1W12U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w12U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w12U01
1HAVA 4AFUA 5CE1A 1KDQA 1O3JA 1C5VA 1S6FA 4I8JA 1GBMA 3E1XB 1PPHE 2WINI 2P93A 3E0NB 5A8YA 1BT7A 3AW1A 3Q3YA 1FDPA 4UEHH 3LGVA 2P16A 2BLQA 3SV7A 4Q7ZA 1NO9H 1BB0B 2A4RA 3BIVH 5T6FA 3VEQB 1GJAB 2BQ7B 1O32A 1O3GA 3QUMP 1Y3WA 3RXHA 1SPJA 1DSUA 1NU9A 4Y79A 1SGTA 2D8WA 1ELDE 2QF0A 1J16A 1OWHA 2OC0A 2BM2A 1A2CH 3AASA 5DP7A 4ZROA 1C5MD 4JZFH 3P17H 4B2AA 1C1NA 1P03A 1UTJA 3ATLA 1GBIA 3TK5A 2ZC9H 4JMYA 1QTFA 3ZZ5A 2ALPA 1O36A 1GMDF 1LHCH 3SZNA 4JYVH 1SL3A 1H4WA 4I8GA 2ZNKH 1HBTH 2F83A 1MU6B 1THRH 1VITF 1O2JA 4JZ1A 1VZQH 1GBBA 1NRNH 2FOMB 3A8AA 2THFB 1YYY1 1PPGE 2ZDLA 4THNH 1L1NA 3K6YA 1RTFB 2BOKA 5ABWA 2HWLB 1FIWA 1TGTA 3I77A 1Z6EA 1SGFA 8LPRA 1KXCA 3O8RA 1SGCA 1SQTA 1BUIA 1HJ8A 1TE0A 3P8OA 1C1OA 2UWOA 2GX4A 2D2DA 1Y59T 4CRBA 4JCNA 5TJXA 4I31A 4FU9A 1ZGIA 5AF9H 1QCPA 4ZH8A 1QL8A 2FESH 1LQDB 1TNHA 3JZ2B 5A0AE 3BTFE 1AGJA 2ZFRH 1ZSKA 3OYPA 2ZHQH 2VU8E 4DURA 4TYDA 3QTOH 1GJ5H 2FS8A 5EXMA 2A32A 2FOAA 2OC7A 1AVXA 2UWPA 2ZIQH 3KIDU 3ZZDA 4NIWA 1O5DH 1ZMJA 4UE7H 1O2QA 2C8XB 1SGQE 5DGJA 1GMCG 1THSH 2ZU1A 3TGJE 4YTAA 5EG4A 1NFUA 1TGBA 1V2PT 3Q3KA 1GJCB 1ZOMA 1KXEA 2J38A 3T26A 2TGDA 3PV4A 3H7OA 4TWWA 1LPKB 4ZAEA 2FXRA 3SGAE 3RXTA 1ID5H 2FTMA 2FODA 3U8RH 3UWJH 1C5YB 2VH0A 1F5KU 3MMGA 1N6XA 4GUXA 4AYYB 2JH5D 2F91A 2WYGA 4X0WU 1RRKA 2AEIH 3RXFA 4ISHH 1YC0A 3MNBA 1O34A 1WQSA 2CHAB 3RM0H 2Y5HA 3BF6H 4FXGH 1SLVB 3SU1A 2FP7B 2JKHA 3A7VA 2Z3DA 1AE8H 4ABFA 3PROA 1C1WH 4U32A 1GHZA 3QGJA 3V3MA 1C5SA 3A8CA 3QDZB 5F8TA 2BY8X 3LC5A 3LT3A 1GBDA 3KF2A 3SN8A 2FLBH 2CF9H 3ZVEA 3IWMA 1SQAA 3PM3A 3MU4A 4NIVA 1WSSH 3FAOA 5E8EH 3ZZ3A 1TABE 3PO1B 5I25A 2PUQH 3T62A 1C5XB 2ZCKP 1QBOA 1DLKB 2EI8A 1UTOA 3SV8A 2QYIA 4CH2B 2K1QA 1G2MA 2SGQE 3DFLA 3GY8A 1CU1A 3MH5A 1HJAC 1UK2A 3MOCA 1AY6H 3ELAH 1TQ7B 3KGPA 1Z8RA 4Y8XA 5JPMH 1ACBE 3ODFA 4PROA 2NU0E 5DK1A 3PLPA 3S9CA 5C2ZA 1FY5A 2ZQ2A 2W26A 1BRUP 1J14A 4TWYA 1NZQH 3D62A 4ABDA 1XUHA 3MH7A 1P9SA 2BY7X 3LC3A 1VR1H 2O8LA 1TALA 2O9QA 4H4FA 4IN1A 2ZU4A 1FPHH 1JIMA 2Z3EA 1G3EA 1A4WH 5GIBA 1CQQA 1IQNA 4GSOA 5JBCS 6GCHF 3TGIE 1TWXB 1TPPA 1O3BA 1J8AA 4E7RG 1NRSH 2WPKS 3UIRA 1C1RA 1K1MA 2BXUH 5IDKA 4ISLA 2F9OA 1MMJN 2OD3B 4E05H 1EAIA 1A0LA 2QN5T 1GG6B 2TPIZ 2PGQB 3PWCA 4I8HA 2Y82A 5J4SA 2BTCE 2H2ZA 3EQ0H 1K1OA 1AUTC 1C9PA 4B73A 3GY7A 1IQLA 3EE0B 4HGCA 1DOJA 1GHBG 3M35A 4LOYH 3HK3B 1P3CA 2UUKB 3D65E 2A4OA 1GMCF 1GDUA 5GPIB 3UQVA 1FN6A 3P70B 3BEUA 1GVZA 3MU5A 2ZF0H 2XBWA 1TIOA 2ZDAH 4AFQA 1ZR0A 1L0ZA 5EXNA 4DOQA 2GDEH 2ZPQA 1O2XA 3QZRA 1UVUH 5FBIA 2RCEA 1BTWA 4MLFB 1C5PA 1LVYA 5FCKA 1W12U 2AMQA 2ODQA 1QQ4A 1QR3E 2FI4E 4NCYA 4JYTA 1Z1JA 1H9LB 1NS3A 2GCTC 1O2PA 1EPTC 3F1SB 1A5HA 1G3DA 2H9TH 1ELCA 2GZ9A 1Z8IB 3D23A 1GI7B 1O5GH 2PTCE 1IQJA 3CENA 5DP4A 2VVUA 1EAUA 1CHOG 3MH4A 1QB1A 1O2ZA 4MDSA 1C4Y2 3TITA 1BA8B 4JYUH 4X8SH 2GKVE 1V2ST 1T8MA 1LHGH 1G37A 1W3CA 3RM2H 3RC6A 3GY2A 1JRSA 2CGAA 3P8FA 1CA8B 4AB9A 1KTSB 1MAXA 1JOUB 3EA9A 2ZHDA 3BTQE 4Y8ZA 2RA3A 1DWDH 1GHXH 1ZTKA 4Y76A 2QA9E 3NKKA 2BX4A 4E7NA 2J92A 2C3SA 1EZUC 1C2KA 3ZZ8A 2GT7A 1GCTC 2GV6A 4A7IB 1T8OA 1SB1H 1ZZZA 5HMAA 1DSTA 4ZKRU 1MTWA 1O3HA 3KHVA 5LGOA 1OPHB 4FUDA 4TPYA 3KQEA 3T28A 1PQ7A 1DWEH 2AMPA 4WMDA 1YPLH 1EPTB 2VIQA 1Y8TA 1DPOA 5DKMA 4NWLA 4Q7YA 1AKSB 3K9XB 1TPOA 3A82A 3VB5A 1S0QA 3UNQA 1C2IA 3HK6B 3P95A 5FHTA 2NU3E 2HNTE 2R0KA 1V2JT 2QAAA 5E0HA 3ATIA 3LJOA 2P3FH 3RU4D 1QQUA 1GDNA 2TRMA 4HTCH 1EB2A 1Y3YA 4AG2A 1YLCA 1XVMA 5I46H 1V2OT 1BTZA 2FS9A 3I78A 1KXDA 4BAKB 2ZFTA 1D3TB 1DITH 4A5TS 5GWZA 3RMLH 4Y11E 3H7TA 4Y7AA 2HPPH 3RXUA 1P2KA 4WMEA 2ZTXA 3CP7A 2VIPA 3HPTB 2FOFA 4H6TA 2TIOA 3LONA 1A5GH 4Q7XA 1KYNA 4X6MA 1O2TA 2YNBA 1W14U 3L6PA 1FY3A 1YF4A 1QL9A 2VIOA 4UFEH 2ANKH 1D6RA 4K60A 2XBVA 4FU8A 4FVDA 1DVAH 1FAXA 1PJPA 1QB6A 3F9EA 2FX4A 4MVNA 2AGGX 5F8XA 2ZI2H 4BANB 1NFXA 4GVUA 3T2NA 2BDYA 2G5VA 1WOFA 1WCZA 4RSPA 5L2ZH 4X1SU 3NUMA 4GPGA 1W13U 1EP5A 4I7YH 1LQEA 1ZHMA 1LTOA 1C2JA 5DP5A 4IMQA 5EOKA 3UTUH 1ZMLA 4RKOB 4AYVB 4FUHA 1THPB 1J15A 4MPWA 4X6NA 3HATH 1P3EA 2ZFPH 1H1BA 1FIZA 1AE5A 2R3UA 1MCVA 1BHXB 1W7GH 1HV7A 1O2MA 3PTBA 2BVXH 2XBXA 1H8IH 3E90B 2PLXA 2ANYA 2ZTZA 2F9NA 4K3JA 1AZ8A 2J94A 3LGUA 1XUGA 3GISB 5L2YH 1C5NH 2H5DA 1KIGH 2P3TB 1LKBA 2PKAA 2F9BH 1UVTH 4IN2A 3S7KB 1AWHB 1YPKH 1O33A 4OS2A 2Z9GA 4F49A 1SLUB 5CHAC 1W0YH 3SUEA 1HYLA 1O2IA 1W8BH 3LIWA 1CGJE 4K1EA 4OS6A 3RXSA 4WH6A 3VB4A 3UY9A 3W95A 1LVOA 1ORFA 3S0NA 4CRCA 1F2SE 2DE9A 3ZVDA 1BBRE 3GY6A 4O3UA 4YZUA 4KTUA 3PMJA 1LO6A 1MU8B 5C5OA 1O3MA 2G00A 2AFQB 2DE8A 1LPGB 1C2MA 1RIWC 1ZJDA 4LXBH 1NFYA 1EXFA 1XMNB 2GGVB 3BTKE 3VB3A 1JXPA 1C5RA 1UHBA 3E16B 1AI8H 3RUOA 4YM9A 3SW2B 4AFSA 1O3NA 3SQEE 4BTIB 4ESTE 1B7XB 1O2OA 3FVFB 1SGNE 1C4V2 1QRXA 1S81A 1EP6A 1HXFH 2XWAA 3UUZA 2ZWLH 3ZV8A 1MKWH 3M5NA 2ZGBH 4WH8A 1QRZA 1UTMA 1XKBC 3UR9A 1V2RT 2NU2E 2XTTB 3GCNA 2P8OB 1GHWH 1P12E 1ZPCA 4K8BA 3PO1C 3QWCH 2B7DH 3ZZ9A 3TPIZ 1K1PA 4AN7A 4NIXA 1CA0B 1Y3UA 1OXGA 3T5FH 5GXPA 2HNTF 