1W12U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w12U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w12U01
1TRYA 1IHTH 3BTFE 5JBBS 3UOPA 1EOJA 1QIXB 3S9CA 2J95A 4BXWA 2ODPA 2G52A 3NXPA 1HYLA 5DGJA 5EXLA 1Z71A 3SOSA 1J9CH 3R0FA 1O3JA 3AW0A 2XTTB 2I6SA 1UO6A 1SQTA 2CN0H 4MPVA 1JRTA 1NM6A 2OBQA 1OYTH 5T3HA 2ZDLA 1D6WA 5HYOA 1C2HA 1A46H 4ABBA 1KLIH 2A1DB 4AG2A 1Z1JA 1BTHH 2H1UA 1IQIA 1GBKA 1HBTH 1P2IA 1RIWC 1H4WA 1OWEA 2PUQH 2PKSC 2YNAA 3VXFH 1MTNC 1GMDG 2VH0A 1DX5M 1FZZA 2P59A 3BTHE 1HFDA 2IJOB 1KXCA 3OU0A 1GHYH 1P06A 1JIMA 2FP7B 1KYNA 1P2MA 4WH6A 3D65E 8LPRA 2ZPQA 1CT0E 4WMFA 3RXRA 4K69A 1XX9A 1C2EA 4NIXA 4X1NU 2BD9A 3V12A 2VIDA 4MNYA 3UREA 2UUFB 2VJ1A 1O3IA 1O5EH 3BF6H 3LDXH 4ZKSU 2OC7A 3BTWE 3KL6A 6LPRA 1H9IE 4TWWA 4ZROA 6GCHF 4FUJA 3SV7A 3ZV9A 2ODYB 1G3DA 2VH6A 1TPOA 3M3VA 4GLYA 1UMAH 4DY7B 2ULLA 3BTTE 1LPGB 1P2QA 1SL3A 3FZZA 1N8OC 2QN5T 3QLPH 1O5FH 3ZVDA 3SV2H 5I25A 4NFFA 5GWZA 1EX3A 2YOLA 2B0FA 1FPCH 2UWLA 1QJ1B 3SJ8A 2BVRH 1LVBA 5F8XA 1AKSB 2OTVA 2AERH 5EGMA 3TLOA 1C5OH 1AMHA 3SBKA 4F4OC 3MH4A 2OC1A 1A0LA 1AVXA 3RC6A 4YLUA 3RXUA 3UNQA 4DOQA 1ZSKA 1ELDE 2QXGA 2VGCC 3SNEA 2V3OH 3U98H 1C2IA 4Q7XA 1K1JA 3LKWA 1YPKH 3GCTF 4I8GA 1EJMA 1NFUA 2B8OH 1GJCB 1C5WB 2ZFPH 1AGJA 3P6ZB 1E37B 1XXFA 4AFSA 4LZ4B 1NROH 1Y5BT 1VJ9U 4O03A 4DJZB 1GWAA 1EKBB 3UTUH 3MNBA 2A7JA 2RG3A 3M7UA 1ZGVA 4NFEA 1MH0A 2P94A 4X2WA 1C1PA 4I32A 2ODQA 3PO1B 2XBVA 5AFYH 1NFXA 4YZUA 4SGAE 1XM1A 3MU8A 3IG6B 1C5ZB 1HPGA 1T31A 1ZPZA 4GCHG 1FUJA 1SHYA 4TYDA 1BDAA 3TIUA 1K22H 3TJOA 3I29A 4H4FA 1O2SA 3AVZA 1A4WH 1ANCA 1OWHA 3DA9B 2FZZA 2TIOA 2J94A 4FUFA 3TJUA 1O0DH 5DKMA 1JRSA 3TGJE 1ZMLA 5LGOA 4BTTB 4O9VA 4D8NA 4ABAA 1SGTA 4U2WA 2BY5X 3E8LA 3QN7A 1SOZA 1ZJDA 1OOKB 1G32B 1UCYH 2JETC 3UNSA 4FXGH 3RXBA 3A82A 1B0FA 3T26A 1D3DB 1EXFA 1P2JA 1W7XH 2Q6GA 1BMMH 1ZHRA 2A4OA 4A1VA 4XBCA 1ZPCA 4X8UH 4U01A 3VGCB 4R8TB 1FAKH 1DSTA 2GCTB 1BBRE 1ANEA 1G37A 4PROA 2NU2E 3T25A 4FU9A 1NFYA 1EUFA 3PMAB 5A8XA 1NC6A 4AYVB 1TRMA 5ESBA 2ZI2H 3AAVA 1D9IA 1FV9A 1TBQH 3QK1A 2QGRA 4ISHH 1RRKA 1P9UA 2Y6TA 5CMXH 4FVDA 1EPTB 1G3EA 1ZHPA 1SG8B 1A7SA 3LGVA 2TRMA 3RXEA 4I8JA 1LHDH 2ZO3H 2Q6FA 4ISOA 2AGGX 2P3TB 4B74A 4HI3A 3OYPA 4Y8XA 4NIWA 1YPEH 1KXDA 4AGJA 3A8BA 1OX1A 2BD8A 2Z9GA 3U8OH 3A89A 3B8JA 3RXTA 4X6NA 1LVYA 1HJ8A 4UFFH 4CH8B 1GI2A 1O5CB 2G81E 1GCTB 2RA0A 2NU3E 2TPIZ 2ZGBH 2SGEE 2O8WA 3ZZDA 1QBOA 3D23A 5FBIA 5ETXA 1CA8B 5A09A 3KQEA 3M35A 2H9EH 3LJOA 3LPRA 1ABIH 2GD4B 1E38B 1FLEE 4ZAEA 1S0QA 3FANA 1WUNH 2KAIA 1DE7H 2BVSH 1ID5H 1GJAB 1TPPA 5G4BA 1SLWB 1HV7A 4YM9A 1XKBC 1AN1E 1G2LA 2ZGJA 1E0FD 2NU1E 1DT2A 1QQUA 2VWNA 2FODA 1C2DA 1LQEA 1ABJH 1VZQH 2PR3A 4HTCH 3SQEE 1O2OA 1EOLA 1Z8JB 4I31A 3T62A 4DVAU 1Y3VA 3T27A 5HM9A 4Q7ZA 2HNTE 3Q3XA 1Q2WA 2B7DH 4CRGA 2GMTC 4KTUA 1TLDA 1TGTA 1FI8A 2UUKB 3GOVB 4K5ZA 1BRAA 4XDEA 5AVDA 4D76A 1FY8E 1YCPH 2ZQ2A 3BG4C 2BD7A 2FDAA 1J17T 1KXFA 1RIWB 3M5OA 4X6PA 3HGPA 4ZKNU 1Z8IB 3A87A 3SU2A 2PKSB 1GHWH 3JZ2B 1MTNB 1LHEH 1C4V2 1FQ3A 4A6LA 2ZIQH 1BMLA 1C4U2 3I78A 3SW2B 3TK5A 3O8BA 1IQJA 5TJXA 4KTSA 2Q1JA 2Y7ZA 3RXQA 1V6DA 2BQ6B 1KDQA 3M5LA 1MBMA 1PJPA 1P09A 1P57B 5AHGH 1GI0A 1NS3A 2G5VA 2FTMA 1MTSA 3UWIA 7LPRA 4ZHMU 3AASA 3SU3A 3A88A 3ESTA 3SGQE 3TPIZ 3TU7H 4KKDA 1D6RA 2PW8H 2EI6A 1QBVH 1LMWB 1VCQA 1GDNA 1ZHMA 3BIVH 1UVSH 3RC4A 1V2LT 4CRBA 1BJUA 3GY3A 4K1EA 3E90B 2GX4A 5LPFA 4D9QA 3CENA 1SGDE 3RXAA 3GYLB 2P93A 1O30A 1BZXE 1QURH 1KSNA 2J38A 2QF0A 3ATWA 2A7CA 4Q2KA 2O8UA 3K65B 4K2YA 1YPHC 4O3TA 2DE8A 3EA9A 1BT7A 2BLQA 1SGQE 2TGTA 4LK4A 1N8OB 1THRH 1JBUH 4A5TS 4DT7B 1TGNA 4NZQA 4O3UA 3QTVH 4I8KA 4UEHH 2BLOA 3EYDA 2J4IA 1HAPH 3ZYEA 2J92A 1F5RA 2BY9X 4RSPA 1QRZA 2RA3A 3SUDA 2GZ8A 2H6MA 3A7XA 2A5KA 1AWFH 2Z6BD 3SUGA 3PB1E 2BXTH 4OS4A 1HRTH 1CSOE 2BD4A 2C8ZB 2ZHEH 2FXRA 1KXAA 1P2KA 1A5IA 1TPAE 2VGCB 1O2IA 1P8VC 3L3TA 2O9QA 1UVOA 4CBOA 1Z6JH 5GCHG 1O2QA 1GMCG 1WU1A 4JK5A 5H4IB 2BLVA 1IQFA 1TNKA 4LXBH 1DWBH 4NIVA 2B5TB 1LO6A 1C1RA 3URDA 3MTYA 5E2PA 2A5AA 4INLA 4Y7BA 1PFXC 4UD9H 1FAXA 1F2SE 4BAMB 1S5SA 3BIUH 3NCLA 1UHBA 1C5MD 4JYUH 1O39A 3S0NA 1N6YA 3KN2A 2ASUB 5FCRA 1C1UH 5A8ZA 2BDHA 1T7CA 1LQDB 2UUJB 2XC4A 3ATIA 1O3CA 2FS9A 2SGDE 3SU4A 1V3XA 2V0BA 3BTQE 2XCFA 1T4VH 1MZDA 1V2JT 1WTHD 1IQEA 1TGSZ 1P03A 1KTSB 2BOKA 1C9PA 4NA9H 5DP8A 1T4UH 3RU4E 4ISLA 1HUTH 1T8LA 2FLRH 5EXMA 2EA3A 4JK6A 3ZZAA 1PQ7A 4ABHA 5FPSA 4XOJA 3HK6B 1OS8A 3ZVEA 2JETB 