 4Y10E 2P3FH 2XC0A 2WPMS 1IQIA 4MDSA 5BPEA 1JIRA 2A7HA 5EXNA 1A0LA 1TFXA 3RUOA 4MNVA 3UR6A 3M7TA 3ZZCA 5ETXA 3VB5A 2EEKA 1N8OC 3W95A 9ESTA 2C4FH 4WJG2 2Y6TA 2C8WB 2OC7A 3OX7U 4K1SA 1EOJA 5DGJA 2BVXH 1SFQB 2WUBA 4Y8YA 1PYTC 1S0RA 1AB9C 1O2IA 1EATA 3DD2H 3FP7E 1ZMJA 1J9CH 3L3TA 1PQAA 2FXRA 5C2ZA 3U69H 3NXPA 1GMHG 1SVPA 2ZEBA 5C1YA 1HAGE 1KY9A 1Y3UA 1K28D 4LZ1H 1FMGA 2VH6A 1EXFA 1SB1H 3DFJA 2O8TA 2VVVA 3P8NA 2FZZA 1GHBF 1LTOA 3Q3YA 1THRH 4R8TB 1FXYA 3LC3A 2A0QB 3M5NA 2BDGA 1TLDA 1W0ZU 2XXLA 3DFLA 3EA8A 1O5FH 4I7YH 1NFYA 1HJAC 3PM3A 3F6UH 1VITH 1O3JA 3BEIB 5DP7A 3P17H 4ZUHA 2FOEA 3P8OA 1SGFA 3A8CA 1VJ9U 2JH0D 2BY5X 2R2WU 3T28A 1QBNA 2OP9A 3ATMA 1LHFH 1YP9A 3ZZ9A 2Y7XA 4DCDA 1XMNB 4IMZA 2TPIZ 3ELAH 1BMAA 5DKMA 2PSYA 1FAKH 1C2HA 1O33A 1K1MA 2FTLE 1A5GH 1SGCA 5FPYA 1ZGIA 5FAHA 3SU1A 4K8BA 2J34A 5DPAA 2QY0B 1AQ7A 2JH6D 2WV5A 1BTZA 2BD4A 1EJNA 3ODDA 1CQQA 1WCZA 1VITG 1QA0A 1V2LT 1GJ8B 3AVZA 2BX4A 2ZCKP 5EGMA 1QNJA 1UK4A 3BTFE 4WMDA 1O34A 1KXEA 3NK8A 4XBDA 4H6SB 1AUJA 4X1RU 3TH2H 1RTLA 2OD3B 1UTMA 2D2DA 2AMPA 1ANCA 2OCVB 1LDTT 4U30A 2QF3A 3E6PH 2WV4A 4LOYH 4B75A 1LPGB 2OC1A 5FPTA 2PW8H 1BOQA 3H7OA 5JBCS 1XUFA 3MO9A 4OGXA 3HGNA 1C9TA 1SG8B 1E37B 3LGUA 3ZYEA 2AEIH 2FX4A 3TITA 3RMMH 4U2WA 4IMQA 1QR3E 3SV2H 1LHDH 2GKVE 1GGDC 1BCUH 2BX3A 3RXQA 3UNRA 1O3FA 1NY22 1DY9A 1GHBG 2UWOA 5EPYA 4FXGH 1PPBH 5DJ7A 1YPJH 1OYQA 2BY7X 1ANDA 7GCHF 4I8KA 3PMBB 1EUFA 4NA7A 5HXFA 3GY6A 1ABJH 3MH4A 1IQHA 1Z7KA 2FWWA 1XXFA 4B76A 3CS7A 4AYVB 1MKWK 1UK3A 4ISLA 1NESE 1O3NA 1V3XA 1PPFE 2XWBI 2BMGB 2XBWA 3RXMA 4BAKB 6LPRA 1YLDA 1YGCH 2ZU5A 1K1JA 1BBRK 3K65B 3TLOA 5J4SA 1LPKB 4ZKNU 2Z9JA 2Y80A 2STAE 5FBIA 4GHTA 4UFGH 1GJAB 2ASUB 1F2SE 3SJKA 1GI4A 4X1SU 3N7OA 1FZZA 4JCNA 3OU0A 2HLCA 1HUTH 2B0FA 1C5PA 2BYAX 4IBLH 2J2UA 1SOZA 2ZI2H 4X1QU 4ABGA 1GDUA 2BD9A 2G4UA 3BTHE 3MOCA 2C3SA 1V2KT 4KELA 4NFFA 1LO6A 1QTFA 4WH8A 4OS4A 4Q7ZA 1WUNH 1MQ6A 1FY4A 3Q3XA 4Y76A 4Y71A 2GCTB 1V2ST 1KDQA 4E7NA 1D9IA 2BY6X 3BIVH 4X8VH 1SR5C 2NU2E 4WXVA 1FN8A 3ZZ7A 4AGJA 3B8JA 1DXWA 2ZG0H 5ABWA 2TGTA 2H9HA 2A5KA 3NUMA 4A5TS 3ZV8A 1C1WH 1O35A 2BD8A 1QY6A 1VGCB 2Z9KA 2ZIQH 4VGCC 4OS5A 1CU1A 1GVZA 1ETSH 3ZVBA 2XRCA 1SLVB 1RRKA 1Z6JH 2CJIA </