1TOCB 3SJOA 1XKAC 1A1RA 2CN0H 3SU3A 5C20A 2FI3E 2M5TA 1GDQA 1C1SA 2IN2A 1TGSZ 5CHAB 2SGPE 1OYQA 3BIUH 2JH6D 2ZU3A 2ILNA 5JBTA 4R8TB 3O8DA 4D9QA 1XUFA 4I32A 2R2MB 2P3UB 3STJA 3ATKA 4BXWA 4DIHH 3KCGH 1P2QA 1V2LT 4WMFA 2PKSB 1TBRH 1Z6JH 4BAQB 2R2WU 2W7SA 3TJOA 1ZPBA 5LH8A 1C1TA 1UVPA 4MPXA 2J34A 1H8DH 1C5WB 3IITA 1AB9C 3FZZA 1Z8JB 3U8TH 5DP6A 1HXEH 4BTTB 6CHAC 4X2WA 2GD4B 2GT8A 1EJAA 1VCQA 1PFXC 5EW1H 1O3AA 3MNXA 3E3TA 3OTJE 5JB9S 4Y10E 1O3DA 4JK6A 1JBUH 1JIRA 1G2LA 1GI1A 2GZ7A 1MTVA 3SHAH 1O3PB 1RXPA 3TJUA 3PYHA 1S82A 2CV3A 2GMTC 1QNJA 1GCTB 3O8BA 2OQUA 1F5LA 3U9AH 5C67A 1C5ZB 1O3IA 3BN9A 1TNLA 2BXTH 2RG3A 1EATA 4GCHF 3GDVA 3RLWH 5A8ZA 1GI4A 1HJAB 3EA8A 3ZZCA 1PYTC 4NGAH 2ANWA 3SNBA 1C5LH 2FIRH 2AIPA 3QTVH 5AVDA 8GCHF 3U69H 7LPRA 2PSYA 3SNDA 1C2GA 2BVRH 4X1NU 1XUJA 1INCA 1DY8A 2PWXA 1PQ8A 2VJ1A 1P2JA 1OKXA 4CH8B 1MQ5A 1VJAU 2O8WA 3A7XA 1WBGB 1QRWA 1HAHH 2BDBA 2H5CA 4SGAE 1SGPE 2PUXB 1TRNA 3GCTG 3VXFH 2BLWA 3EYDA 2XYAA 2WPIS 1CO7E 1FXYA 1FY8E 2BHGA 1WU1A 1ZLRA 4GHTA 4K5ZA 2VB0A 2AERH 3V0XA 1EJNA 1Z71A 3M3VA 4ZHAA 1O2HA 3DT0H 2Z9KA 2V3HH 2PW8H 4INKA 1ELEE 2VIDA 1L1GA 1ELTA 3DUXH 2FOCA 1LHEH 3M7TA 1TPAE 5FPSA 1O35A 4A92A 3U1IB 7KMEH 4CBOA 1MH0A 1Q2WA 2BQ6B 2OUAA 5FXLA 1G9IE 3RDZA 3RXJA 1UK4A 3LKWA 1V2UT 1BITA 1CT0E 4BAHB 3QX5H 2SGEE 3UPEA 1VGCC 3SJ8A 2RA0A 4HFPB 8ESTE 2R0LA 1TX8A 4NIYA 1F0TA 3SQHE 1TFXA 5G4BA 3P8NA 3S7HB 4QT8C 2Y5GA 4O03A 1B5GH 1MKWK 2TBSA 4ABHA 2EI6A 1V6DA 1AFQB 3GYMA 2V35A 4MTBA 1PQ5A 3E8LA 3ZZAA 2P94A 4NSVA 1W10U 1CT4E 4ZUHA 1C5UA 1GCDA 1CT2E 3GCOA 3RC4A 1D3DB 1ABJH 5SGAE 2GDDA 4DT7B 4X8TH 4WVPE 2OBOA 1UVSH 1YKTA 2GCTB 4Q2KA 1C5OH 2ZHEH 2FOHA 2W3IA 1QFKH 1ANEA 3LU9B 1AO5A 2FDAA 2BZ6H 2TGTA 1O2NA 1TNIA 4X8VH 1AQ7A 3F68H 4ABAA 2HLCA 1WYKA 3RU4E 2J9NA 1KXBA 4D7GA 3SV9A 1HUTH 1EOJA 4X2VA 1X7AC 2OP9A 3F9FA 1GPZA 1B0FA 1LVBA 1C4U2 1P2NA 3FFGA 1OYTH 3RMOH 5TCAA 1KLJH 2ZGJA 3KQBA 2FLRH 1IQEA 3M5LA 2A5KA 1SGDE 4UFFH 4MPUA 4LZ1H 1P11E 4CRFA 1LMWB 2ZZUH 5K7RA 1HGTH 1YLDA 3LOXA 1UTKA 4AB8A 1ABIH 3A85A 5F6MA 3GCTF 1SBWA 3QN7A 2D1JA 4AZ2B 1AKSA 2BDHA 3ZVFA 1MZAA 8KME2 1A61H 4FUBA 1E38B 4YOIA 1V2NT 5A0BA 5C1YA 2RDLA 1P02A 1SI5H 3A80A 2XWBI 4MNVA 3KNXA 1GL0E 3BEFB 4MQAA 4AGJA 1HJ9A 1ANCA 5L30H 4NZQA 1HNEE 5J4QA 1A3EH 1SOZA 4MNXA 1OWEA 1S5SA 2ULLA 1PPBH 1FLEE 3P8GA 3K2UA 1ETSH 1MQ6A 1SGIB 1N8OC 5E2OA 3M36A 4GAWA 2B0FA 1DXPA 3GDSA 3MU1A 2BYAX 4DVAU 3UQOA 2C8YB 1MKXK 2FYQA 4B75A 1GL1A 1KXAA 4DJZB 1TMBH 1TRYA 1TX6A 1KXFA 1QHRB 3ZZBA 2ZO3H 3R3GB 3SU0A 1PPCE 3SV2H 1P09A 1P0SH 1ETTH 1O2YA 2HRVA 1BJUA 1UTQA 1GJ6A 3NPSA 4TY7A 3K6ZA 1LDTT 1AVGH 2SGFE 2ZP0H 4GCHG 3MYWA 3VB6A 1F0SA 1ZSLA 2Q6GA 1GBCA 4Y6DA 2A1DB 2A4GA 2QCYA 2ZHFH 3GCHC 2WV4A 1AUJA 1ETRH 2QXIA 3PMHB 1G3CA 2WYJA 3BSQA 4JZIA 1P01A 1GBTA 1MTUA 3RXRA 1ESAA 1KSNA 1WV7H 3NXPA 1SGFG 4FU7A 1F92A 4IC6A 2LNCA 2HNTC 1G30B 3SI3H 3AAVA 1M9UA 1IQIA 3BTHE 1FAKH 1KY9A 4KP0A 1ELAA 4X6OA 3VFEA 3T27A 5T6GA 1O3KA 2GZ8A 1SLXB 1AMHA 3ZZ6A 4YESB 3SUDA 2PFEA 4B2CA 2P8OC 1P10A 2ASUB 3TJNA 4IW4E 1T8NA 1BMAA 5ESTE 5GJ4B 2YNAA 3HKJB 2CMYA 3ZYEA 2WPMS 4B76A 3BTTE 3B23B 1TNKA 1V2QT 1YPMH 1Z1IA 2ODYB 1O3LA 2G51A 1UK3A 1TRMA 4ABJA 4O3TA 5T3HA 3P92A 4LK4A 4INLA 2GTBA 1SG8B 1C1PA 1SQOA 4TPIZ 3RP2A 2QIQA 3MO3A 3TLOA 2HOBA 1FV9A 2CJIA 3GCHB 1S85A 1O3FA 1O5CB 3RXMA 1U6QA 5L6NH 2V0BA 3VPKA 1YCPK 1OWJA 1TMTH 1MAYA 1GBKA 1GG6C 2R9PA 1AVWA 2ZQ1A 1HIAA 1O39A 3LGIA 4BAOB 2VWOA 3F9GA 1Y5BT 1LVMA 1BRBE 1F0RA 1UO6A 2OLGA 3RXAA 1BTHH 3TJVA 4ZKSU 1HAXB 1ZTLA 2V6NA 2ZG0H 3BTGE 6ESTA 2BD5A 2FO9A 3CS7A 2FYRA 1GBEA 3SGQE 1CHOF 1QA7A 1VITH 1NN6A 3RXCA 2XC0A 1C2LA 1S84A 3FP7E 1FZZA 2XCNA 4I8KA 5C1XA 5AFYH 2ZDMA 2ANMH 3SU4A 3KEEA 1S83A 1P9UA 1IQGA 1DT2A 1CGIE 4NZLA 1QL7A 2CXVA 1QBVH 1WTHD 1ELBA 3DA9B 1Z7KA 4ZHMU 3BEIB 3NWUA 3WY8A 1CBWB 1BDAA 2UUFB 1HPGA 1TB6H 4WY3A 2BD2A 5DJ7A 3O8CA 1UTPA 2BVSH 2GCHG 5BRRE 3RXIA 4D9RA 4XE4A 5EQSA 4X1QU 3LGYA 3PMAB 4IS5A 3TVJB 3VXEH 3UFAA 3A81A 1GJ9B 2B8OH 1C5TA 1GJ7B 1H9HE 2WPLS 1GGDC 1SVPA 1XM1A 4YO9A 4SGBE 1MZDA 1GGDB 4UFDH 3LH3A 3ZZ7A 3A7YA 3E6PH 1C2FA 2FWWA 1BTYA 3SJIA 2Z9IA 4IBLH 4LZ4B 3F6UH 3TH4H 2BD8A 2BDGA 5TCCA 1K28D 1O37A 3FP8E 5JBBS 1O30A 4MNYA 4U2WA 1P2OA 2F9PA 2XW9A 1K22H 1E36B 2FOGA 4F4OC 1C2EA 1IAUA 1O2UA 1Y3VA 2ZGXH 2Q1JA 1W2KH 4H42U 3MU0A 4CR9A 2ZPRA 6GCHG 1S6HA 2A7HA 1D3PB 5DP3A 3SV6A 1O0DH 4ABIA 1GHBF 4DGJA 2J95A 3M5MA 2O8UA 1UTLM 2G4UA 5EQQA 3SI4H 2PGBB 4JZDH 1O3CA 1N1LA 5T6DA 4ISNA 2BLVA 4NFEA 3SU5A 4UFGH 3SU6A 4A1VA 1FJSA 3MNCA 1GBAA 1MD7A 5A0CA 2FPZA 2BY9X 5EPYA 1GBLA 3T25A 1K1IA 2OC8A 3QGNB 2PV9B 1QA0A 1FY4A 4HZHA 1BBRK 2SFAA 1UTNA 4AG1A 2BLOA 1DDJA 4TY6A 3LDXH 1DANH 1GMDG 3A7TA 2KAIB 3OX7U 2G81E 3EDXB 3U8OH 3V7TA 3KQDA 1NROH 3KN2A 2VGCB 3OU0A 2H9EH 3MO9A 3BTME 1YPGH 3TGKE 3A8DA 1ZHRA 1CHGA 2AYWA 4Z0KA 4NA9H 2A2XH 4X6PA 1J9CH 1YGCH 4XFQA 3RXVA 2J4IA 3SOSA 1O2SA 2OINA 1ZTJA 1SFQB 3SJ9A 3S9BA 4BOHA 3RC5A 1L2EA 1C1MA 1ELFA 5HYOA 3M3TA 4X2XA 1FI8A 3MWIU 4K8YA 2AMDA 2STAE 2ZDKA 4FUIA 2QGRA 3GYLB 5B6OA 2IPHA 1DWCH 4AOQA 1MBQA 