3F9FA 2QXHA 3MNCA 4MG3A 2F3CE 3RXGA 3QZQA 2PTNA 1GJ4H 3O8DA 4X8VH 2FLBH 2HALA 3JZ1B 3QDZB 2ZNKH 3D62A 2OINA 4Y11E 3MO3A 5HGGA 4AX9H 2ZHDA 1O37A 4YOIA 2OXSA 1EZSC 1G9IE 1GJ5H 1YPJH 2R0KA 4JMYA 5EPNA 3O8RA 3RXVA 1SQAA 2D8WA 1QB1A 2A5IA 2NU0E 4AG1A 2JH0D 2OUAA 1K2I1 4X1PU 2HGTH 3SHAH 3ITIA 1VITG 1CGIE 1Z6EA 3H7TA 5CE1A 3VB4A 1TAWA 1UTKA 1BBRK 1INCA 1HAOH 2PSXA 4NA7A 1SB1H 2Z3DA 3SJOA 1S83A 1TYNA 1C5SA 3GY6A 5LPRA 3QO6A 1BRBE 1OWDA 1SVPA 3LGUA 1XKAC 2A2QH 3KGPA 1YYY1 2P8OC 2AIQA 2FOFA 1YPHE 4MPWA 3E0NB 1THPB 3ZV8A 3TJVA 3KCGH 5JPMH 2FYQA 1BIOA 2HPPH 1O2WA 3G01A 1UTPA 1DY9A 2UUYA 3U1JB 3SJKA 1C1NA 1TMUH 1O2JA 4WJG2 2FPZA 3M36A 4NSYA 5A0AE 4Y0ZE 2ZC9H 1EB1H 1O2KA 4ABDA 2NWNA 5DG6A 2AYWA 1BTUA 5IYTA 1SLUB 1P2OA 4NIYA 2PUXB 1AKSA 4BXSA 4JYVH 4THNH 1Z8GA 1V2MT 3HKJB 3L6PA 1O2LA 2BX3A 2BDGA 1F0TA 2XNIA 4ABFA 1Y3WA 1UK4A 1QA7A 3MYWA 4GCHF 2ANKH 1BRUP 1BTYA 3PYHA 1ORFA 1F5LA 4MTBA 1AIXH 1HAGE 2GGVB 1W8BH 1SGRE 3K6YA 2GMTB 2Y5FA 5BPEA 1S6FA 5FHTA 2C90B 3MO6A 1Y5AT 3BG4B 1NTPA 3M3TA 3RMNH 1AD8H 1MBQA 1NRNH 2G51A 1SFIA 4FUIA 2VINA 1SGNE 3H5CB 2VWMA 2YNBA 2ZU5A 4IBLH 1G3CA 5C1XA 3P8FA 3F9GA 1NT1A 3RM0H 4ZHAA 2H9TH 4IN1A 3A7VA 3PTBA 1S6HA 4Y7AA 2XYAA 2BTCE 3T2NA 2F91A 4DW2U 1O3EA 1XUJA 3CS7A 2BY8X 3K9XB 2WPKS 3ZZ5A 2EI7A 1W0YH 2H2ZA 3RXCA 1BOQA 3UR9A 1AHTH 2ZWLH 1CO7E 1NN6A 2WYGA 5DP7A 1SGFG 4GVUA 2PFEA 1PQ8A 1DLEA 4U30A 4ABIA 1KXBA 2ZDAH 4DURA 3T28A 4K1SA 1TMBH 2W26A 1S0RA 4YOGA 1BHXF 2OC0A 1M9UA 5FX5A 2FI4E 4M7GA 1SPJA 2SNVA 1BQYA 2ZDMA 3RC5A 2QA9E 4VGCC 1EJAA 1GI8B 3BTDE 3S69A 4E05H 3GCHC 1S85A 3M37A 3ZZBA 3EE0B 3RDZA 1K1PA 1YPGH 1NPMA 3LGTA 2ZA5A 1RTKA 1ELBA 4ZKOU 1O35A 2BDCA 1HJAC 1S81A 2F9VA 4BTUB 9ESTA 3ZZ8A 4FUHA 4BOHA 1QB9A 3SU0A 3U8RH 1JIRA 1SQOA 4WXVA 1EPTA 1MCVA 3UIRA 3SU1A 4AFZA 1GVKB 1BITA 4X6MA 1K1MA 4A92A 5F03A 3E0PB 1C2GA 1L2EA 3SN8A 2ZQ1A 3PLBA 4B75A 4MLFB 4A7IB 1Y8TA 1QTFA 2CMYA 2H5DA 3SJ9A 3EGKH 1QA0A 1G3BA 1V2RT 2FOGA 1QL7A 1B5GH 3RU4D 1UTOA 1DFPA 4MNVA 3ZZ7A 2BY6X 3NWUA 1J16A 5E0HA 4O97A 2QYIA 2J9NA 3H7OA 4FU7A 4OS5A 4ABEA 3A8CA 3MU0A 1FN6A 1MCTA 3RMMH 1HAXB 1WQSA 1VR1H 2W3IA 2BLWA 3ZZ9A 2P16A 3TJNA 1OPHB 1PPFE 3RUOA 3NUMA 3LC5A 1SGIB 2BHGA 5I46H 3PLKA 1UVPA 2GCHG 2ZEBA 1LKAA 1PYTC 3CP7A 1ZTKA 5JBTA 1O3BA 5T6DA 4Y8ZA 4YO9A 3GY2A 1FONA 2QC2A 4FU8A 3SU6A 2BD2A 2PGBB 1TIOA 2P3UB 4TY6A 3EQ0H 2FOEA 1VJAU 1O3NA 3ZVBA 3C27B 1DXWA 2FTLE 4X2XA 1IQNA 1YLDA 4J1YA 1ELCA 1O3OA 2JKHA 2BOHB 2FI5E 2WV5A 3A86A 3SNCA 1O2PA 1TQ0B 2HLCA 4OS7A 1N1LA 1TQ7B 1C2LA 1RGQA 1W13U 4ISNA 4BAOB 1ELGA 4FUBA 4TWYA 2BQ7B 2F9OA 3RXMA 1PQAA 3W94A 3VPKA 2F9NA 1TNLA 1O34A 1AWHB 4FUCA 1ZYOA 1O3AA 1LPKB 2P3FH 2ZU3A 3TGKE 1WAYB 3B9FH 3U9AH 1OYQA 4E7RG 5EW1H 2BQWB 3KQCA 4XBDA 1WSSH 4JZEH 1GI3A 2PHBA 4BTIB 4IW4E 2Z94A 2LNCA 2ZDKA 1L4DA 2P8OB 2ZFSA 1GJBB 3F68H 4NGAH 4NG9H 1GJDB 4AB9A 3ZVFA 3C1KA 4B73A 1JOUB 5GCHF 1D3TB 2XW9A 5A0BA 1EP6A 4IS5A 3P95A 3OTJE 2EI8A 2Z9IA 4A1XA 3UNRA 1SGFA 5EG4A 2AIPA 1WV7H 2Z9LA 3GCOA 5DK1A 2Y80A 1EB2A 2ZCKP 2A45B 3DUXH 4B71A 5GXPA 1V2VT 1GJ6A 2ZGCA 3TNSA 2ZHWH 1TOCB 3SHCH 1A5HA 2GDDA 1QNJA 3V7TA 2G4TA 1AY6H 1BJVA 2VVUA 2ZZUH 1TBRH 1LVOA 2ZFRH 4LZ1H 1PPCE 2A32A 3LT3A 2H9HA 4LOYH 4IGDA 4UFDH 3M61U 3MU1A 4NWLA 2ZCHP 1LDTT 1MKXH 1VGCC 3RXPA 2FYRA 1A0JA 1K1NA 1GHZA 1V2OT 2GT7A 1CHOF 4X8SH 1KLTA 1IQLA 4INKA 1DS2E 2SGAA 1SGYE 3ATKA 1ZPBA 1Y3XA 1AQ7A 5PTPA 2A31A 1HAHH 1NFWA 3VXEH 1H8IH 1IQMA 1GHBG 1PPGE 4SGBE 1SR5C 2O8LA 2XRCA 3Q3KA 5F8ZA 1ARCA 1GL0E 5EQQA 1P3EA 1YGCH 2D26C 1AE8H 3FP8E 2CHAC 2J2UA 1HB0B 1HIAB 1FIWA 1V2KT 1Y5UT 3E3TA 1V2UT 1BTXA 1LCYA 1CHGA 1FJSA 2BDIA 2WUCA 5FPYA 4IMQA 8GCHF 1UTQA 1D3PB 2OC8A 2ZG0H 2FS8A 1ELFA 1ZR0A 3TK6A 3RXSA 1YBWA 2UWOA 1ZLRA 1ZSJA 1VITF 1LTOA 4YESB 3S9BA 1HGTH 2FOHA 1O3GA 3V0XA 3VB7A 4MQAA 1A0HB 2IN2A 1O2XA 1C5QA 5E0JA 1TRNA 3AW1A 3LOXA 2GV7A 2PLXA 2OQ5A 1GBTA 3HK3B 4JZDH 1ZMNA 1UVTH 2XC0A 1C2KA 2FM2A 2VVCA 1GJ7B 1K28D 3QZRA 3E91A 4I8HA 4DG4A 5IDKA 3SQHE 2BXUH 2A4GA 2W7UA 3RXLA 4X8TH 4HFPB 4MPUA 4VGCB 2XCNA 3GY8A 2HRVA 2Z3EA 1A3BH 2O8MA 3GCHB 1UTLM 1V2PT 1IQKA 1OP0A 1ESAA 3SI3H 2FOBA 1DSUA 1HJAB 1TNIA 1P02A 1GDQA 1F0UA 5DP9A 2VIOA 1ZSLA 5EODA 3LJJA 4FVBA 1C1OA 2BY7X 3L33A 3PTNA 4TPYA 3S7KB 3A7YA 2XWBI 3ODFA 3VEQB 4WXIA 3S9AA 4HZHA 2Y5HA 5L2YH 1BMNH 2QV1A 3FP7E 2ZTZA 1YF4A 1O3FA 1P05A 3ENSB 3DFJA 1RS0A 3TH2H 1ELAA 1T8OA 2Z7FE 1NRSH 2GT8A 1O2VA 4ZMAH 3BN9A 3IITA 4E7NA 3DT0H 1O2YA 1PPBH 1W14U 2B9LA 2KAIB 1TX7A 2QAAA 3SU5A 4Y10E 1HAZB 1C5NH 1Q3XA 1WCZA 1C1SA 2FO9A 1C5RA 1O36A 1ESBA 3A8DA 1MD7A 3STIA 1D3QB 1TGBA 1Y3UA 1C2JA 1MUEB 4NZLA 3SV8A 5C5NA 4B76A 1N6XA 4ZUHA 1ETSH 3UOUA 5AFZH 1SLXB 3F9HA 1QY6A 2TBSA 4WVPE 5JBCS 3PWBA 1GMDF 1ETTH 2V6NA 1GL1A 1SFQB 5EU8A 1J14A 4Y0YE 2ALPA 1H9HE 1ZOMA 2XC5A 1QGFA 1P12E 3QUMP 4AFUA 2HOBA 7GCHG 3ZVAA 3P70B 3KQBA 1BCUH 1DOJA 3PMJA 1GGDC 2WINI 4ZH8A 1MAXA 3OY5U 1JXPA 4E06H 1AO5A 1JMOH 1SGCA 3GY5A 3TVJB 2ZGXH 1FN8A 3SV6A 2ZP0H 2ANYA 3A83A 1C5UA 3FFGA 3VB5A 4ABJA 3QTOH 1FDPA 5BRRE 5C20A 1X7AC 3STJA 4BAKB 7KMEH 4IN2A 2BVXH 2VWLA 1JWTA 2ZU2A 3SNAA 1H1BA 2THFB 5L2ZH 3GDUA 4Y71A 2OQUA 3ZZCA 3ODDA 2WPJS 4TPIZ 3A81A 1MAYA 1AFQC 1NRQH 1DWDH 1EZQA 7ESTE 2PV9B 1LPZB 1AZ8A 1XVMA 2I6QA 1EAWA 3BG8A 1C5PA 2IOTA 3RXFA 3RLWH 5J4SA 1WBGB 2W5EA 3HPTB 5T6GA 5LPEA 2WPMS 3UUZA 1SLVB 2Y7XA 3QWCH 1YPMH 1TNHA 5TCCA 4I8LA 1CA0C 4OGXA 4FUDA 4I7YH 2K1QA 1K1LA 4MNXA 2ZFQH 2DE9A 1O2TA 1WQVH 3A8AA 3LH3A 1D4PB 2H5CA 1V2NT 3GICB 1YM0A 2R0LA 2Z9JA 1C1VH 1CBWC 2VNTA 2HNTF 3ZVGA 2Q6DA 5ABWA 1C2FA 1ZTJA 1WOFA 1XMNB 2TGDA 1KTTB 1O2HA 3SUFA 3QGJA 1O31A 1MKWK 2OCVB 1AZZA 3TGIE 1V2TT 2GKVE 1TABE 1CGHA 1QRXA 3MNSA 3A7WA 1GHAG 5DO4H 4OS2A 1B7XB 2GVFA 1EAXA 1DANH 2C93B 3A84A 4JZIA 3BEUA 2SGQE 1YPLH 3QX5H 1VGCB 2GCHF 1GMHG 1P2NA 1AU8A 1W2KH 2AMPA 3KEEA 1BHXB 2IPHA 3Q76A 4UFEH 5K0HA 1DWEH 1NESE 3RXHA 2BD3A 4KTCA 1UTNA 2ANWA 1TB6H 1CU1A 1BTZA 1SBWA 1GI7B 2G00A 2GV6A 2QIQA 4WH8A 2Y82A 2FX4A 6ESTA 2NU4E 2C8XB 3ZYDA 1A61H 1EQ9A 5E0GA 4FUGA 3MHWU 1Z8RA 4JZ1A 2CHAB 1SC8U 4ZXYH 2QF3A 3UFAA 1TNJA 4CR5A 3MO9A 3GDVA 1A2CH 3R3GB 4B2BA 4CRFA 2LPRA 3MI4A 1QR3E 4K1TA 2WYJA 5K7RA 3P8OA 4AZ2B 1UK2A 2ZTXA 1P10A 1NU9A 2TGPZ 5LH8A 1O3PB 3RM2H 1GVLA 1O33A 2QY0B 1XVOA 1C5VA 1PPHE 3MH7A 1O3MA 3UPEA 1YCPK 1CT4E 2WV4A 1FY1A 3GY4A 5GDSH 3UWJH 1T32A 5CHAC 3T29A 1E36B 1IOEA 4X2VA 1SGPE 4ZHLU 3MMGA 5A2MH 2PKAB 1EZUC 5T6FA 2GP9B 1HAVB 1LVMA 5SGAE 2F83A 2G5NA 1TOMH 3SJIA 1KXEA 2GZ9A 1Y59T 3QGNB 1F7ZA 1Y3YA 1GBCA 5DP4A 2VIWA 1P0SH 3ZZ4A 1FY3A 1IQGA 1GBEA 2BB4A 4Y8YA 2EC9H 4WMDA 3TK9A 4B2AA 1F5KU 5C67A 3MH5A 4K3JA 1QB6A 4CR9A 3F6UH 3NZIA 2AMDA 2DUCA 2FIRH 2FWWA 4JZFH 1GDUA 4AYYB 3PROA 1HNEE 4U32A 2BD5A 4YOJA 4BAQB 3MOCA 2HVXA 2ZECA 2F9BH 3MH6A 2STBE 1O2MA 2ZHQH 1A3EH 2V3HH 1GBMA 2GTBA 5FXLA 2WPIS 4B2CA 4CRCA 2ZPRA 1XUKA 1TA6A 2ZGHA 1MD8A 2AEIH 2WPHS 2ZU4A 5L6NH 1ANBA 2A4RA 1GJ9B 2AMQA 3SUEA 4NA8A 1HAIH 1MMJN 1RXPA 5F6MA 1VITH 3Q3YA 4RKJB 1P04A 1TWXB 3HGNA 1FY4A 2ESTE 1TMTH 1G36A 1NRRH 1WTGH 4X1RU 2XBYA 3GYMA 2BYAX 1UVUH 1KIGH 4D9RA 4XBBA 1AUJA 4D7FA 1GHBF 5HMAA 4NSVA 4GHQA 5L30H 3MNXA 3PMHB 2XBWA 3GY7A 1ZRBA 4JCNA 1W3CA 1ZJKA 3SGBE 1TX6A 3PWCA 1YKTA 2P95A 5C2ZA 1V2QT 3LGIA 3SNBA 5AF9H 3CS0A 2XXLA 1TFXA 1GBHA 1EAUA 5DP5A 3M7QA 3RP2A 1DPOA 3V3MA 2JH5D 1GHXH 1ZGIA 1QBNA 4IC6A 2O8TA 2HNTC 4K8BA 1K21H 1L4ZA 5GIBA 1NO9H 4XFQA 1GGDB 5C5OA 2CJIA 1C5XB 3KHVA 4GPGA 3FP6E 2PGQB 5JBAS 4YT6H 1O2RA 2ANMH 1AFEH 4DCDA 1GVZA 1GHVH 2CV3A 1ARBA 2CF9H 4X2YA 2XWAA 2C3SA 3VB6A 1J15A 3SZNA 5B6OA 1GBIA 3ZVCA 1NY22 2BDAA 4UONA 1HIAA 3U1IB 4WMEA 1UCYE 4OGYA 3KF2A 4NWKA 4X0WU 1EAIA 5JYIA 3URCA 2WPLS 3FZDA 1AFQB 3SORA 1MQ6A 3EDXB 2ZFFH 3RXJA 1GCDA 1TPSA 4CRDA 3OY6U 2ZDVH 5EOKA 1UJ1A 1QL9A 1GJ8B 4DGJA 1MQ5A 1OWJA 3TNTA 2R3UA 2R9PA 4TY7A 5C1YA 4YT7H 2FI3E 3K2UA 3D49H 2OLGA 1O2GH 2M5TA 5DP3A 1IAUA 3AAUA 1CA0B 1GBLA 4K8YA 1BBRH 1FPHH 1BTWA 1HXEH 1T8NA 1TNGA 1CT2E 1GMCF 1BUIA 3TH4H 3P8NA 1O32A 1C1QA 1CBWB 4BNRA 4CRAA 1XUHA 2AGIX 1QL8A 2OD3B 3GDSA 2J34A 4FUEA 1SOTA 4HGCA 2VIVA 3M7TA 4ESTE 1RD3B 4CHAC 2SNWA 2ZDNA 5EW2H 1LHFH 3E1XB 2JH6D 1K1OA 4QT8C 1GBJA 1LHGH 1YCPM 1HAYB 2STAE 1J8AA 1TGCA 1ESTA 6GCHG 3PM3A 1MKWH 2BDYA 1ZZZA 2W7SA 3UQVA 3B23B 2Y5GA 1MTWA 1AB9C 1P01A 2A0QB 3Q00A 2FOAA 4YLQH 4X1QU 2SGPE 1AVWA 1RFNA 1VCWA 3N7OA 3PMBB 3VFEA 3NK8A 1QJ6B 2R3YA 1Q31A 5JB9S 3MWIU 4DIIH 1DWCH 1W0ZU 3A80A 3IWMA 7GCHF 4RKOB 5A8YA 1XXDA 3PV4A 3RXDA 4K60A 1SGEE 2Z3CA 1DXPA 1K1IA 1RTLA 2ZKSA 3MU4A 4X6OA 3E6PH 2VWOA 2BZAA 4RN6A 4WWYA 1ELTA 3ZZ3A 1TBZH 3NKKA 4KELA 5FCKA 5HXFA 4IMZA 1F92A 4ASHA 1F0SA 5FPTA 2ZF0H 1BMAA 4B1TA 1GG6C 4XE4A 4OS6A 5TCAA 2F9PA 5C3NA 4H6SB 6CHAC 1ZMJA 3A7ZA 4ISIH 1UTMA 1ANDA 1C4Y2 1S84A 1WYKA 1YC0A 4KGAA 5JDUB 2ZHFH 3RXOA 1L0ZA 3K6ZA 5CHAB 3GCTG 1GBBA 1O3KA 2GDEH 3LONA 4Z6AH 4AFQA 1BA8B 3SO3A 3P17H 4A1TA 2OP9A 4IC5A 1ELVA 2OBOA 