2HALA 4ASHA 1XXFA 1L1JA 1A46H 1XUIA 4WF8A 2Z94A 2Y6TA 3GICB 1BOQA 3M5OA 4Z6AH 1F5RA 2BY5X 3ZYDA 1GBJA 2BB4A 2I6QA 4FUCA 1BQYA 2GMTB 7ESTE 5AFZH 5E0JA 1SHYA 1HCGA 1N6YA 3UNRA 4INHA 4U01A 3SORA 2VVVA 1RTKA 2J2UA 4FUFA 3UOPA 1E35B 1O2LA 1WAYB 3HKIB 2VINA 2ZHWH 5JYIA 3EA7A 4ABGA 1Q3XA 1BBRH 4FUGA 3OSYA 4OGXA 5F8ZA 2XCFA 3NCLA 4RN6A 4DY7B 1RTLA 1G32B 2V3OH 1HAIH 1HAVB 2NU1E 2YOLA 1ZHPA 1GVKB 1SSXA 1VCWA 5C3NA 1EX3A 1D9IA 2SGAA 1GI3A 3BTDE 1T32A 5CMXH 2JETB 1Q31A 1DWBH 3LGTA 4YOGA 6CHAB 2D26C 4XSKU 1QBNA 2G4TA 3H5CB 1UJ1A 1OWKA 5C1UA 2QC2A 1GBHA 2HPQH 2ZEBA 1N8OB 2DUCA 1ZPZA 4OS7A 2C4FH 2Z9JA 2XNIA 2VIVA 1ZRBA 2HGTH 3TNTA 1SFIA 2A31A 1GI2A 1YM0A 2XBYA 1VCPA 2AS9A 3QO6A 4Y0YE 1H9IE 3ATMA 2XC4A 5AHGH 1GI8B 4UONA 1AB9B 1RGQA 3SNEA 2ZDVH 2H1UA 2VH6A 1CVWH 1FONA 2ZFSA 1GMHG 3TH3H 2WPHS 3QK1A 5FPYA 3M37A 1FN8A 3URDA 3A88A 2ZECA 3A87A 1BRAA 4X1RU 4K1SA 1PPZA 2BY6X 1VGCB 4Y7BA 2A5AA 4E06H 1KDQB 5FAHA 1WQVH 1S0RA 4XBCA 5FX6A 3RU4T 4YT6H 1XX9A 4NA8A 3TU7H 5JDUB 2ZGCA 2W5EA 1RJXB 4NA7A 2GV7A 2TGAA 3MTYA 2FX6A 5H4IB 4K2YA 1GBFA 5E2PA 1HAYB 3ITIA 3OY5U 3V13A 1P2IA 2HVXA 5GCHG 2QXGA 1AFEH 1GJ8B 4K1TA 2Z3CA 3SNCA 3M61U 2CF8H 4B1TA 4DCDA 4I8LA 3LPRA 2QF3A 1YPEH 1SC8U 4OS1A 1O2KA 4ABBA 1HLTH 2O8TA 3I29A 4CRDA 4FUEA 3L3TA 4OS4A 1TBQH 4CHAB 1NESE 2WV5A 2B9LA 1T4VH 2A7CA 1OOKB 2OBQA 2FEQH 5A2MH 2LPRA 2PR3A 1FPCH 1EASA 1NTPA 1RIWB 3BTEE 1BMLA 1OSSA 1V3XA 1HAPH 1EB1H 3TIUA 1AZZA 1C9TA 3M7UA 1IQKA 2FM2A 1GHVH 2CHAC 5ESBA 2O8MA 2Z6BD 1HIAB 1D3QB 1SGEE 2BOHB 3QLPH 1GJDB 2ZTYA 3A7ZA 1TPSA 3PB1E 3Q77A 2VWLA 3RMMH 1OP2A 1QIXB 3SBKA 5EXLA 1GHAG 4KTSA 1F7ZA 1LKAA 2SGDE 4BNRA 1EAWA 1GVLA 1QJ6B 2VWNA 1IQMA 4IGDA 1O38A 4A1TA 5A8XA 1GI6A 1DE7H 3BTWE 1T31A 2C90B 1NU7B 1DUAA 1AD8H 4UD9H 5DG6A 2A4QA 3A8BA 4D7FA 5EODA 3U98H 1QURH 1ZGVA 2I6SA 1BHXF 1ESTA 1P2MA 4CR5A 9ESTA 2BDAA 1PQAA 2Q6FA 3ENSB 2W7UA 3ZVCA 4WJG2 3SU2A 2BD7A 2IOTA 1JWTA 1ZRKA 2QV1A 4OGYA 1PYTD 2P59A 4WWYA 2SNVA 3Q00A 2QXHA 3MU8A 4D8NA 1IQHA 1DY9A 1XUKA 1ZSJA 3RXEA 1C1UH 4WXIA 1YP9A 2ALVA 3SGBE 1ZMNA 1P57B 1VJ9U 4J1YA 3QZQA 1DXWA 3C1KA 1ELVA 2Z7FE 2ZGHA 1NM6A 3MHWU 3BG4B 5EW2H 2BDCA 1EZXC 1PPFE 1CE5A 5DP9A 2C8ZB 2A0QB 1OS8A 2F9VA 3ODDA 5F03A 1O5EH 4UDWH 1W7XH 3URCA 1AN1E 2G5NA 1V2WT 2ZKSA 1Y5UT 2Y5FA 1UVOA 1GI9B 2UUJB 3S9AA 1MTNB 5FX5A 3T29A 2ZFFH 3M7QA 4OS5A 3SUGA 1P05A 4MNWA 1DX5M 2PHBA 5K0HA 4DG4A 1LPZB 5DP8A 1BMNH 2PTNA 1LHDH 2PKSC 4Y71A 3RXOA 1GHYH 2ZU5A 4XBDA 3UWIA 1ZYOA 4ZKNU 3S69A 1GI0A 2G55A 2ZCHP 3GY5A 2VNTA 1XVOA 2PSXA 4IMZA 1L4ZA 8GCHG 3B8JA 1VITG 3FP6E 3RXBA 1EAXA 3GOVB 3VGCC 2A45B 2VWMA 2AGIX 3FZDA 2Q6DA 3SO3A 5EU8A 3STIA 1V2VT 2BDIA 1W11U 1TGCA 1C2DA 1KLTA 2FOEA 1UCYK 1IHSH 2WUCA 9LPRA 4IC5A 2ESTE 2F3CE 1P04A 3LH1A 5JB8S 1ELGA 1NPMA 3ZVBA 2C93B 2OXSA 1FUJA 3C27B 1BRCE 3PLBA 5LPFA 2H9HA 2H6MA 1TA6A 4AGKA 1A3BH 3A84A 5DO4H 1GHAF 2P95A 2Y7XA 4BAMB 4O9VA 1YBWA 1TONA 1V2MT 5HM9A 1K1JA 2EC9H 5EPNA 1TLDA 3TNSA 1ARBA 3A86A 1SR5C 1GMHF 4GHQA 2FTLE 1HAGE 2ZFQH 4AORA 1WTGH 2FZZA 4H6SB 3N7OA 1TNJA 2A2QH 2BD4A 1EQ9A 3ESTA 1O5FH 1EPTA 1UHBB 1ANBA 1NRQH 1CSOE 5FCRA 1OWDA 1HAOH 3CS0A 2UWLA 1QJ1B 3W94A 4NWKA 2JETC 3A89A 2ZA5A 1YCPM 4BTUB 4BXSA 4O97A 1Y3XA 4KTCA 1EZSC 3R0FA 1ARCA 1YPHC 1IQFA 1SGRE 1NRRH 3GY4A 3UNSA 3SHCH 1TA2A 1YCPH 4CREA 2BD3A 1BCUH 1OP0A 1DM4B 1TOMH 2ZCLP 1LHFH 1TBZH 1XXDA 1O2RA 1RS0A 4ISIH 2AH4X 2TGPZ 3PLKA 7GCHF 4J2YB 2G8TA 3BG4C 1AHTH 3ZV9A 1T8LA 3DFJA 4YLQH 4MG3A 1G3BA 2Z9LA 3E0PB 2OQ5A 3B9FH 1P06A 4JZEH 4DW2U 1K2I1 3DD2H 2BQWB 1ANDA 1O5BB 3P6ZB 3RMNH 4Q80A 4Y0ZE 4CBNA 5FPTA 1SLWB 2GVFA 4B71A 3M3SA 4X2YA 3UOUA 3FANA 4I33A 1OP8A 1SHHB 7GCHG 4CRAA 4FUJA 3A83A 1O2VA 2A5IA 5IYTA 4AX9H 1CGHA 2OTVA 1QY6A 1QJ7B 1O2GH 2ZDNA 1T7CA 3JZ1B 1KTTB 1UCYE 4M7GA 1G36A 1GI5A 1P8VC 4B74A 1NRPH 3SJKA 3OY6U 1HFDA 1O2WA 3HGPA 4NFFA 3V12A 1TQ0B 2FMJA 3SNAA 3RXGA 2B5TB 1GWAA 1TNGA 1O31A 2NWNA 1EJMA 3MFJA 3F9HA 4ZXXH 1QB9A 1E37B 4GLYA 1TGNA 4B2BA 1A0JA 1K1NA 1YPHE 2AIQA 4XBBA 1V2KT 1C2HA 5FBEA 1SMFE 3D49H 3ZVAA 1MKXH 3AVZA 5C5NA 1JRTA 3TK6A 1MUEB 2NU4E 2XC5A 3RLYH 3TK9A 3U1JB 5LPEA 1JMOH 2BZAA 3MNSA 1RFNA 3LJJA 1SOTA 3KQCA 1AU8A 3PMBB 4HI3A 1EUFA 4X8UH 1A0HB 1OX1A 1W0ZU 2KAIA 1D4PB 4KKDA 2WUBA 1O3OA 1FMGA 3DHKH 3EAJA 5LPRA 1F0UA 5DPAA 1FY1A 1WUNH 1CA0C 1PPEE 1AWFH 3UR6A 3RXLA 4DIIH 1MD8A 1BTXA 4U30A 1TAWA 1YPJH 4K69A 4NSYA 5GCHF 4D76A 4X1PU 1NFWA 1A7SA 2G52A 4VGCB 2Y7ZA 3GDUA 1TYNA 4Y8YA 3MI4A 3A7WA 2F9UA 3ZVGA 2VIWA 3HGNA 4YT7H 1OWIA 3Q76A 3RXQA 1Z8GA 1DICA 5HXFA 4ZMAH 1EZQA 2IJOB 2W3KA 5EQRA 1HDTH 1ZJKA 2WPJS 3E91A 3BG8A 1BTUA 5EGMA 1NC6A 1FQ3A 5HM2A 1DS2E 1FNIA 1QGFA 1TX7A 1EOLA 4ISOA 1C1QA 5BPEA 1AIXH 5GDSH 3G01A 1K21H 2FOBA 3BV9B 4A6LA 1HAZB 3UREA 1E0FD 1LCYA 1BJVA 1GJBB 3KL6A 2Y81A 1DLEA 2EA3A 4KGAA 4CRGA 4XDEA 3ZZ4A 1AFQC 4AFZA 2QY0B 1HB0B 2GCHF 4XOJA 2ZU2A 2ZPSA 1UCYH 2OC1A 1C1VH 3AAUA 1E34B 5ETXA 1TMUH 4YOJA 3PWBA 1BIOA 1O3EA 5E0GA 3K65B 1NY22 4ZHLU 3EGKH 4MPVA 1A5IA 5PTPA 3PTNA 2R3YA 1J17T 1B0EA 1MCTA 2BD9A 4WXVA 2BMGB 3MH6A 4JK5A 1RD3B 2QXJA 3L33A 1MTSA 4NG9H 1K1LA 4ABEA 2EEKA 3NZIA 1IOEA 4ZKOU 1IHTH 2AGEX 2OCVB 4KELA 3VGCB 1C5QA 1MTNC 6LPRA 3LGWA 1DUEA 2VGCC 3TH2H 1DFPA 1L4DA 1CBWC 1EKBB 2PKAB 4FVBA 1Y5AT 1GJ4H 5A09A 1O5AB 1V2TT 4YLUA 1HRTH 1NT1A 2SNWA 2XRCA 4VGCC 3GY3A 2STBE 2GP9B 1BTPA 3RXDA 1UMAH 3SUFA 1T4UH 3VB7A 2VVCA 2JH0D 2A7JA 2XXLA 3RXPA 2BX3A 5JBAS 1D6WA 1SGYE 1BMMH 3Q3XA 2ODPA 3NK8A 4ZXYH 3AW0A 2EI7A 2C8WB 2FI5E 1KLIH 2Y80A 3MO6A 4R0IA 5HGGA 3IG6B 3ATWA 3RXKA 4RKJB 4CHAC 1MBMA 1BZXE 1K9OE 2UUYA 1ESBA 4A1XA
chains in the Genus database with same CATH superfamily
1HAVA 4AFUA 5CE1A 1KDQA 1O3JA 1C5VA 1S6FA 3OEHD 1GBMA 4I8JA 3E1XB 1PPHE 2WINI 2P93A 3E0NB 5A8YA 1BT7A 3AW1A 3Q3YA 1FDPA 4UEHH 2V7QD 3LGVA 2P16A 2BLQA 3SV7A 4Q7ZA 1NO9H 1BB0B 2A4RA 3BIVH 5T6FA 3VEQB 1GJAB 2BQ7B 1O32A 1O3GA 3QUMP 1Y3WA 3RXHA 1SPJA 1DSUA 1NU9A 4Y79A 1SGTA 4ACBA 2D8WA 1ELDE 2QF0A 1J16A 1OWHA 2OC0A 2KM0A 2BM2A 1A2CH 3AASA 5DP7A 4ZROA 1C5MD 4JZFH 3P17H 4B2AA 1C1NA 1P03A 1UTJA 3ATLA 1GBIA 3TK5A 2ZC9H 4JMYA 1QTFA 3ZZ5A 2ALPA 1O36A 1GMDF 1LHCH 3SZNA 4JYVH 1SL3A 1H4WA 4I8GA 2ZNKH 1HBTH 2F83A 1MU6B 1THRH 1VITF 1O2JA 1YLNA 4JZ1A 1VZQH 1GBBA 1NRNH 2FOMB 3A8AA 2EY4C 2THFB 1YYY1 1PPGE 2ZDLA 4THNH 1L1NA 3K6YA 1RTFB 2BOKA 5ABWA 2HWLB 1FIWA 1TGTA 3I77A 1Z6EA 1SGFA 8LPRA 1KXCA 3O8RA 1SGCA 1SQTA 1BUIA 1HJ8A 1TE0A 3P8OA 1C1OA 2UWOA 2GX4A 2D2DA 1Y59T 4CRBA 4JCNA 5TJXA 3SZEA 4I31A 4FU9A 1ZGIA 5AF9H 1QCPA 4ZH8A 1QL8A 2FESH 1LQDB 1TNHA 3JZ2B 5A0AE 3BTFE 1AGJA 2ZFRH 2F43B 1ZSKA 4ASUD 3OYPA 2ZHQH 2VU8E 4DURA 4TYDA 3QTOH 1GJ5H 2FS8A 5EXMA 2A32A 2FOAA 2OC7A 1AVXA 2UWPA 2ZIQH 3KIDU 3ZZDA 4NIWA 1O5DH 1ZMJA 4UE7H 1O2QA 2C8XB 3FO8D 1SGQE 5DGJA 1GMCG 3OE7D 1THSH 2ZU1A 3TGJE 4YTAA 5EG4A 1NFUA 1TGBA 1V2PT 1H8ED 3Q3KA 1GJCB 1ZOMA 1KXEA 2J38A 3T26A 2CK3D 2TGDA 3PV4A 3H7OA 4TWWA 1LPKB 4ZAEA 2FXRA 3SGAE 3RXTA 1ID5H 2FTMA 2FODA 3N7DA 3U8RH 3UWJH 1C5YB 2VH0A 1F5KU 3MMGA 1N6XA 1KMHB 4GUXA 4AYYB 2JH5D 2F91A 2WYGA 4X0WU 1RRKA 2AEIH 3RXFA 4ISHH 1YC0A 3MNBA 1O34A 1WQSA 2CHAB 3RM0H 2Y5HA 3BF6H 4FXGH 1SLVB 3SU1A 2FP7B 2JKHA 3A7VA 2Z3DA 1AE8H 4ABFA 3PROA 1C1WH 4U32A 1GHZA 3F2GA 3QGJA 3V3MA 1C5SA 1W0JD 3A8CA 3QDZB 5F8TA 2BY8X 3LC5A 3LT3A 1GBDA 3KF2A 3SN8A 2FLBH 2CF9H 3ZVEA 3IWMA 1SQAA 3PM3A 3MU4A 4NIVA 1WSSH 3FAOA 5E8EH 3ZZ3A 1TABE 3PO1B 5I25A 2PUQH 3T62A 1C5XB 2ZCKP 1QBOA 1DLKB 2EI8A 1UTOA 3SV8A 2QYIA 4CH2B 2K1QA 1G2MA 2SGQE 3DFLA 3GY8A 1CU1A 3MH5A 1HJAC 1UK2A 2XNDD 3MOCA 1AY6H 3ELAH 1TQ7B 3KGPA 1Z8RA 4Y8XA 5JPMH 2WHXA 1ACBE 3ODFA 4PROA 2NU0E 5DK1A 3PLPA 3S9CA 5C2ZA 1FY5A 2ZQ2A 2W26A 4ZCNA 1BRUP 1J14A 4TWYA 1NZQH 3D62A 4ABDA 1XUHA 3MH7A 1P9SA 2BY7X 3DCLA 3LC3A 1VR1H 2O8LA 1TALA 2O9QA 3KYGA 4H4FA 4IN1A 2ZU4A 1FPHH 1JIMA 2Z3EA 1G3EA 1A4WH 5GIBA 1CQQA 1IQNA 4GSOA 5JBCS 6GCHF 3TGIE 1TWXB 1TPPA 4P02A 1O3BA 1J8AA 4E7RG 1NRSH 2L74A 2WPKS 3UIRA 1C1RA 1K1MA 2BXUH 5IDKA 4ISLA 2F9OA 1MMJN 2OD3B 4E05H 1EAIA 5IK2D 1A0LA 2QN5T 1GG6B 2TPIZ 2PGQB 3PWCA 4I8HA 2Y82A 5J4SA 2BTCE 2H2ZA 3EQ0H 5DN6D 2M2AA 1K1OA 1AUTC 1C9PA 4B73A 3GY7A 1IQLA 2QE7D 3EE0B 4HGCA 1DOJA 1GHBG 3M35A 4LOYH 3HK3B 1P3CA 2UUKB 3D65E 2A4OA 1GMCF 1GDUA 5GPIB 3UQVA 3PRDA 1FN6A 3P70B 3BEUA 1GVZA 3MU5A 2ZF0H 2XBWA 1TIOA 2ZDAH 4AFQA 1ZR0A 1L0ZA 5EXNA 4DOQA 2GDEH 2ZPQA 1O2XA 3QZRA 1UVUH 5FBIA 2RCEA 1BTWA 4MLFB 1C5PA 1LVYA 5FCKA 1W12U 2AMQA 3KQ5A 2ODQA 1QQ4A 1QR3E 2FI4E 4NCYA 4JYTA 1Z1JA 1H9LB 1NS3A 2GCTC 1O2PA 1EPTC 3F1SB 1A5HA 1G3DA 2H9TH 1ELCA 2GZ9A 3CNRA 1Z8IB 4XRNA 3D23A 3UB0A 1GI7B 1O5GH 2EQNA 2PTCE 1IQJA 3CENA 5DP4A 2VVUA 1EAUA 1CHOG 3MH4A 3N99A 2WZQA 1QB1A 1O2ZA 4MDSA 1C4Y2 3TITA 4F55A 1BA8B 4JYUH 4X8SH 2GKVE 1V2ST 1T8MA 1LHGH 1G37A 1W3CA 3RM2H 3RC6A 3GY2A 1JRSA 2CGAA 3P8FA 1CA8B 4AB9A 1E79D 1KTSB 1JOUB 1MAXA 3EA9A 2ZHDA 3BTQE 4Y8ZA 2RA3A 1DWDH 1GHXH 1ZTKA 4Y76A 2QA9E 3NKKA 2BX4A 2F4LA 4E7NA 2J92A 2C3SA 1EZUC 1C2KA 3ZZ8A 2GT7A 1GCTC 2GV6A 3WW7A 1T8OA 4A7IB 1SB1H 1ZZZA 5HMAA 1DSTA 4ZKRU 1MTWA 1O3HA 3KHVA 4RI0A 5EJLA 5LGOA 3F0OA 1OPHB 4FUDA 4TPYA 3KQEA 3T28A 1PQ7A 1DWEH 3PV5A 2AMPA 4WMDA 1YPLH 1EPTB 2VIQA 1Y8TA 1DPOA 2RDEA 4NWLA 4Q7YA 5DKMA 1AKSB 3K9XB 1TPOA 3A82A 3VB5A 1S0QA 3UNQA 1C2IA 3HK6B 3P95A 5FHTA 2NU3E 2HNTE 2R0KA 1V2JT 2QAAA 5E0HA 3ATIA 3LJOA 2P3FH 3RU4D 1QQUA 1GDNA 2TRMA 4HTCH 1EB2A 1Y3YA 4AG2A 2KCOA 1YLCA 1XVMA 5I46H 1V2OT 1BTZA 2FS9A 3I78A 1KXDA 4BAKB 2ZFTA 1D3TB 1DITH 4A5TS 5GWZA 3RMLH 4Y11E 3OFND 3H7TA 4Y7AA 2HPPH 3RXUA 3OTPA 1P2KA 2WPDD 4WMEA 2WV9A 2ZTXA 3CP7A 2VIPA 3HPTB 2FOFA 4H6TA 2TIOA 3LONA 1A5GH 4Q7XA 1KYNA 4X6MA 1O2TA 2YNBA 1W14U 3L6PA 1FY3A 1YF4A 1QL9A 2VIOA 4UFEH 2ANKH 1D6RA 4K60A 2XBVA 4FU8A 4FVDA 1DVAH 1FAXA 1PJPA 1QB6A 3F9EA 2FX4A 4MVNA 2AGGX 5F8XA 2ZI2H 4BANB 1NFXA 4GVUA 3T2NA 2BDYA 2G5VA 1WOFA 1WCZA 4RSPA 5L2ZH 4X1SU 3NUMA 4GPGA 1W13U 1EP5A 4I7YH 1LQEA 1ZHMA 1LTOA 1C2JA 5DP5A 4IMQA 5EOKA 3UTUH 1ZMLA 4RKOB 4AYVB 4FUHA 1THPB 1J15A 4MPWA 4X6NA 3HATH 1P3EA 2ZFPH 1H1BA 1FIZA 2KCYA 1AE5A 2R3UA 1MCVA 1BHXB 1E1RD 1W7GH 1HV7A 1O2MA 3PTBA 2BVXH 2XBXA 1H8IH 3E90B 2PLXA 2ANYA 2ZTZA 2F9NA 4K3JA 1AZ8A 2J94A 3LGUA 1XUGA 1E1QD 3GISB 