2FX6A 1SHHB 4UE7H 1YP9A 3BEFB 5FAHA 3LH1A 8ESTE 1HDTH 1TE0A 1W7GH 1O5BB 1O38A 2G4UA 1OP8A 2BMGB 3S7HB 1FXYA 2CXVA 2HPQH 1ACBE 5EPYA 1MTVA 1QCPA 1QQ4A 3RMOH 8KME2 1DUAA 2TGAA 2AH4X 1GPZA 2UWPA 1HLTH 3M3SA 3F9EA 1OWKA 2D2DA 1P3CA 1RJXB 1SMFE 1UK3A 2BDBA 1EP5A 1L1JA 3O8CA 1O3HA 1T8MA 2A4QA 1AE5A 3SI4H 3P8GA 3FAOA 4UFGH 5EXNA 1E34B 3I77A 3HKIB 4AN7A 2ZFTA 1S82A 1GI5A 3V13A 1MTUA 9LPRA 2Y81A 3A7TA 4CH2B 4GHTA 4I33A 1GHAF 1FY5A 3GISB 1IHSH 4KP0A 1DITH 1XUIA 1GMHF 1C1TA 1UTJA 3RMLH 3TH3H 1QJ7B 2C8YB 2BZ6H 1PPEE 3LC3A 3FVFB 3E16B 1P9SA 1CGJE 1L1NA 5FBEA 4DIHH 3RXIA 1THSH 3DFLA 1GI4A 1CE5A 3OSYA 1GI6A 2QXIA 1ELEE 1EASA 3M5NA 3LGWA 4MNWA 2R2MB 3UQOA 2VB0A 1K9OE 4CREA 3A85A 1QRWA 3KQDA 3OX7U 3MU5A 3SV9A 1DDJA 4Q7YA 3EAJA 2FOCA 4WY3A 1DUEA 2AS9A 2Z9KA 1OWIA 5E2OA 1HXFH 4CBNA 3DHKH 5A0CA 4OS1A 3KNXA 2VVVA 3BTME 2RCEA 2VU8E 1L1GA 1NRPH 1ZTLA 3U8TH 1OSSA 1DY8A 1O2NA 4GUXA 1V2ST 1AUTC 5DPAA 4NCYA 2C8WB 1VCPA 1OKXA 3WY8A 1BRCE 1ETRH 3T5FH 3UY9A 1FIZA 5J4QA 2XBXA 5EQRA 2SFAA 1C2MA 1MZAA 4MDSA 3PLPA 4AB8A 1O3DA 2RDLA 4AORA 3Q77A 1EJNA 1FNIA 1NU7B 3U69H 1C1WH 1GI9B 5FX6A 1GBDA 1EZXC 1MU8B 1HCGA 4MVNA 3BEIB 2SGFE 4H42U 5DJ7A 1XUFA 4BAHB 5ESTE 2PWXA 1P11E 4Y79A 1DICA 1TONA 1EATA 1HJ9A 3PO1C 1NZQH 3HATH 1C5LH 2G8TA 1OP2A 1O3LA 2GZ7A 2C4FH 1KDQB 1CHOG 1V2WT 3ATMA 5C1UA 1QHRB 3ATLA 1LKBA 1GI1A 4JYTA 3LGYA 3EA8A 2FEQH 3NPSA 4GAWA 3W95A 1UCYK 3RLYH 1O2ZA 2FESH 3VB3A 1RTFB 1DLKB 2D1JA 1W11U 2ZTYA 2PKAA 4Y76A 3ZZ6A 4R0IA 1HAVA 3BTGE 4ZXXH 1IQHA 2ZPSA 5F8TA 1H8DH 2AGEX 5EQSA 3UR6A 4ZKRU 3BTKE 3MFJA 1C5TA 3SNDA 8GCHG 2PTCE 1MU6B 1XUGA 2ZCLP 3LU9B 1TA2A 1O5DH 1O2UA 1G30B 2BM2A 1DM4B 2A7HA 2CF8H 5HM2A 2A2XH 3VGCC 5GPIB 2V35A 1AVGH 1O5GH 4CHAB 2W3KA 2G55A 1G2MA 2GCTC 1PQ5A 1CQQA 1H9LB 2WUBA 1A5GH 3GCNA 3TITA 1KY9A 4INHA 5DP6A 3P92A 4D7GA 4GSOA 4AOQA 1C5YB 1B0EA 4XSKU 1C9TA 1LHCH 1YLCA 4MPXA 4WF8A 3SGAE 2HWLB 4ABGA 4X1SU 2ALVA 1A1RA 1CVWH 1EPTC 1W10U 3BTEE 1AB9B 1PPZA 1DVAH 2ZU1A 4J2YB 1W12U 5GJ4B 2FOMB 2R2WU 2CGAA 1Z1IA 3LIWA 4YTAA 3RXKA 1TALA 2PSYA 4UDWH 5E8EH 1SI5H 3DD2H 2EEKA 3KIDU 2BX4A 1GBFA 2VIPA 1PYTD 2VIQA 1GBAA 3M5MA 2QXJA 1UHBB 3RU4T 1O5AB 1Z7KA 1C1MA 3BV9B 1BB0B 4Y6DA 1F0RA 1U6QA 1GCTC 4Q80A 2QCYA 1KLJH 1QFKH 3BSQA 3EA7A 1MKXK 3ELAH 3F1SB 1TX8A 4H6TA 1AI8H 1OXGA 1E35B 1SSXA 2FMJA 4Z0KA 4BANB 2F9UA 1BTPA 5JB8S 4F49A 1GG6B 2ILNA 1ZRKA 6CHAB 2AFQB 4AGKA 1FMGA
chains in the Genus database with same CATH superfamily
1TRYA 1IHTH 3BTFE 5JBBS 3UOPA 1EOJA 1QIXB 3S9CA 2J95A 4BXWA 2ODPA 2G52A 3ZIAD 3NXPA 1HYLA 5DGJA 5EXLA 1Z71A 3SOSA 1J9CH 3R0FA 1O3JA 3AW0A 2XTTB 2I6SA 1UO6A 1SQTA 2CN0H 4MPVA 1JRTA 1NM6A 2OBQA 1OYTH 5T3HA 2ZDLA 1D6WA 5HYOA 1C2HA 1A46H 4ABBA 1KLIH 2A1DB 4AG2A 1Z1JA 1NBME 1BTHH 2H1UA 1IQIA 1GBKA 1HBTH 1P2IA 1RIWC 3PRDA 1H4WA 1OWEA 2PUQH 2PKSC 2YNAA 3VXFH 1MTNC 1GMDG 1W0JD 2VH0A 1DX5M 1FZZA 2P59A 3BTHE 1HFDA 2IJOB 1KXCA 3OU0A 1GHYH 1P06A 1JIMA 2FP7B 1KYNA 1P2MA 4WH6A 3D65E 8LPRA 2ZPQA 1CT0E 4WMFA 3RXRA 4K69A 1XX9A 1C2EA 4NIXA 4X1NU 2BD9A 3V12A 2VIDA 4MNYA 3F3BA 3UREA 2UUFB 2VJ1A 4OM9A 3W1EA 1O3IA 1O5EH 3BF6H 3LDXH 4ZKSU 2OC7A 3BTWE 3KL6A 6LPRA 1H9IE 3UAIC 4TWWA 4ZROA 6GCHF 2V3MA 4FUJA 3SV7A 3ZV9A 2ODYB 1G3DA 2VH6A 1TPOA 3M3VA 4GLYA 3OFND 1UMAH 4DY7B 2ULLA 3BTTE 1LPGB 1P2QA 1K0HA 1SL3A 3FZZA 1N8OC 2QN5T 3QLPH 1O5FH 3ZVDA 3SV2H 3F2GA 5I25A 4NFFA 5GWZA 1EX3A 2YOLA 2B0FA 1FPCH 2UWLA 1QJ1B 3SJ8A 2BVRH 1LVBA 5F8XA 2WHXA 1AKSB 2OTVA 2AERH 5EGMA 3TLOA 2WV9A 1C5OH 1AMHA 3SBKA 4F4OC 3MH4A 2OC1A 1A0LA 1AVXA 3RC6A 4YLUA 3RXUA 3UNQA 4DOQA 2IPQX 1ZSKA 1ELDE 2QXGA 2VGCC 3SNEA 2V3OH 3U98H 1C2IA 3AK5A 4Q7XA 1K1JA 3LKWA 1YPKH 3GCTF 4I8GA 1EJMA 1NFUA 2B8OH 1GJCB 1C5WB 2ZFPH 1AGJA 3P6ZB 1E37B 1XXFA 4AFSA 4LZ4B 1NROH 1Y5BT 1VJ9U 4O03A 4DJZB 1GWAA 1EKBB 3UTUH 3MNBA 2A7JA 2RG3A 3M7UA 1ZGVA 4NFEA 1MH0A 2P94A 4X2WA 1C1PA 4I32A 2ODQA 3PO1B 2XBVA 5AFYH 1NFXA 4YZUA 3MQKC 4SGAE 1XM1A 3MU8A 3IG6B 1C5ZB 1HPGA 1T31A 1ZPZA 4GCHG 1FUJA 1SHYA 4TYDA 1BDAA 3TIUA 1K22H 3TJOA 3I29A 4H4FA 1O2SA 3AVZA 1A4WH 1ANCA 1OWHA 3DA9B 2FZZA 2TIOA 2J94A 4FUFA 3TJUA 1O0DH 5DKMA 1JRSA 3TGJE 1ZMLA 5LGOA 4BTTB 4O9VA 4D8NA 4ABAA 1SGTA 4U2WA 2BY5X 3E8LA 3QN7A 4XD7D 1SOZA 1ZJDA 1OOKB 1G32B 1UCYH 2JETC 3UNSA 4FXGH 5FL7D 3RXBA 3A82A 1B0FA 3T26A 1D3DB 1EXFA 1P2JA 1W7XH 2Q6GA 1BMMH 1ZHRA 2A4OA 4A1VA 4XBCA 1ZPCA 4X8UH 4U01A 3VGCB 4R8TB 3DSOA 1FAKH 1DSTA 2GCTB 1BBRE 1ANEA 1G37A 