3N7EA 5L2YH 1C5NH 2H5DA 1KIGH 2P3TB 1LKBA 2PKAA 2F9BH 1UVTH 1OHHD 4IN2A 3S7KB 1AWHB 1YPKH 1O33A 4OS2A 5HIYA 2Z9GA 4F49A 1SLUB 5CHAC 1W0YH 3SUEA 1HYLA 1O2IA 1W8BH 3LIWA 1CGJE 4K1EA 4OS6A 3RXSA 4WH6A 3VB4A 3UY9A 3W95A 1LVOA 1ORFA 3S0NA 4CRCA 1F2SE 2DE9A 4RT1A 3ZVDA 1BBRE 5CDFE 3GY6A 4O3UA 4YZUA 4KTUA 3PMJA 1LO6A 1MU8B 5C5OA 1EFRD 1O3MA 2G00A 2AFQB 2DE8A 1LPGB 1C2MA 1RIWC 1ZJDA 4LXBH 1NFYA 1EXFA 1XMNB 2GGVB 3BTKE 3VB3A 1JXPA 1C5RA 1UHBA 3E16B 1AI8H 2L6OA 3RUOA 4YM9A 3SW2B 4AFSA 1O3NA 3SQEE 4BTIB 4ESTE 1B7XB 1O2OA 3FVFB 1SGNE 2J5UA 1C4V2 1QRXA 1S81A 1EP6A 1HXFH 2XWAA 3UUZA 2ZWLH 3ZV8A 1MKWH 3M5NA 2ZGBH 4WH8A 4Z1MD 1QRZA 1UTMA 1XKBC 3UR9A 1V2RT 2NU2E 2XTTB 3GCNA 2P8OB 1GHWH 1P12E 1ZPCA 4K8BA 3PO1C 3QWCH 2B7DH 3ZZ9A 3TPIZ 1K1PA 4AN7A 4NIXA 1CA0B 1Y3UA 1OXGA 3T5FH 5GXPA 2HNTF 1TOCB 3SJOA 1XKAC 1A1RA 2CN0H 3SU3A 5C20A 4YXWD 2FI3E 2M5TA 1GDQA 1C1SA 2IN2A 5C0UA 1TGSZ 5CHAB 2SGPE 1OYQA 3BIUH 2JH6D 2ZU3A 2ILNA 5JBTA 4R8TB 3O8DA 4D9QA 1XUFA 4I32A 2R2MB 2P3UB 3STJA 3ATKA 4BXWA 4DIHH 3KCGH 1P2QA 1V2LT 4WMFA 2PKSB 1TBRH 1Z6JH 4ACAA 4BAQB 2R2WU 2W7SA 3TJOA 1ZPBA 5LH8A 1C1TA 1UVPA 4MPXA 2J34A 1H8DH 1C5WB 3IITA 1AB9C 3FZZA 1Z8JB 3U8TH 5DP6A 3W1EA 1HXEH 4BTTB 6CHAC 4X2WA 2GD4B 2GT8A 1EJAA 1VCQA 1PFXC 5EW1H 1O3AA 3MNXA 3E3TA 3OTJE 5JB9S 4Y10E 1O3DA 4JK6A 1JBUH 1JIRA 1G2LA 2GZ7A 1GI1A 1MTVA 3SHAH 1O3PB 1RXPA 3TJUA 3PYHA 1S82A 2CV3A 2GMTC 1QNJA 1GCTB 3O8BA 3DSPA 2OQUA 1F5LA 2KFWA 5F53A 3U9AH 5C67A 1C5ZB 1O3IA 3BN9A 1TNLA 2BXTH 2RG3A 1EATA 4GCHF 3GDVA 3RLWH 5A8ZA 1GI4A 1HJAB 3EA8A 1UW7A 3ZZCA 1PYTC 4NGAH 2ANWA 3SNBA 1C5LH 2FIRH 2AIPA 3QTVH 5AVDA 8GCHF 3NRLA 3U69H 7LPRA 2PSYA 3SNDA 1C2GA 2BVRH 4X1NU 1XUJA 1INCA 1DY8A 2PWXA 1PQ8A 2VJ1A 1P2JA 1OKXA 4CH8B 1MQ5A 1VJAU 2O8WA 3A7XA 1WBGB 1QRWA 1HAHH 2BDBA 2H5CA 4SGAE 1SGPE 2PUXB 1TRNA 3GCTG 3VXFH 2BLWA 3EYDA 2XYAA 2WPIS 1CO7E 1FXYA 1FY8E 2BHGA 1WU1A 1ZLRA 4GHTA 4K5ZA 2VB0A 2AERH 3V0XA 1EJNA 1Z71A 3M3VA 4ZHAA 1O2HA 3DT0H 2Z9KA 2V3HH 2LELA 1YWUA 2PW8H 4INKA 1ELEE 2VIDA 1L1GA 1ELTA 3DUXH 2FOCA 1LHEH 5HIZA 3M7TA 1TPAE 5FPSA 1O35A 4A92A 3U1IB 7KMEH 4CBOA 1MH0A 1Q2WA 2BQ6B 2OUAA 5FXLA 1G9IE 3RDZA 3RXJA 1UK4A 3LKWA 1V2UT 1BITA 1CT0E 4BAHB 3QX5H 2SGEE 3UPEA 1VGCC 3SJ8A 2RA0A 4HFPB 8ESTE 2R0LA 1TX8A 4NIYA 1F0TA 3SQHE 1TFXA 5G4BA 3P8NA 3S7HB 4QT8C 2Y5GA 4O03A 1B5GH 1MKWK 2TBSA 4ABHA 2EI6A 1V6DA 1AFQB 3GYMA 2V35A 4MTBA 1PQ5A 3E8LA 3ZZAA 2P94A 4NSVA 1W10U 1CT4E 4ZUHA 1C5UA 1GCDA 1CT2E 3GCOA 3RC4A 1D3DB 1ABJH 5SGAE 2GDDA 4DT7B 4X8TH 4WVPE 2OBOA 1UVSH 1YKTA 2GCTB 4Q2KA 1C5OH 2ZHEH 2FOHA 2W3IA 1QFKH 1ANEA 3LU9B 1AO5A 2FDAA 2BZ6H 2TGTA 1O2NA 1TNIA 4X8VH 1AQ7A 3F68H 4ABAA 2HLCA 1WYKA 3RU4E 2J9NA 1KXBA 4D7GA 3SV9A 1HUTH 1EOJA 1VKYA 4X2VA 1X7AC 2OP9A 3F9FA 1GPZA 1B0FA 1LVBA 1C4U2 1P2NA 3FFGA 1OYTH 3RMOH 5TCAA 1KLJH 2ZGJA 3KQBA 2FLRH 1IQEA 3M5LA 3UAIC 2A5KA 1SGDE 4UFFH 4MPUA 4LZ1H 1P11E 4CRFA 1LMWB 2ZZUH 5K7RA 1HGTH 1YLDA 3LOXA 1UTKA 4AB8A 1ABIH 3A85A 4FOUC 5F6MA 3GCTF 1SBWA 3QN7A 2D1JA 4AZ2B 1AKSA 2BDHA 2K0QA 3ZVFA 1MZAA 8KME2 1A61H 1W0KD 4FUBA 2K8IA 1E38B 4YOIA 2AHME 1V2NT 5A0BA 5C1YA 2RDLA 1P02A 1SI5H 3A80A 2XWBI 1S6LA 4MNVA 3KNXA 1GL0E 3BEFB 4MQAA 4AGJA 1HJ9A 1ANCA 4B6FA 5L30H 4NZQA 2QF5A 1HNEE 5J4QA 1A3EH 1SOZA 4MNXA 1OWEA 1S5SA 2ULLA 1PPBH 1FLEE 3P8GA 3DSGA 3K2UA 1ETSH 1MQ6A 1SGIB 1N8OC 2GJGA 5E2OA 3M36A 4GAWA 2B0FA 1DXPA 3GDSA 3MU1A 2BYAX 4TSFD 5C94A 4DVAU 3UQOA 1COWD 2C8YB 1MKXK 2FYQA 4B75A 1GL1A 1KXAA 3WWBA 5GNDA 4DJZB 1TMBH 1TRYA 1TX6A 1KXFA 1QHRB 3ZZBA 2ZO3H 3R3GB 3SU0A 1PPCE 3SV2H 1P09A 1P0SH 1ETTH 1O2YA 2HRVA 1BJUA 1UTQA 1GJ6A 3NPSA 4TY7A 3K6ZA 1LDTT 1AVGH 2SGFE 2ZP0H 4GCHG 3MYWA 3VB6A 1F0SA 1ZSLA 2Q6GA 1GBCA 4Y6DA 2A1DB 2A4GA 2QCYA 2ZHFH 4HG6A 3GCHC 2WV4A 1AUJA 1ETRH 2QXIA 3PMHB 1G3CA 2WYJA 3BSQA 4JZIA 1P01A 1GBTA 1MTUA 3RXRA 1ESAA 1KSNA 1WV7H 3H09A 3NXPA 1SGFG 4FU7A 1F92A 4IC6A 2KCAA 2LNCA 2HNTC 1G30B 3SI3H 3AAVA 1M9UA 1IQIA 3BTHE 1FAKH 1KY9A 4KP0A 1ELAA 4X6OA 3VFEA 3T27A 5T6GA 1O3KA 2GZ8A 1SLXB 1AMHA 3ZZ6A 4YESB 3SUDA 2PFEA 2KR7A 4B2CA 2P8OC 1P10A 2ASUB 3TJNA 4IW4E 1T8NA 1BMAA 5ESTE 5GJ4B 2YNAA 3HKJB 2CMYA 3ZYEA 2WPMS 2KZ4A 3BTTE 4B76A 3B23B 1TNKA 1V2QT 1YPMH 1Z1IA 5EJ1A 2ODYB 1O3LA 2G51A 1UK3A 1TRMA 1WDIA 4ABJA 4O3TA 5T3HA 3P92A 4LK4A 4INLA 2GTBA 1SG8B 1C1PA 1SQOA 2JIZD 4TPIZ 3RP2A 2QIQA 3MO3A 3TLOA 2HOBA 1FV9A 2CJIA 3GCHB 1S85A 1O3FA 1O5CB 3RXMA 1U6QA 5L6NH 2V0BA 3VPKA 1YCPK 2PP6A 1OWJA 1TMTH 1MAYA 1GBKA 1GG6C 2J97A 1AVWA 2R9PA 2ZQ1A 1HIAA 1O39A 3LGIA 4BAOB 2VWOA 3F9GA 1Y5BT 3PV2A 1LVMA 1BRBE 1F0RA 1UO6A 2OLGA 3RXAA 1BTHH 3TJVA 4ZKSU 1HAXB 1ZTLA 3WWFA 2V6NA 2ZG0H 3BTGE 3F0PA 6ESTA 2BD5A 2FO9A 3CS7A 2FYRA 1GBEA 2WSSD 3SGQE 1CHOF 1QA7A 1VITH 1NN6A 3RXCA 2XC0A 1C2LA 1S84A 3FP7E 1FZZA 5CHBA 2XCNA 4I8KA 5C1XA 5AFYH 2ZDMA 2ANMH 3SU4A 3KEEA 1S83A 1P9UA 1IQGA 3KYFA 1DT2A 1CGIE 4NZLA 1QL7A 2CXVA 1QBVH 1WTHD 1ELBA 3DA9B 1Z7KA 4ZHMU 3BEIB 3NWUA 4P00A 3WY8A 1CBWB 1BDAA 2UUFB 1HPGA 1TB6H 4WY3A 2BD2A 5DJ7A 3O8CA 1UTPA 2BVSH 2GCHG 2JJ2D 5BRRE 3RXIA 4D9RA 4XE4A 5EQSA 4X1QU 3LGYA 