4PROA 2HVYB 2KM0A 2NU2E 3T25A 4FU9A 1NFYA 1QZ8A 1EUFA 3PMAB 5A8XA 1NC6A 4AYVB 1TRMA 5ESBA 2ZI2H 3AAVA 1D9IA 1FV9A 2W6ID 1TBQH 2J98A 3QK1A 2QGRA 4ISHH 1RRKA 1P9UA 2Y6TA 2IJD1 4FVDA 5CMXH 1EPTB 1G3EA 1ZHPA 1SG8B 1A7SA 3LGVA 2TRMA 3RXEA 4I8JA 1SQRA 1LHDH 2ZO3H 2Q6FA 4ISOA 2AGGX 2P3TB 4B74A 4HI3A 3OYPA 4Y8XA 4NIWA 1YPEH 1KXDA 4AGJA 3A8BA 1OX1A 2BD8A 2Z9GA 5HIYA 3U8OH 3A89A 3B8JA 3RXTA 4X6NA 1LVYA 1HJ8A 4UFFH 4CH8B 1GI2A 1O5CB 2G81E 1GCTB 2RA0A 2NU3E 2TPIZ 2ZGBH 2SGEE 2O8WA 3ZZDA 1QBOA 3D23A 5FBIA 1OHHD 1CA8B 2RDEA 5ETXA 5A09A 5B6LA 3KQEA 3M35A 2H9EH 3LJOA 3LPRA 1ABIH 2GD4B 1E38B 1FLEE 4ZAEA 1S0QA 3FANA 1WUNH 2YMSC 2KAIA 1DE7H 2BVSH 1ID5H 1GJAB 1TPPA 5G4BA 1SLWB 1HV7A 4YM9A 1XKBC 1NBMD 1AN1E 1G2LA 2ZGJA 1E0FD 2NU1E 1DT2A 1QQUA 2VWNA 2FODA 1C2DA 5HKKD 1LQEA 1ABJH 1VZQH 2PR3A 4HTCH 3SQEE 1O2OA 5C0TA 1EOLA 1KMHB 1Z8JB 2L74A 5KECA 4I31A 3T62A 4DVAU 1Y3VA 3T27A 5HM9A 4Q7ZA 2HNTE 4DT4A 3Q3XA 1Q2WA 2B7DH 4CRGA 2GMTC 4KTUA 1TLDA 1TGTA 1FI8A 2UUKB 3GOVB 4K5ZA 1BRAA 4XDEA 5AVDA 4D76A 1FY8E 1YCPH 2ZQ2A 3BG4C 2BD7A 2FDAA 1J17T 1KXFA 1RIWB 3M5OA 4X6PA 3HGPA 4ZKNU 1Z8IB 3A87A 3SU2A 2PKSB 1GHWH 3JZ2B 1MTNB 1LHEH 1C4V2 1FQ3A 4A6LA 4TT3D 2ZIQH 1BMLA 1C4U2 3I78A 3SW2B 3TK5A 3O8BA 1IQJA 5TJXA 4KTSA 2Q1JA 2Y7ZA 3RXQA 1V6DA 2BQ6B 1KDQA 3M5LA 1MBMA 1PJPA 1P09A 1P57B 5AHGH 1GI0A 1NS3A 2G5VA 2FTMA 3F2HA 1MTSA 3UWIA 7LPRA 4ZHMU 3AASA 3SU3A 3A88A 3ESTA 3SGQE 3TPIZ 3TU7H 4KKDA 1D6RA 2PW8H 2EI6A 1QBVH 1LMWB 2VBCA 1VCQA 4ASUD 1GDNA 1ZHMA 3BIVH 1UVSH 3RC4A 1V2LT 4CRBA 1BJUA 3GY3A 4K1EA 3E90B 2GX4A 5LPFA 4D9QA 3CENA 1SGDE 3RXAA 3GYLB 2P93A 1O30A 1BZXE 2V7QD 1QURH 1KSNA 2J38A 2QF0A 3ATWA 2EY4C 2A7CA 4Q2KA 2O8UA 3K65B 4K2YA 1YPHC 4O3TA 2DE8A 3EA9A 1BT7A 2BLQA 1SGQE 2TGTA 4LK4A 1N8OB 1THRH 1JBUH 1W0KD 4A5TS 4DT7B 1TGNA 4NZQA 4O3UA 3QTVH 4I8KA 4UEHH 2BLOA 3EYDA 2J4IA 2AHME 1HAPH 3ZYEA 2J92A 1F5RA 2BY9X 4RSPA 1QRZA 2RA3A 3SUDA 2GZ8A 2H6MA 3A7XA 2A5KA 1AWFH 2Z6BD 3SUGA 3PB1E 2BXTH 4OS4A 1HRTH 1CSOE 2BD4A 2C8ZB 2ZHEH 2FXRA 1KXAA 1P2KA 1A5IA 1TPAE 2VGCB 1O2IA 1P8VC 3L3TA 4F48B 2O9QA 1UVOA 3PRBA 4CBOA 1Z6JH 5GCHG 1O2QA 1GMCG 1WU1A 4JK5A 5H4IB 2BLVA 1IQFA 1TNKA 4Q63A 4LXBH 1DWBH 4NIVA 2B5TB 1LO6A 1C1RA 3URDA 3MTYA 5E2PA 2A5AA 4INLA 4Y7BA 1PFXC 4UD9H 1FAXA 1F2SE 4BAMB 1S5SA 3BIUH 3NCLA 2KCYA 1UHBA 1C5MD 4JYUH 1O39A 3S0NA 1N6YA 3KN2A 2ASUB 5FCRA 1C1UH 5A8ZA 2BDHA 4RT0A 1T7CA 1LQDB 2KCOA 2UUJB 2XC4A 3ATIA 1O3CA 1EFRD 2FS9A 2SGDE 3SU4A 1V3XA 2V0BA 3BTQE 2XCFA 1T4VH 1MZDA 1V2JT 1WTHD 1IQEA 1TGSZ 1P03A 1KTSB 2BOKA 1C9PA 4NA9H 5DP8A 1T4UH 3RU4E 2GJGA 4ISLA 1HUTH 1T8LA 2FLRH 5EXMA 2EA3A 4JK6A 3ZZAA 1PQ7A 4ABHA 5FPSA 4XOJA 3HK6B 1OS8A 3ZVEA 2JETB 3F9FA 2QXHA 3MNCA 4MG3A 2F3CE 3RXGA 3QZQA 2PTNA 1GJ4H 3O8DA 4X8VH 2FLBH 2HALA 3JZ1B 3QDZB 2ZNKH 3D62A 2OINA 4Y11E 3MO3A 1H8HD 5HGGA 5C17A 4AX9H 2ZHDA 1O37A 4YOIA 2OXSA 1EZSC 1G9IE 1GJ5H 1YPJH 2R0KA 4JMYA 5EPNA 4ZCNA 3RXVA 3O8RA 1SQAA 2D8WA 1QB1A 2A5IA 2NU0E 4AG1A 2JH0D 2OUAA 1K2I1 4X1PU 2HGTH 3SHAH 3ITIA 1VITG 1CGIE 1Z6EA 3H7TA 5CE1A 3VB4A 1TAWA 1UTKA 1BBRK 1INCA 1HAOH 2PSXA 4NA7A 1SB1H 2Z3DA 3SJOA 1S83A 1TYNA 1C5SA 3GY6A 5LPRA 3QO6A 3F2FA 1BRBE 1OWDA 1SVPA 3LGUA 1XKAC 2A2QH 3KGPA 2KR7A 1YYY1 2P8OC 2AIQA 2FOFA 1YPHE 2CK3D 4MPWA 3E0NB 1THPB 3ZV8A 4YXWD 3TJVA 3KCGH 5JPMH 2FYQA 1BIOA 2HPPH 1O2WA 3G01A 1UTPA 1DY9A 2UUYA 3U1JB 3SJKA 1C1NA 1TMUH 1O2JA 4WJG2 2FPZA 3M36A 4NSYA 5A0AE 4Y0ZE 2ZC9H 1EB1H 1O2KA 4ABDA 2NWNA 5DG6A 2AYWA 1BTUA 5IYTA 1SLUB 1P2OA 2YMSB 4NIYA 2PUXB 1AKSA 4BXSA 4JYVH 4THNH 1Z8GA 1V2MT 3HKJB 3L6PA 1O2LA 2BX3A 2BDGA 1F0TA 2XNIA 4ABFA 1Y3WA 1UK4A 1QA7A 3MYWA 4GCHF 2ANKH 1BRUP 1BTYA 3PYHA 1ORFA 2KFWA 1F5LA 4MTBA 1AIXH 1E79D 1HAGE 2GGVB 1W8BH 1SGRE 3K6YA 1E1RD 2GMTB 2Y5FA 5BPEA 1S6FA 5FHTA 2C90B 3MO6A 1Y5AT 3BG4B 1NTPA 3M3TA 3RMNH 1AD8H 5F53A 3OTPA 1MBQA 1NRNH 2G51A 1SFIA 4FUIA 2VINA 1SGNE 3H5CB 2VWMA 1H8ED 2YNBA 2ZU5A 4IBLH 1G3CA 5C1XA 3P8FA 3F9GA 1NT1A 3RM0H 4ZHAA 5GNDA 4F55A 2H9TH 4IN1A 3A7VA 3PTBA 1S6HA 4Y7AA 2XYAA 2BTCE 3T2NA 2F91A 4DW2U 1O3EA 3GS9A 1XUJA 3CS7A 2BY8X 3K9XB 2WPKS 3ZZ5A 2EI7A 1W0YH 2H2ZA 3RXCA 1BOQA 3UR9A 1AHTH 2ZWLH 1CO7E 1NN6A 2WYGA 5DP7A 1SGFG 3PV2A 4GVUA 2PFEA 3DSPA 1PQ8A 4ACBA 1DLEA 4U30A 4ABIA 1KXBA 2ZDAH 4DURA 3T28A 4AC9A 2WZQA 4K1SA 1TMBH 2W26A 1S0RA 4YOGA 1BHXF 2OC0A 1M9UA 5FX5A 2FI4E 4M7GA 1SPJA 2SNVA 1BQYA 2ZDMA 3RC5A 2QA9E 4VGCC 1EJAA 1GI8B 3BTDE 3S69A 4M9FA 4E05H 