3PMAB 4IS5A 3TVJB 3VXEH 3UFAA 3A81A 1GJ9B 2B8OH 1C5TA 1GJ7B 1H9HE 2WPLS 1GGDC 3FKSD 1SVPA 1XM1A 4YO9A 4SGBE 1MZDA 1GGDB 4UFDH 3LH3A 3ZZ7A 3A7YA 3E6PH 1C2FA 2FWWA 1BTYA 3SJIA 2Z9IA 4IBLH 4LZ4B 3F6UH 3TH4H 2BD8A 2BDGA 5TCCA 1K28D 1O37A 3FP8E 5JBBS 1O30A 4MNYA 4U2WA 1P2OA 2F9PA 2XW9A 1K0HA 1K22H 1E36B 2FOGA 4F4OC 1C2EA 1IAUA 1O2UA 1Y3VA 2ZGXH 2Q1JA 1W2KH 4H42U 3MU0A 4CR9A 2ZPRA 6GCHG 1S6HA 2A7HA 1D3PB 5DP3A 3SV6A 3VG8A 1O0DH 4ABIA 1GHBF 4DGJA 2J95A 3M5MA 2O8UA 1UTLM 2G4UA 5EQQA 3SI4H 2PGBB 4JZDH 1O3CA 1N1LA 5T6DA 4ISNA 2BLVA 4NFEA 3SU5A 4UFGH 3SU6A 4A1VA 1FJSA 3MNCA 1GBAA 1MD7A 5A0CA 2FPZA 2BY9X 5EPYA 1GBLA 3T25A 1K1IA 2YMSC 2OC8A 3QGNB 2PV9B 1QA0A 1FY4A 1YY3A 1BBRK 4HZHA 2SFAA 1UTNA 4AG1A 2BLOA 1DDJA 4TY6A 3LDXH 1DANH 2W6JD 1GMDG 3A7TA 2KAIB 3OX7U 2G81E 3EDXB 3U8OH 3V7TA 3KQDA 1NROH 3KN2A 2VGCB 3OU0A 2H9EH 3MO9A 3BTME 1YPGH 3TGKE 3A8DA 1ZHRA 1CHGA 2AYWA 4Z0KA 4NA9H 2A2XH 4X6PA 1J9CH 1YGCH 4XFQA 3RXVA 2J4IA 3SOSA 1O2SA 2OINA 1ZTJA 1SFQB 3SJ9A 3S9BA 4BOHA 4OM9A 3RC5A 1L2EA 1C1MA 1ELFA 5HYOA 3M3TA 4X2XA 4M9FA 1FI8A 3MWIU 4K8YA 2AMDA 2STAE 2ZDKA 4FUIA 2QGRA 3GYLB 5B6OA 2IPHA 1DWCH 4AOQA 1MBQA 2HALA 4ASHA 1XXFA 1L1JA 1A46H 2V3MA 1XUIA 4WF8A 2Z94A 2Y6TA 3GICB 4B6EA 1BOQA 3M5OA 4Z6AH 1F5RA 2BY5X 3ZYDA 1GBJA 2J98B 4Q63A 2BB4A 2I6QA 4FUCA 1BQYA 2GMTB 7ESTE 5AFZH 5E0JA 1SHYA 5B6LA 1HCGA 1N6YA 3ZIAD 3UNRA 4INHA 3GS9A 4U01A 3SORA 2VVVA 1RTKA 2J2UA 5KEDA 4FUFA 3UOPA 1E35B 1O2LA 1WAYB 3HKIB 2VINA 2ZHWH 5JYIA 3EA7A 4ABGA 1Q3XA 1BBRH 4FUGA 3OSYA 2W6ID 4OGXA 5F8ZA 2XCFA 1NBMD 3NCLA 4RN6A 4DY7B 1RTLA 1G32B 2V3OH 1HAIH 1HAVB 2NU1E 2YOLA 1ZHPA 1GVKB 1SSXA 1VCWA 5C3NA 1EX3A 1D9IA 2SGAA 1GI3A 3BTDE 1T32A 4DT4A 5CMXH 2JETB 1Q31A 1DWBH 3LGTA 4YOGA 6CHAB 2D26C 4XSKU 1QBNA 2G4TA 3H5CB 1UJ1A 1OWKA 5C1UA 2QC2A 1GBHA 2HPQH 2ZEBA 5KGOA 1N8OB 2DUCA 1ZPZA 4OS7A 2C4FH 2Z9JA 2XNIA 2VIVA 1ZRBA 2HGTH 3TNTA 1SFIA 2A31A 1GI2A 1YM0A 2XBYA 1VCPA 2AS9A 3QO6A 4Y0YE 1H9IE 3ATMA 2XC4A 5AHGH 1GI8B 4UONA 1AB9B 1RGQA 3SNEA 2ZDVH 2H1UA 2VH6A 1CVWH 1FONA 2ZFSA 1GMHG 3TH3H 2WPHS 3QK1A 5FPYA 3M37A 1FN8A 3URDA 3A88A 2ZECA 3A87A 1BRAA 4X1RU 4K1SA 1PPZA 2BY6X 1VGCB 4Y7BA 2A5AA 4E06H 1KDQB 5FAHA 1WQVH 1S0RA 4XBCA 5FX6A 3RU4T 4YT6H 1XX9A 4NA8A 3TU7H 5JDUB 2ZGCA 2W5EA 1RJXB 4NA7A 2GV7A 2TGAA 3MTYA 2FX6A 5H4IB 4K2YA 1GBFA 3F2FA 5E2PA 1HAYB 3ITIA 1QZ8A 3OY5U 3V13A 1P2IA 2HVXA 2YMSD 5GCHG 2QXGA 1AFEH 1GJ8B 4K1TA 2J98A 2Z3CA 3SNCA 3M61U 2CF8H 4B1TA 4DCDA 4I8LA 3LPRA 2QF3A 1YPEH 1SC8U 4OS1A 1O2KA 4ABBA 1HLTH 2O8TA 3I29A 4CRDA 4FUEA 3L3TA 4OS4A 2QF4A 3PRBA 3F2HA 1TBQH 4CHAB 1NESE 2JDID 2B9LA 2WV5A 1T4VH 2A7CA 1OOKB 2OBQA 2FEQH 5A2MH 2LPRA 2PR3A 1FPCH 1EASA 1NTPA 1RIWB 3BTEE 1BMLA 1OSSA 4TT3D 1V3XA 1HAPH 1EB1H 3TIUA 1AZZA 1C9TA 3M7UA 1IQKA 2FM2A 1GHVH 2CHAC 5ESBA 2O8MA 2Z6BD 1HIAB 1D3QB 1SGEE 2BOHB 3QLPH 1GJDB 2ZTYA 3A7ZA 1TPSA 3PB1E 3Q77A 2VWLA 3RMMH 1OP2A 1QIXB 3SBKA 5EXLA 1GHAG 4KTSA 1F7ZA 1LKAA 2SGDE 4BNRA 1EAWA 1GVLA 1QJ6B 2VWNA 1IQMA 4IGDA 1O38A 4A1TA 5A8XA 1GI6A 4F48B 1DE7H 3BTWE 3OEED 1T31A 2C90B 1NU7B 1DUAA 1AD8H 4UD9H 5DG6A 2A4QA 3A8BA 4D7FA 5EODA 3U98H 1QURH 1ZGVA 2I6SA 1BHXF 1ESTA 1P2MA 4CR5A 9ESTA 2BDAA 1PQAA 2Q6FA 2IPQX 3ENSB 2W7UA 3ZVCA 4WJG2 3SU2A 2BD7A 2IOTA 1JWTA 1ZRKA 2QV1A 4OGYA 1PYTD 2P59A 4WWYA 2SNVA 2VBCA 3Q00A 2QXHA 3MU8A 4D8NA 1IQHA 1DY9A 1XUKA 1ZSJA 3RXEA 1C1UH 4WXIA 1YP9A 2ALVA 3SGBE 1ZMNA 1P57B 1VJ9U 4J1YA 3QZQA 1DXWA 3C1KA 1ELVA 2Z7FE 2ZGHA 1NM6A 3MHWU 3BG4B 5EW2H 2BDCA 2JJ1D 1EZXC 1PPFE 1CE5A 5DP9A 2C8ZB 2A0QB 1OS8A 2F9VA 3ODDA 5F03A 5KECA 1O5EH 4UDWH 1W7XH 3URCA 1AN1E 2G5NA 1V2WT 2ZKSA 1Y5UT 2Y5FA 1UVOA 1GI9B 1WXRA 2UUJB 3S9AA 1MTNB 5FX5A 3T29A 2ZFFH 3M7QA 1MABB 4OS5A 3SUGA 1P05A 4MNWA 1DX5M 2PHBA 5K0HA 4DG4A 1LPZB 5DP8A 1BMNH 2PTNA 1LHDH 2PKSC 4Y71A 3RXOA 1GHYH 2ZU5A 4XBDA 3UWIA 1ZYOA 4ZKNU 3S69A 1GI0A 2G55A 2ZCHP 3GY5A 2VNTA 1XVOA 2PSXA 4IMZA 1L4ZA 8GCHG 3B8JA 1VITG 3FP6E 3RXBA 2XOKD 1EAXA 3GOVB 3VGCC 5FL7D 2A45B 2VWMA 2AGIX 3FZDA 2Q6DA 3SO3A 5EU8A 3STIA 1V2VT 2BDIA 1W11U 1TGCA 1C2DA 1KLTA 2FOEA 1UCYK 4FETA 1H8HD 1IHSH 2WUCA 9LPRA 4IC5A 2ESTE 2F3CE 1P04A 3LH1A 5JB8S 1ELGA 1NPMA 3ZVBA 2C93B 2OXSA 1FUJA 3C27B 1BRCE 3PLBA 5LPFA 2LP6A 2H9HA 2H6MA 1TA6A 4AGKA 1A3BH 3A84A 5DO4H 1GHAF 5DSFA 2P95A 2Y7XA 4BAMB 4O9VA 1YBWA 1TONA 1V2MT 5HM9A 1K1JA 2EC9H 5EPNA 1TLDA 3TNSA 1ARBA 3A86A 1SR5C 1GMHF 4GHQA 2FTLE 3FN8A 1HAGE 2ZFQH 4AORA 1WTGH 2FZZA 4H6SB 3N7OA 1TNJA 2A2QH 2BD4A 1EQ9A 3ESTA 1O5FH 1EPTA 1UHBB 1ANBA 1NRQH 1CSOE 5FCRA 1OWDA 1HAOH 5EJZA 3CS0A 2UWLA 1QJ1B 3W94A 4NWKA 2JETC 3A89A 2ZA5A 1YCPM 4BTUB 4BXSA 4O97A 1Y3XA 4KTCA 1EZSC 3R0FA 1ARCA 1NBME 1YPHC 1IQFA 1SGRE 1NRRH 3GY4A 1FX0B 3UNSA 3SHCH 1TA2A 1YCPH 4I86A 4CREA 2BD3A 1BCUH 1OP0A 1DM4B 1TOMH 2ZCLP 1LHFH 1TBZH 1XXDA 1O2RA 1RS0A 4ISIH 2AH4X 2TGPZ 3PLKA 7GCHF 4J2YB 2G8TA 3BG4C 1AHTH 3ZV9A 1T8LA 3DFJA 4YLQH 4MG3A 1G3BA 3EE7A 2Z9LA 3E0PB 2OQ5A 3B9FH 1P06A 4JZEH 4DW2U 5C0TA 1K2I1 3DD2H 2BQWB 1ANDA 1O5BB 3P6ZB 3RMNH 4Q80A 4Y0ZE 5HKKD 4CBNA 5FPTA 1SLWB 2GVFA 4B71A 3M3SA 