4Z1MD 3GCHC 1S85A 4FETA 3M37A 3ZZBA 3EE0B 3RDZA 1K1PA 1YPGH 1NPMA 3LGTA 2ZA5A 1RTKA 1ELBA 4ZKOU 1O35A 2BDCA 1HJAC 1S81A 2F9VA 4BTUB 9ESTA 3ZZ8A 4FUHA 4BOHA 3KYGA 1QB9A 3SU0A 3U8RH 1JIRA 1SQOA 4WXVA 1EPTA 1MCVA 2K0QA 3SU1A 3UIRA 1GVKB 1BITA 4X6MA 1K1MA 4AFZA 4A92A 5F03A 3E0PB 1C2GA 2JJ2D 2LELA 1L2EA 3SN8A 2ZQ1A 3PLBA 4B75A 4MLFB 5KEDA 4A7IB 1Y8TA 1QTFA 2CMYA 2H5DA 3SJ9A 3EGKH 1QA0A 1G3BA 1V2RT 2FOGA 2J97A 1QL7A 1B5GH 3RU4D 1UTOA 1DFPA 4MNVA 3ZZ7A 2BY6X 3NWUA 1J16A 5E0HA 4O97A 2QYIA 2J9NA 3H7OA 4FU7A 4OS5A 4ABEA 3A8CA 3MU0A 1FN6A 1MCTA 3RMMH 1HAXB 1WQSA 1VR1H 2W3IA 1E1QD 2BLWA 3ZZ9A 2P16A 3TJNA 1OPHB 1PPFE 3RUOA 3NUMA 3LC5A 1SGIB 2BHGA 5I46H 3PLKA 1UVPA 2GCHG 2ZEBA 1LKAA 1PYTC 3CP7A 1ZTKA 5JBTA 1O3BA 5T6DA 2OK5A 4Y8ZA 4YO9A 3GY2A 2XOKD 1FONA 2QC2A 4FU8A 3SU6A 2BD2A 2PGBB 1TIOA 2P3UB 4TY6A 3EQ0H 2FOEA 1VJAU 1O3NA 3ZVBA 3C27B 1DXWA 2FTLE 4X2XA 1IQNA 1YLDA 4J1YA 1ELCA 1O3OA 2JKHA 2BOHB 2FI5E 2WV5A 3A86A 3SNCA 1O2PA 1TQ0B 2HLCA 4OS7A 1N1LA 1TQ7B 1C2LA 1RGQA 1W13U 3OE7D 4ISNA 4BAOB 1ELGA 4FUBA 4TWYA 2BQ7B 2F9OA 3RXMA 1PQAA 3W94A 3VPKA 2F9NA 1TNLA 1O34A 1AWHB 4FUCA 1ZYOA 1O3AA 1LPKB 2P3FH 2ZU3A 3TGKE 1WAYB 3B9FH 3U9AH 1OYQA 1SKYE 4E7RG 5EW1H 2BQWB 3CNRA 3KQCA 4XBDA 1WSSH 4JZEH 1GI3A 2PHBA 4BTIB 4IW4E 2Z94A 2LNCA 2ZDKA 1L4DA 2P8OB 2ZFSA 1GJBB 3F68H 4NGAH 4NG9H 1GJDB 4AB9A 3ZVFA 3C1KA 4B73A 2KCAA 1JOUB 5GCHF 1D3TB 2XW9A 5A0BA 1VKYA 1EP6A 4IS5A 3P95A 3OTJE 2EI8A 2Z9IA 4A1XA 3UNRA 1SGFA 5EG4A 2AIPA 1WV7H 3N7EA 2Z9LA 3GCOA 5DK1A 2Y80A 1EB2A 2ZCKP 2A45B 3DUXH 4B71A 2L6OA 5GXPA 1V2VT 1GJ6A 2ZGCA 3TNSA 2ZHWH 1TOCB 3SHCH 1A5HA 2GDDA 1QNJA 3V7TA 2G4TA 1AY6H 1BJVA 2VVUA 2ZZUH 1TBRH 1LVOA 2ZFRH 4LZ1H 1PPCE 2A32A 3LT3A 2H9HA 4LOYH 4IGDA 4UFDH 3M61U 3MU1A 4NWLA 2ZCHP 1LDTT 1MKXH 1VGCC 3RXPA 2FYRA 1A0JA 1K1NA 1GHZA 1V2OT 2GT7A 1CHOF 4X8SH 1KLTA 1IQLA 3WW7A 4INKA 4P00A 1DS2E 2SGAA 1SGYE 3ATKA 1ZPBA 1Y3XA 1AQ7A 5PTPA 2A31A 1HAHH 1NFWA 3VXEH 1H8IH 1IQMA 1GHBG 1PPGE 4SGBE 1SR5C 2O8LA 2XRCA 3Q3KA 5F8ZA 1ARCA 1GL0E 5EQQA 1P3EA 1YGCH 2D26C 1AE8H 3FP8E 2CHAC 2J2UA 1HB0B 1HIAB 1FIWA 1V2KT 1Y5UT 3E3TA 1V2UT 1BTXA 1LCYA 1CHGA 1FJSA 2BDIA 2WUCA 5FPYA 3OEED 4IMQA 8GCHF 1UTQA 1D3PB 2OC8A 2ZG0H 2FS8A 1ELFA 1ZR0A 3TK6A 3RXSA 1YBWA 2UWOA 1ZLRA 1ZSJA 1VITF 1LTOA 4YESB 3S9BA 1HGTH 2FOHA 1O3GA 3V0XA 3VB7A 4MQAA 1A0HB 2IN2A 1O2XA 1C5QA 5E0JA 1TRNA 3AW1A 3LOXA 2GV7A 2PLXA 2OQ5A 1GBTA 3FO8D 3HK3B 4JZDH 1ZMNA 1UVTH 2XC0A 1C2KA 2FM2A 2VVCA 1GJ7B 1K28D 3QZRA 3E91A 4I8HA 4DG4A 5IDKA 3SQHE 2BXUH 2A4GA 2W7UA 3RXLA 4X8TH 4HFPB 4MPUA 4VGCB 2XCNA 3GY8A 2HRVA 2Z3EA 1A3BH 2O8MA 3GCHB 2JJ1D 1UTLM 1V2PT 1IQKA 1OP0A 1ESAA 4P02A 3SI3H 2FOBA 1DSUA 1HJAB 1TNIA 1P02A 1GDQA 1F0UA 5DP9A 2VIOA 1ZSLA 5EODA 3LJJA 4FVBA 1C1OA 2BY7X 3L33A 3FN8A 3PTNA 4TPYA 3S7KB 3A7YA 2XWBI 3ODFA 3VEQB 4WXIA 3S9AA 4HZHA 1YWUA 2Y5HA 5L2YH 1BMNH 2QV1A 3FP7E 2ZTZA 1YF4A 1O3FA 1P05A 3ENSB 5DSFA 3DFJA 1RS0A 3TH2H 1ELAA 1T8OA 2Z7FE 1NRSH 2GT8A 1O2VA 4ZMAH 3BN9A 3UB0A 3IITA 4E7NA 5EIYA 3DT0H 1O2YA 1PPBH 1W14U 2B9LA 2KAIB 1TX7A 2QAAA 3SU5A 4Y10E 1HAZB 1C5NH 1Q3XA 1WCZA 1C1SA 2FO9A 1C5RA 1O36A 1ESBA 3A8DA 1MD7A 3STIA 1D3QB 1TGBA 1Y3UA 1C2JA 1MUEB 4NZLA 3SV8A 5C5NA 4B76A 1N6XA 2XNDD 4ZUHA 1ETSH 3UOUA 5AFZH 1SLXB 3F9HA 1QY6A 2TBSA 4WVPE 5JBCS 3PWBA 1GMDF 1ETTH 2V6NA 1GL1A 1SFQB 5EU8A 1J14A 4Y0YE 3WWFA 2ALPA 1H9HE 1ZOMA 2XC5A 1QGFA 1P12E 3FOAA 3QUMP 4AFUA 2HOBA 7GCHG 3ZVAA 3P70B 3KQBA 1BCUH 1DOJA 3PMJA 1GGDC 2WINI 4ZH8A 1MAXA 3OY5U 1JXPA 4E06H 1AO5A 1JMOH 1SGCA 3GY5A 3TVJB 2ZGXH 1FN8A 3SV6A 2ZP0H 2ANYA 3A83A 1C5UA 3FFGA 3VB5A 4ABJA 3QTOH 1FDPA 5EJZA 5BRRE 5C20A 1X7AC 3STJA 4BAKB 7KMEH 4IN2A 2BVXH 2VWLA 1JWTA 2ZU2A 3SNAA 1H1BA 2THFB 5L2ZH 3GDUA 4Y71A 2OQUA 2HLDD 3ZZCA 3ODDA 2WPJS 4TPIZ 1S6LA 3A81A 1MAYA 1AFQC 1NRQH 3WWBA 1DWDH 1EZQA 7ESTE 2PV9B 1LPZB 1AZ8A 1XVMA 2I6QA 1EAWA 3BG8A 1C5PA 2IOTA 3RXFA 3RLWH 5J4SA 2K8IA 1WBGB 2W5EA 3HPTB 5T6GA 5LPEA 2WPMS 3UUZA 1SLVB 2Y7XA 3QWCH 1YPMH 1TNHA 5TCCA 4I8LA 4RT1A 1CA0C 4OGXA 4FUDA 4I7YH 2K1QA 1K1LA 3F0PA 4MNXA 2ZFQH 2DE9A 1O2TA 1WQVH 3A8AA 3LH3A 1D4PB 2H5CA 1V2NT 3GICB 1YM0A 2R0LA 2Z9JA 1C1VH 1CBWC 2VNTA 2HNTF 2QF4A 3ZVGA 2Q6DA 5ABWA 1C2FA 1ZTJA 1WOFA 1XMNB 2TGDA 1KTTB 1O2HA 3SUFA 3QGJA 1O31A 1MKWK 2OCVB 1AZZA 3TGIE 1V2TT 2GKVE 1TABE 1CGHA 1QRXA 3MNSA 3A7WA 1GHAG 2RFKC 5DO4H 4OS2A 1B7XB 2GVFA 1EAXA 3KYFA 1DANH 2C93B 3A84A 4HG6A 4JZIA 3BEUA 2SGQE 1YPLH 