4X2YA 3UOUA 3FANA 4I33A 1OP8A 1SHHB 4Q4LA 4CRAA 7GCHG 4FUJA 3A83A 1O2VA 2A5IA 5IYTA 4AX9H 1CGHA 2OTVA 1QY6A 1QJ7B 1O2GH 2ZDNA 1T7CA 3JZ1B 1KTTB 1UCYE 4M7GA 1G36A 1GI5A 1P8VC 4B74A 1NRPH 3SJKA 3OY6U 1HFDA 1O2WA 3HGPA 4NFFA 3V12A 1SKYE 1TQ0B 2FMJA 3SNAA 3RXGA 2B5TB 1GWAA 1TNGA 1O31A 2NWNA 1EJMA 3FOAA 3MFJA 2KX4A 3F9HA 4ZXXH 1QB9A 1E37B 4GLYA 1TGNA 4B2BA 1A0JA 2KCPA 1K1NA 1YPHE 2AIQA 4XBBA 1V2KT 1C2HA 2OK5A 3SYJA 5FBEA 1SMFE 3D49H 3ZVAA 1MKXH 3AVZA 5C5NA 4RT0A 1JRTA 3TK6A 1MUEB 2NU4E 2XC5A 3RLYH 3TK9A 3U1JB 5LPEA 1JMOH 2BZAA 3MNSA 1RFNA 3LJJA 1SOTA 3KQCA 1AU8A 3PMBB 4HI3A 1EUFA 4X8UH 1A0HB 1OX1A 1W0ZU 2KAIA 5T1VA 1D4PB 2HVYB 4KKDA 2WUBA 1O3OA 1FMGA 3DHKH 3EAJA 5LPRA 3U28C 1F0UA 5DPAA 1FY1A 1WUNH 1CA0C 1PPEE 1AWFH 3UR6A 3RXLA 4DIIH 1MD8A 1BTXA 4U30A 1TAWA 1YPJH 4K69A 4NSYA 5GCHF 4D76A 4XD7D 2RFKC 4X1PU 1NFWA 1A7SA 2G52A 4VGCB 2Y7ZA 3GDUA 1TYNA 4Y8YA 3MI4A 3A7WA 2F9UA 3ZVGA 2VIWA 3HGNA 4YT7H 1OWIA 3Q76A 3RXQA 5EIYA 1Z8GA 1DICA 5HXFA 3OAAD 4ZMAH 1EZQA 2IJOB 2W3KA 5EQRA 1HDTH 3AK5A 1ZJKA 2WPJS 3E91A 3BG8A 1BTUA 5EGMA 1NC6A 1FQ3A 5C17A 5HM2A 1DS2E 1FNIA 1QGFA 1TX7A 1EOLA 4ISOA 1C1QA 5BPEA 1AIXH 3DSOA 5GDSH 3G01A 1K21H 2FOBA 3BV9B 4A6LA 1HAZB 3UREA 1E0FD 1LCYA 1BJVA 1GJBB 3KL6A 2Y81A 1DLEA 2EA3A 4KGAA 4CRGA 4XDEA 3ZZ4A 1AFQC 4AFZA 2QY0B 1HB0B 2GCHF 4XOJA 2ZU2A 2HLDD 2ZPSA 1UCYH 2OC1A 1C1VH 3AAUA 1E34B 5ETXA 1TMUH 4YOJA 3PWBA 2IJD1 3MQKC 1BIOA 1O3EA 5E0GA 3K65B 1NY22 4ZHLU 3EGKH 4MPVA 3F3BA 1A5IA 5PTPA 3PTNA 2R3YA 1J17T 1B0EA 1MCTA 2BD9A 4WXVA 2BMGB 3MH6A 4JK5A 1RD3B 2QXJA 3L33A 1MTSA 4NG9H 1K1LA 4ABEA 2EEKA 1BMFD 3NZIA 1IOEA 4ZKOU 1IHTH 2AGEX 2OCVB 4KELA 3VGCB 1C5QA 1MTNC 6LPRA 3LGWA 1DUEA 2VGCC 3TH2H 1DFPA 1L4DA 1CBWC 1EKBB 2PKAB 4FVBA 1Y5AT 1GJ4H 5A09A 1O5AB 1V2TT 4YLUA 1HRTH 1NT1A 2SNWA 2XRCA 4VGCC 3GY3A 1SQRA 2YMSB 2STBE 2GP9B 1BTPA 3RXDA 1UMAH 3SUFA 1T4UH 3VB7A 2VVCA 2JH0D 2A7JA 2XXLA 3RXPA 2BX3A 5JBAS 1D6WA 1SGYE 1BMMH 3Q3XA 2ODPA 3NK8A 4ZXYH 3AW0A 4AC9A 2EI7A 2C8WB 2FI5E 1KLIH 2Y80A 3MO6A 4R0IA 5HGGA 3IG6B 3ATWA 3RXKA 4RKJB 4CHAC 1MBMA 1BZXE 1K9OE 2UUYA 1ESBA 4A1XA
chains in the Genus database with same CATH topology
1HAVA 4AFUA 5CE1A 1KDQA 1O3JA 1C5VA 1S6FA 4I8JA 1GBMA 3E1XB 1PPHE 2WINI 2P93A 3E0NB 5A8YA 1BT7A 3AW1A 3Q3YA 1FDPA 4UEHH 3LGVA 2P16A 2BLQA 3SV7A 4Q7ZA 1NO9H 1BB0B 2A4RA 3BIVH 5T6FA 3VEQB 1GJAB 2BQ7B 1O32A 1O3GA 3QUMP 1Y3WA 3RXHA 1SPJA 1DSUA 1NU9A 4Y79A 1SGTA 2D8WA 1ELDE 2QF0A 1J16A 1OWHA 2OC0A 2BM2A 1A2CH 3AASA 5DP7A 4ZROA 1C5MD 4JZFH 3P17H 4B2AA 1C1NA 1P03A 1UTJA 3ATLA 1GBIA 3TK5A 2ZC9H 4JMYA 1QTFA 3ZZ5A 2ALPA 1O36A 1GMDF 1LHCH 3SZNA 4JYVH 1SL3A 1H4WA 4I8GA 2ZNKH 1HBTH 2F83A 1MU6B 1THRH 1VITF 1O2JA 4JZ1A 1VZQH 1GBBA 1NRNH 2FOMB 3A8AA 2THFB 1YYY1 1PPGE 2ZDLA 4THNH 1L1NA 3K6YA 1RTFB 2BOKA 5ABWA 2HWLB 1FIWA 1TGTA 3I77A 1Z6EA 1SGFA 8LPRA 1KXCA 3O8RA 1SGCA 1SQTA 1BUIA 1HJ8A 1TE0A 3P8OA 1C1OA 2UWOA 2GX4A 2D2DA 1Y59T 4CRBA 4JCNA 5TJXA 4I31A 4FU9A 1ZGIA 5AF9H 1QCPA 4ZH8A 1QL8A 2FESH 1LQDB 1TNHA 3JZ2B 5A0AE 3BTFE 1AGJA 2ZFRH 1ZSKA 3OYPA 2ZHQH 2VU8E 4DURA 4TYDA 3QTOH 1GJ5H 2FS8A 5EXMA 2A32A 2FOAA 2OC7A 1AVXA 2UWPA 2ZIQH 3KIDU 3ZZDA 4NIWA 1O5DH 1ZMJA 4UE7H 1O2QA 2C8XB 1SGQE 5DGJA 1GMCG 1THSH 2ZU1A 3TGJE 4YTAA 5EG4A 1NFUA 1TGBA 1V2PT 3Q3KA 1GJCB 1ZOMA 1KXEA 2J38A 3T26A 2TGDA 3PV4A 3H7OA 4TWWA 1LPKB 4ZAEA 2FXRA 3SGAE 3RXTA 1ID5H 2FTMA 2FODA 3U8RH 3UWJH 1C5YB 2VH0A 1F5KU 3MMGA 1N6XA 4GUXA 4AYYB 2JH5D 2F91A 2WYGA 4X0WU 1RRKA 2AEIH 3RXFA 4ISHH 1YC0A 3MNBA 1O34A 1WQSA 2CHAB 3RM0H 2Y5HA 3BF6H 4FXGH 1SLVB 3SU1A 2FP7B 2JKHA 3A7VA 2Z3DA 1AE8H 4ABFA 3PROA 1C1WH 4U32A 1GHZA 3QGJA 3V3MA 1C5SA 3A8CA 3QDZB 5F8TA 2BY8X 3LC5A 3LT3A 1GBDA 3KF2A 3SN8A 2FLBH 2CF9H 3ZVEA 3IWMA 1SQAA 3PM3A 3MU4A 4NIVA 1WSSH 3FAOA 5E8EH 3ZZ3A 1TABE 3PO1B 5I25A 2PUQH 3T62A 1C5XB 2ZCKP 1QBOA 1DLKB 2EI8A 1UTOA 3SV8A 2QYIA 4CH2B 2K1QA 1G2MA 2SGQE 3DFLA 3GY8A 1CU1A 3MH5A 1HJAC 1UK2A 3MOCA 1AY6H 3ELAH 1TQ7B 3KGPA 1Z8RA 4Y8XA 5JPMH 1ACBE 3ODFA 4PROA 2NU0E 5DK1A 3PLPA 3S9CA 5C2ZA 1FY5A 2ZQ2A 2W26A 1BRUP 1J14A 4TWYA 1NZQH 3D62A 4ABDA 1XUHA 3MH7A 1P9SA 2BY7X 3LC3A 1VR1H 2O8LA 1TALA 2O9QA 4H4FA 4IN1A 2ZU4A 1FPHH 1JIMA 2Z3EA 1G3EA 1A4WH 5GIBA 1CQQA 1IQNA 4GSOA 5JBCS 6GCHF 3TGIE 1TWXB 1TPPA 1O3BA 1J8AA 4E7RG 1NRSH 2WPKS 3UIRA 1C1RA 1K1MA 2BXUH 5IDKA 4ISLA 2F9OA 1MMJN 2OD3B 4E05H 1EAIA 1A0LA 2QN5T 1GG6B 2TPIZ 2PGQB 3PWCA 4I8HA 2Y82A 5J4SA 2BTCE 2H2ZA 3EQ0H 1K1OA 1AUTC 1C9PA 4B73A 3GY7A 1IQLA 3EE0B 4HGCA 1DOJA 1GHBG 3M35A 4LOYH 3HK3B 1P3CA 2UUKB 3D65E 2A4OA 1GMCF 1GDUA 5GPIB 3UQVA 1FN6A 3P70B 3BEUA 1GVZA 3MU5A 2ZF0H 2XBWA 1TIOA 2ZDAH 4AFQA 1ZR0A 1L0ZA 5EXNA 4DOQA 2GDEH 2ZPQA 1O2XA 3QZRA 1UVUH 5FBIA 2RCEA 1BTWA 4MLFB 1C5PA 1LVYA 5FCKA 1W12U 2AMQA 2ODQA 1QQ4A 1QR3E 2FI4E 4NCYA 4JYTA 1Z1JA 1H9LB 1NS3A 2GCTC 1O2PA 1EPTC 3F1SB 1A5HA 1G3DA 2H9TH 1ELCA 2GZ9A 1Z8IB 3D23A 1GI7B 1O5GH 2PTCE 1IQJA 3CENA 5DP4A 2VVUA 1EAUA 1CHOG 3MH4A 1QB1A 1O2ZA 4MDSA 1C4Y2 3TITA 1BA8B 4JYUH 4X8SH 2GKVE 1V2ST 1T8MA 1LHGH 1G37A 1W3CA 3RM2H 3RC6A 3GY2A 1JRSA 2CGAA 