3QX5H 1VGCB 2GCHF 1GMHG 2F43B 4ACAA 1P2NA 1AU8A 1W2KH 2AMPA 3KEEA 2F4LA 1BHXB 2IPHA 3Q76A 4UFEH 5K0HA 1DWEH 1WXRA 1NESE 3RXHA 2BD3A 4KTCA 1UTNA 2ANWA 1TB6H 1CU1A 1BTZA 1SBWA 1GI7B 2G00A 2GV6A 2QIQA 2W6JD 4WH8A 2Y82A 2FX4A 6ESTA 2NU4E 2C8XB 3ZYDA 1A61H 1EQ9A 5E0GA 4FUGA 3MHWU 4I86A 5EJLA 1Z8RA 4JZ1A 2CHAB 1SC8U 4ZXYH 2QF3A 3UFAA 1TNJA 4CR5A 3VG8A 3MO9A 3GDVA 1A2CH 3R3GB 4B2BA 4CRFA 2LPRA 3MI4A 1QR3E 4K1TA 2WYJA 5K7RA 3P8OA 4AZ2B 1UK2A 2ZTXA 1P10A 1NU9A 2TGPZ 5LH8A 1O3PB 3RM2H 1GVLA 1O33A 2QY0B 1XVOA 1C5VA 1PPHE 3MH7A 1O3MA 3UPEA 1YCPK 1CT4E 2WV4A 1FY1A 3GY4A 5GDSH 3UWJH 1T32A 5CHAC 3T29A 1E36B 1IOEA 4X2VA 1SGPE 4ZHLU 3MMGA 5A2MH 2PKAB 1EZUC 5T6FA 2GP9B 1HAVB 1LVMA 5SGAE 2F83A 2G5NA 1TOMH 3SJIA 1KXEA 2GZ9A 1Y59T 2KCPA 3QGNB 1F7ZA 1Y3YA 1GBCA 5DP4A 4TSFD 2VIWA 1P0SH 5IK2D 3ZZ4A 1FY3A 1IQGA 1GBEA 2BB4A 4Y8YA 2EC9H 4WMDA 3TK9A 4B2AA 1F5KU 5C67A 3MH5A 4K3JA 1QB6A 4CR9A 3F6UH 3NZIA 2AMDA 2DUCA 2FIRH 2FWWA 2KZ4A 4JZFH 1GDUA 4AYYB 3PROA 1HNEE 3KQ5A 4U32A 2BD5A 4YOJA 4BAQB 3MOCA 2HVXA 2JDID 2ZECA 2F9BH 3MH6A 2STBE 2QE7D 1O2MA 2ZHQH 1A3EH 2V3HH 1GBMA 2GTBA 5FXLA 2WPIS 4B2CA 4CRCA 2ZPRA 1XUKA 1TA6A 2ZGHA 1MD8A 2AEIH 1YLNA 2WPHS 2ZU4A 5L6NH 1ANBA 2A4RA 1GJ9B 2YMSD 2AMQA 5CHBA 3SUEA 4NA8A 1HAIH 1MMJN 1RXPA 5F6MA 2QF5A 1VITH 3Q3YA 4RKJB 1P04A 1TWXB 3HGNA 1FY4A 2ESTE 1TMTH 3FKSD 1G36A 1NRRH 1WTGH 4X1RU 2XBYA 3GYMA 3N7DA 2BYAX 1UVUH 1KIGH 4D9RA 4XBBA 1AUJA 4D7FA 1GHBF 5HMAA 4NSVA 4GHQA 5EJ1A 5L30H 3MNXA 2KX4A 3PMHB 2XBWA 3GY7A 1ZRBA 4JCNA 1W3CA 1ZJKA 3SGBE 1TX6A 3PWCA 1YKTA 2P95A 5C2ZA 1V2QT 1FX0B 3LGIA 3SNBA 5AF9H 3CS0A 2XXLA 1TFXA 1GBHA 1EAUA 5DP5A 5CDFE 3M7QA 3RP2A 1DPOA 3V3MA 2JH5D 1GHXH 1ZGIA 1QBNA 4IC6A 2O8TA 2HNTC 4K8BA 1K21H 1L4ZA 5GIBA 1NO9H 4XFQA 1GGDB 5C5OA 5HIZA 2CJIA 1C5XB 3KHVA 4GPGA 3FP6E 2PGQB 5JBAS 4YT6H 1O2RA 2ANMH 1AFEH 4DCDA 1GVZA 1GHVH 2CV3A 1ARBA 2CF9H 4X2YA 2XWAA 2C3SA 3VB6A 1J15A 3SZNA 5B6OA 1GBIA 3ZVCA 1NY22 2BDAA 3NRLA 1HIAA 4UONA 3U1IB 4WMEA 1UCYE 4OGYA 3KF2A 4NWKA 4X0WU 1EAIA 5JYIA 3URCA 2WPLS 3FZDA 1AFQB 3SORA 1MQ6A 3EDXB 2ZFFH 3RXJA 1GCDA 1TPSA 4CRDA 3OY6U 2ZDVH 3EE7A 5EOKA 2WSSD 1UJ1A 1QL9A 3PV5A 1GJ8B 4DGJA 1MQ5A 1OWJA 3TNTA 3H09A 1UW7A 2R3UA 2R9PA 4TY7A 5C1YA 4YT7H 2FI3E 3K2UA 3D49H 2OLGA 1O2GH 2M5TA 5DP3A 1IAUA 3AAUA 1CA0B 1GBLA 4K8YA 1BBRH 1FPHH 1BTWA 1HXEH 1T8NA 1TNGA 1CT2E 5DN6D 1GMCF 1BUIA 3TH4H 3P8NA 1O32A 1C1QA 1CBWB 4BNRA 4CRAA 1XUHA 2AGIX 1QL8A 2OD3B 3GDSA 2J34A 4FUEA 1SOTA 4HGCA 2VIVA 4B6FA 3M7TA 4ESTE 1RD3B 4CHAC 2SNWA 2ZDNA 5EW2H 1LHFH 3E1XB 2JH6D 1K1OA 4QT8C 1GBJA 1LHGH 1YCPM 1HAYB 2STAE 1J8AA 1TGCA 1ESTA 4XRNA 6GCHG 3PM3A 1MKWH 2BDYA 1ZZZA 2W7SA 3UQVA 3B23B 2Y5GA 1MTWA 1AB9C 1P01A 2A0QB 3Q00A 2FOAA 4YLQH 4X1QU 2SGPE 1AVWA 1RFNA 2LP6A 1VCWA 3N7OA 3PMBB 3VFEA 3NK8A 1QJ6B 2R3YA 1Q31A 5JB9S 3MWIU 4DIIH 1DWCH 1W0ZU 3A80A 3IWMA 7GCHF 4RKOB 5A8YA 1XXDA 3PV4A 3RXDA 4K60A 1SGEE 2Z3CA 1DXPA 1K1IA 1RTLA 2ZKSA 3MU4A 4X6OA 3E6PH 2VWOA 5T1VA 2BZAA 4RN6A 4WWYA 1ELTA 3ZZ3A 1TBZH 3NKKA 4KELA 5FCKA 5HXFA 4IMZA 1F92A 4ASHA 1F0SA 5FPTA 2ZF0H 3OEHD 1BMAA 4B1TA 1GG6C 4XE4A 4OS6A 5TCAA 2F9PA 5C3NA 4H6SB 6CHAC 1ZMJA 3A7ZA 4ISIH 1UTMA 1ANDA 1C4Y2 1S84A 1WYKA 1YC0A 4KGAA 5JDUB 2ZHFH 3RXOA 1L0ZA 3K6ZA 5CHAB 3GCTG 2EQNA 1GBBA 1O3KA 2GDEH 3LONA 4Z6AH 4AFQA 1BA8B 3SO3A 3P17H 4A1TA 2OP9A 4IC5A 1ELVA 2OBOA 2FX6A 1SHHB 4UE7H 1YP9A 3BEFB 5FAHA 3LH1A 8ESTE 1HDTH 1TE0A 1W7GH 1O5BB 1O38A 2G4UA 1OP8A 2BMGB 3S7HB 1YY3A 1FXYA 2CXVA 2HPQH 1ACBE 5EPYA 1MTVA 1QCPA 1QQ4A 3RMOH 8KME2 1DUAA 2TGAA 2AH4X 1GPZA 2UWPA 1HLTH 3M3SA 3F9EA 1OWKA 2D2DA 1P3CA 1RJXB 1SMFE 1UK3A 2BDBA 1EP5A 1L1JA 3O8CA 1O3HA 1T8MA 2A4QA 1AE5A 3SI4H 3P8GA 3FAOA 4UFGH 5EXNA 2J98B 1E34B 2PP6A 3I77A 3HKIB 4AN7A 2ZFTA 1S82A 1GI5A 3V13A 1MTUA 9LPRA 3U28C 2Y81A 3A7TA 4CH2B 4GHTA 4I33A 1GHAF 1FY5A 3GISB 1IHSH 4KP0A 1DITH 1XUIA 1GMHF 1C1TA 1UTJA 3RMLH 3TH3H 1QJ7B 2C8YB 2BZ6H 1PPEE 3LC3A 3OAAD 3FVFB 3E16B 5C0UA 1P9SA 1CGJE 1L1NA 5FBEA 4DIHH 3RXIA 1THSH 3DFLA 1GI4A 1CE5A 3OSYA 1GI6A 2QXIA 1ELEE 1EASA 3M5NA 4B6EA 3LGWA 4MNWA 2R2MB 3UQOA 2VB0A 1K9OE 4CREA 3A85A 1QRWA 3KQDA 3OX7U 3MU5A 3SV9A 1DDJA 4Q7YA 3EAJA 2FOCA 4WY3A 1DUEA 2AS9A 2Z9KA 1OWIA 5E2OA 4RI0A 1HXFH 4CBNA 3DHKH 1MABB 4OS1A 5A0CA 3KNXA 2VVVA 3BTME 2RCEA 2VU8E 1L1GA 1BMFD 1NRPH 1ZTLA 3U8TH 1OSSA 1DY8A 1O2NA 4GUXA 5KGOA 1V2ST 1AUTC 5DPAA 4NCYA 2C8WB 1VCPA 1OKXA 3WY8A 1BRCE 1ETRH 3T5FH 3UY9A 