3P8FA 1CA8B 4AB9A 1KTSB 1MAXA 1JOUB 3EA9A 2ZHDA 3BTQE 4Y8ZA 2RA3A 1DWDH 1GHXH 1ZTKA 4Y76A 2QA9E 3NKKA 2BX4A 4E7NA 2J92A 2C3SA 1EZUC 1C2KA 3ZZ8A 2GT7A 1GCTC 2GV6A 4A7IB 1T8OA 1SB1H 1ZZZA 5HMAA 1DSTA 4ZKRU 1MTWA 1O3HA 3KHVA 5LGOA 1OPHB 4FUDA 4TPYA 3KQEA 3T28A 1PQ7A 1DWEH 2AMPA 4WMDA 1YPLH 1EPTB 2VIQA 1Y8TA 1DPOA 5DKMA 4NWLA 4Q7YA 1AKSB 3K9XB 1TPOA 3A82A 3VB5A 1S0QA 3UNQA 1C2IA 3HK6B 3P95A 5FHTA 2NU3E 2HNTE 2R0KA 1V2JT 2QAAA 5E0HA 3ATIA 3LJOA 2P3FH 3RU4D 1QQUA 1GDNA 2TRMA 4HTCH 1EB2A 1Y3YA 4AG2A 1YLCA 1XVMA 5I46H 1V2OT 1BTZA 2FS9A 3I78A 1KXDA 4BAKB 2ZFTA 1D3TB 1DITH 4A5TS 5GWZA 3RMLH 4Y11E 3H7TA 4Y7AA 2HPPH 3RXUA 1P2KA 4WMEA 2ZTXA 3CP7A 2VIPA 3HPTB 2FOFA 4H6TA 2TIOA 3LONA 1A5GH 4Q7XA 1KYNA 4X6MA 1O2TA 2YNBA 1W14U 3L6PA 1FY3A 1YF4A 1QL9A 2VIOA 4UFEH 2ANKH 1D6RA 4K60A 2XBVA 4FU8A 4FVDA 1DVAH 1FAXA 1PJPA 1QB6A 3F9EA 2FX4A 4MVNA 2AGGX 5F8XA 2ZI2H 4BANB 1NFXA 4GVUA 3T2NA 2BDYA 2G5VA 1WOFA 1WCZA 4RSPA 5L2ZH 4X1SU 3NUMA 4GPGA 1W13U 1EP5A 4I7YH 1LQEA 1ZHMA 1LTOA 1C2JA 5DP5A 4IMQA 5EOKA 3UTUH 1ZMLA 4RKOB 4AYVB 4FUHA 1THPB 1J15A 4MPWA 4X6NA 3HATH 1P3EA 2ZFPH 1H1BA 1FIZA 1AE5A 2R3UA 1MCVA 1BHXB 1W7GH 1HV7A 1O2MA 3PTBA 2BVXH 2XBXA 1H8IH 3E90B 2PLXA 2ANYA 2ZTZA 2F9NA 4K3JA 1AZ8A 2J94A 3LGUA 1XUGA 3GISB 5L2YH 1C5NH 2H5DA 1KIGH 2P3TB 1LKBA 2PKAA 2F9BH 1UVTH 4IN2A 3S7KB 1AWHB 1YPKH 1O33A 4OS2A 2Z9GA 4F49A 1SLUB 5CHAC 1W0YH 3SUEA 1HYLA 1O2IA 1W8BH 3LIWA 1CGJE 4K1EA 4OS6A 3RXSA 4WH6A 3VB4A 3UY9A 3W95A 1LVOA 1ORFA 3S0NA 4CRCA 1F2SE 2DE9A 3ZVDA 1BBRE 3GY6A 4O3UA 4YZUA 4KTUA 3PMJA 1LO6A 1MU8B 5C5OA 1O3MA 2G00A 2AFQB 2DE8A 1LPGB 1C2MA 1RIWC 1ZJDA 4LXBH 1NFYA 1EXFA 1XMNB 2GGVB 3BTKE 3VB3A 1JXPA 1C5RA 1UHBA 3E16B 1AI8H 3RUOA 4YM9A 3SW2B 4AFSA 1O3NA 3SQEE 4BTIB 4ESTE 1B7XB 1O2OA 3FVFB 1SGNE 1C4V2 1QRXA 1S81A 1EP6A 1HXFH 2XWAA 3UUZA 2ZWLH 3ZV8A 1MKWH 3M5NA 2ZGBH 4WH8A 1QRZA 1UTMA 1XKBC 3UR9A 1V2RT 2NU2E 2XTTB 3GCNA 2P8OB 1GHWH 1P12E 1ZPCA 4K8BA 3PO1C 3QWCH 2B7DH 3ZZ9A 3TPIZ 1K1PA 4AN7A 4NIXA 1CA0B 1Y3UA 1OXGA 3T5FH 5GXPA 2HNTF 1TOCB 3SJOA 1XKAC 1A1RA 2CN0H 3SU3A 5C20A 2FI3E 2M5TA 1GDQA 1C1SA 2IN2A 1TGSZ 5CHAB 2SGPE 1OYQA 3BIUH 2JH6D 2ZU3A 2ILNA 5JBTA 4R8TB 3O8DA 4D9QA 1XUFA 4I32A 2R2MB 2P3UB 3STJA 3ATKA 4BXWA 4DIHH 3KCGH 1P2QA 1V2LT 4WMFA 2PKSB 1TBRH 1Z6JH 4BAQB 2R2WU 2W7SA 3TJOA 1ZPBA 5LH8A 1C1TA 1UVPA 4MPXA 2J34A 1H8DH 1C5WB 3IITA 1AB9C 3FZZA 1Z8JB 3U8TH 5DP6A 1HXEH 4BTTB 6CHAC 4X2WA 2GD4B 2GT8A 1EJAA 1VCQA 1PFXC 5EW1H 1O3AA 3MNXA 3E3TA 3OTJE 5JB9S 4Y10E 1O3DA 4JK6A 1JBUH 1JIRA 1G2LA 1GI1A 2GZ7A 1MTVA 3SHAH 1O3PB 1RXPA 3TJUA 3PYHA 1S82A 2CV3A 2GMTC 1QNJA 1GCTB 3O8BA 2OQUA 1F5LA 3U9AH 5C67A 1C5ZB 1O3IA 3BN9A 1TNLA 2BXTH 2RG3A 1EATA 4GCHF 3GDVA 3RLWH 5A8ZA 1GI4A 1HJAB 3EA8A 3ZZCA 1PYTC 4NGAH 2ANWA 3SNBA 1C5LH 2FIRH 2AIPA 3QTVH 5AVDA 8GCHF 3U69H 7LPRA 2PSYA 3SNDA 1C2GA 2BVRH 4X1NU 1XUJA 1INCA 1DY8A 2PWXA 1PQ8A 2VJ1A 1P2JA 1OKXA 4CH8B 1MQ5A 1VJAU 2O8WA 3A7XA 1WBGB 1QRWA 1HAHH 2BDBA 2H5CA 4SGAE 1SGPE 2PUXB 1TRNA 3GCTG 3VXFH 2BLWA 3EYDA 2XYAA 2WPIS 1CO7E 1FXYA 1FY8E 2BHGA 1WU1A 1ZLRA 4GHTA 4K5ZA 2VB0A 2AERH 3V0XA 1EJNA 1Z71A 3M3VA 4ZHAA 1O2HA 3DT0H 2Z9KA 2V3HH 2PW8H 4INKA 1ELEE 2VIDA 1L1GA 1ELTA 3DUXH 2FOCA 1LHEH 3M7TA 1TPAE 5FPSA 1O35A 4A92A 3U1IB 7KMEH 4CBOA 1MH0A 1Q2WA 2BQ6B 2OUAA 5FXLA 1G9IE 3RDZA 3RXJA 1UK4A 3LKWA 1V2UT 1BITA 1CT0E 4BAHB 3QX5H 2SGEE 3UPEA 1VGCC 3SJ8A 2RA0A 4HFPB 8ESTE 2R0LA 1TX8A 4NIYA 1F0TA 3SQHE 1TFXA 5G4BA 3P8NA 3S7HB 4QT8C 2Y5GA 4O03A 1B5GH 1MKWK 2TBSA 4ABHA 2EI6A 1V6DA 1AFQB 3GYMA 2V35A 4MTBA 1PQ5A 3E8LA 3ZZAA 2P94A 4NSVA 1W10U 1CT4E 4ZUHA 1C5UA 1GCDA 1CT2E 3GCOA 3RC4A 1D3DB 1ABJH 5SGAE 2GDDA 4DT7B 4X8TH 4WVPE 2OBOA 1UVSH 1YKTA 2GCTB 4Q2KA 1C5OH 2ZHEH 2FOHA 2W3IA 1QFKH 1ANEA 3LU9B 1AO5A 2FDAA 2BZ6H 2TGTA 1O2NA 1TNIA 4X8VH 1AQ7A 3F68H 4ABAA 2HLCA 1WYKA 3RU4E 2J9NA 1KXBA 4D7GA 3SV9A 1HUTH 1EOJA 4X2VA 1X7AC 2OP9A 3F9FA 1GPZA 1B0FA 1LVBA 1C4U2 1P2NA 3FFGA 1OYTH 3RMOH 5TCAA 1KLJH 2ZGJA 3KQBA 2FLRH 1IQEA 3M5LA 2A5KA 1SGDE 4UFFH 4MPUA 4LZ1H 1P11E 4CRFA 1LMWB 2ZZUH 5K7RA 1HGTH 1YLDA 3LOXA 1UTKA 4AB8A 1ABIH 3A85A 5F6MA 3GCTF 1SBWA 3QN7A 2D1JA 4AZ2B 1AKSA 2BDHA 3ZVFA 1MZAA 8KME2 1A61H 4FUBA 1E38B 4YOIA 1V2NT 5A0BA 5C1YA 2RDLA 1P02A 1SI5H 3A80A 2XWBI 4MNVA 3KNXA 1GL0E 3BEFB 4MQAA 4AGJA 1HJ9A 1ANCA 5L30H 4NZQA 1HNEE 5J4QA 1A3EH 1SOZA 4MNXA 1OWEA 1S5SA 2ULLA 1PPBH 1FLEE 3P8GA 3K2UA 1ETSH 1MQ6A 1SGIB 1N8OC 5E2OA 3M36A 4GAWA 2B0FA 1DXPA 3GDSA 3MU1A 2BYAX 4DVAU 3UQOA 2C8YB 1MKXK 2FYQA 4B75A 1GL1A 1KXAA 4DJZB 1TMBH 1TRYA 1TX6A 1KXFA 1QHRB 3ZZBA 2ZO3H 3R3GB 3SU0A 1PPCE 3SV2H 1P09A 1P0SH 1ETTH 1O2YA 2HRVA 1BJUA 1UTQA 1GJ6A 3NPSA 4TY7A 3K6ZA 1LDTT 1AVGH 2SGFE 2ZP0H 4GCHG 3MYWA 3VB6A 1F0SA 1ZSLA 2Q6GA 1GBCA 4Y6DA 2A1DB 2A4GA 2QCYA 2ZHFH 3GCHC 2WV4A 1AUJA 1ETRH 2QXIA 3PMHB 1G3CA 2WYJA 3BSQA 4JZIA 1P01A 1GBTA 1MTUA 3RXRA 1ESAA 1KSNA 1WV7H 3NXPA 1SGFG 4FU7A 1F92A 4IC6A 2LNCA 2HNTC 1G30B 3SI3H 3AAVA 1M9UA 1IQIA 3BTHE 1FAKH 1KY9A 4KP0A 1ELAA 4X6OA 3VFEA 3T27A 5T6GA 1O3KA 2GZ8A 1SLXB 1AMHA 3ZZ6A 4YESB 3SUDA 2PFEA </