1FIZA 5J4QA 2XBXA 5EQRA 2SFAA 1C2MA 1MZAA 4FOUC 4MDSA 3PLPA 3DCLA 3SYJA 4AB8A 1O3DA 2RDLA 4AORA 3Q77A 1EJNA 1FNIA 1NU7B 3U69H 1C1WH 1GI9B 5FX6A 1GBDA 1EZXC 1MU8B 1HCGA 4MVNA 3BEIB 2SGFE 4H42U 5DJ7A 1XUFA 4BAHB 5ESTE 2PWXA 1P11E 4Y79A 1DICA 1TONA 1EATA 1HJ9A 3PO1C 1NZQH 3HATH 1C5LH 2G8TA 1OP2A 1O3LA 2GZ7A 2C4FH 1KDQB 1CHOG 1V2WT 3ATMA 5C1UA 1QHRB 3ATLA 1LKBA 1GI1A 4JYTA 3LGYA 3EA8A 2FEQH 3NPSA 4GAWA 3W95A 1UCYK 3RLYH 1O2ZA 2FESH 3VB3A 1RTFB 1DLKB 2D1JA 1W11U 2ZTYA 2PKAA 4Y76A 3DSGA 3ZZ6A 4R0IA 1HAVA 3BTGE 4ZXXH 1IQHA 2ZPSA 5F8TA 1H8DH 2AGEX 5EQSA 3UR6A 4ZKRU 3BTKE 3MFJA 1C5TA 5C94A 3SNDA 8GCHG 2PTCE 1MU6B 1XUGA 2ZCLP 3LU9B 1TA2A 1O5DH 1O2UA 1G30B 2BM2A 1DM4B 2A7HA 2CF8H 5HM2A 2A2XH 3VGCC 5GPIB 2V35A 2WPDD 1AVGH 1O5GH 4CHAB 2W3KA 3F0OA 2G55A 1G2MA 2GCTC 1PQ5A 1COWD 1CQQA 1H9LB 2WUBA 2M2AA 1A5GH 3GCNA 3TITA 1KY9A 4Q4LA 4INHA 5DP6A 3P92A 4D7GA 4GSOA 4AOQA 1C5YB 1B0EA 4XSKU 1C9TA 1LHCH 1YLCA 4MPXA 4WF8A 3SGAE 2HWLB 4ABGA 4X1SU 2ALVA 1A1RA 1CVWH 2J5UA 1EPTC 1W10U 3BTEE 2JIZD 1AB9B 1PPZA 1DVAH 2ZU1A 4J2YB 1W12U 5GJ4B 2FOMB 2R2WU 2CGAA 1Z1IA 3LIWA 4YTAA 3RXKA 1TALA 2PSYA 4UDWH 5E8EH 1SI5H 3DD2H 2EEKA 3KIDU 2BX4A 1GBFA 2VIPA 1PYTD 2VIQA 1GBAA 3M5MA 2QXJA 1UHBB 3RU4T 1O5AB 1Z7KA 1C1MA 3BV9B 3SZEA 1BB0B 4Y6DA 1F0RA 1U6QA 1GCTC 4Q80A 2QCYA 1KLJH 1QFKH 3BSQA 3EA7A 1MKXK 3ELAH 3F1SB 1TX8A 3N99A 4H6TA 1AI8H 2FMJA 1OXGA 1E35B 1SSXA 4Z0KA 4BANB 1WDIA 1BTPA 2F9UA 5JB8S 4F49A 1GG6B 2ILNA 1ZRKA 6CHAB 2AFQB 4AGKA 1FMGA
chains in the Genus database with same CATH topology
1TRYA 1IHTH 3BTFE 5JBBS 3UOPA 1EOJA 1QIXB 3S9CA 2J95A 4BXWA 2ODPA 2G52A 3NXPA 1HYLA 5DGJA 5EXLA 1Z71A 3SOSA 1J9CH 3R0FA 1O3JA 3AW0A 2XTTB 2I6SA 1UO6A 1SQTA 2CN0H 4MPVA 1JRTA 1NM6A 2OBQA 1OYTH 5T3HA 2ZDLA 1D6WA 5HYOA 1C2HA 1A46H 4ABBA 1KLIH 2A1DB 4AG2A 1Z1JA 1BTHH 2H1UA 1IQIA 1GBKA 1HBTH 1P2IA 1RIWC 1H4WA 1OWEA 2PUQH 2PKSC 2YNAA 3VXFH 1MTNC 1GMDG 2VH0A 1DX5M 1FZZA 2P59A 3BTHE 1HFDA 2IJOB 1KXCA 3OU0A 1GHYH 1P06A 1JIMA 2FP7B 1KYNA 1P2MA 4WH6A 3D65E 8LPRA 2ZPQA 1CT0E 4WMFA 3RXRA 4K69A 1XX9A 1C2EA 4NIXA 4X1NU 2BD9A 3V12A 2VIDA 4MNYA 3UREA 2UUFB 2VJ1A 1O3IA 1O5EH 3BF6H 3LDXH 4ZKSU 2OC7A 3BTWE 3KL6A 6LPRA 1H9IE 4TWWA 4ZROA 6GCHF 4FUJA 3SV7A 3ZV9A 2ODYB 1G3DA 2VH6A 1TPOA 3M3VA 4GLYA 1UMAH 4DY7B 2ULLA 3BTTE 1LPGB 1P2QA 1SL3A 3FZZA 1N8OC 2QN5T 3QLPH 1O5FH 3ZVDA 3SV2H 5I25A 4NFFA 5GWZA 1EX3A 2YOLA 2B0FA 1FPCH 2UWLA 1QJ1B 3SJ8A 2BVRH 1LVBA 5F8XA 1AKSB 2OTVA 2AERH 5EGMA 3TLOA 1C5OH 1AMHA 3SBKA 4F4OC 3MH4A 2OC1A 1A0LA 1AVXA 3RC6A 4YLUA 3RXUA 3UNQA 4DOQA 1ZSKA 1ELDE 2QXGA 2VGCC 3SNEA 2V3OH 3U98H 1C2IA 4Q7XA 1K1JA 3LKWA 1YPKH 3GCTF 4I8GA 1EJMA 1NFUA 2B8OH 1GJCB 1C5WB 2ZFPH 1AGJA 3P6ZB 1E37B 1XXFA 4AFSA 4LZ4B 1NROH 1Y5BT 1VJ9U 4O03A 4DJZB 1GWAA 1EKBB 3UTUH 3MNBA 2A7JA 2RG3A 3M7UA 1ZGVA 4NFEA 1MH0A 2P94A 4X2WA 1C1PA 4I32A 2ODQA 3PO1B 2XBVA 5AFYH 1NFXA 4YZUA 4SGAE 1XM1A 3MU8A 3IG6B 1C5ZB 1HPGA 1T31A 1ZPZA 4GCHG 1FUJA 1SHYA 4TYDA 1BDAA 3TIUA 1K22H 3TJOA 3I29A 4H4FA 1O2SA 3AVZA 1A4WH 1ANCA 1OWHA 3DA9B 2FZZA 2TIOA 2J94A 4FUFA 3TJUA 1O0DH 5DKMA 1JRSA 3TGJE 1ZMLA 5LGOA 4BTTB 4O9VA 4D8NA 4ABAA 1SGTA 4U2WA 2BY5X 3E8LA 3QN7A 1SOZA 1ZJDA 1OOKB 1G32B 1UCYH 2JETC 3UNSA 4FXGH 3RXBA 3A82A 1B0FA 3T26A 1D3DB 1EXFA 1P2JA 1W7XH 2Q6GA 1BMMH 1ZHRA 2A4OA 4A1VA 4XBCA 1ZPCA 4X8UH 4U01A 3VGCB 4R8TB 1FAKH 1DSTA 2GCTB 1BBRE 1ANEA 1G37A 4PROA 2NU2E 3T25A 4FU9A 1NFYA 1EUFA 3PMAB 5A8XA 1NC6A 4AYVB 1TRMA 5ESBA 2ZI2H 3AAVA 1D9IA 1FV9A 1TBQH 3QK1A 2QGRA 4ISHH 1RRKA 1P9UA 2Y6TA 5CMXH 4FVDA 1EPTB 1G3EA 1ZHPA 1SG8B 1A7SA 3LGVA 2TRMA 3RXEA 4I8JA 1LHDH 2ZO3H 2Q6FA 4ISOA 2AGGX 2P3TB 4B74A 4HI3A 3OYPA 4Y8XA 4NIWA 1YPEH 1KXDA 4AGJA 3A8BA 1OX1A 2BD8A 2Z9GA 3U8OH 3A89A 3B8JA 3RXTA 4X6NA 1LVYA 1HJ8A 4UFFH 4CH8B 1GI2A 1O5CB 2G81E 1GCTB 2RA0A 2NU3E 2TPIZ 2ZGBH 2SGEE 2O8WA 3ZZDA 1QBOA 3D23A 5FBIA 5ETXA 1CA8B 5A09A 3KQEA 3M35A 2H9EH 3LJOA 3LPRA 1ABIH 2GD4B 1E38B 1FLEE 4ZAEA 1S0QA 3FANA 1WUNH 2KAIA 1DE7H 2BVSH 1ID5H 1GJAB 1TPPA 5G4BA 1SLWB 1HV7A 4YM9A 1XKBC 1AN1E 1G2LA 2ZGJA 1E0FD 2NU1E 1DT2A 1QQUA 2VWNA 2FODA 1C2DA 1LQEA 1ABJH 1VZQH 2PR3A 4HTCH 3SQEE 1O2OA 1EOLA 1Z8JB 4I31A 3T62A 4DVAU 1Y3VA 3T27A 5HM9A 4Q7ZA 2HNTE 3Q3XA 1Q2WA 2B7DH 4CRGA 2GMTC 4KTUA 1TLDA 1TGTA 1FI8A 2UUKB 3GOVB 4K5ZA 1BRAA 4XDEA 5AVDA 4D76A 1FY8E 1YCPH 2ZQ2A 3BG4C 2BD7A 2FDAA 1J17T 1KXFA 1RIWB 3M5OA 4X6PA 3HGPA 4ZKNU 1Z8IB 3A87A 3SU2A 2PKSB 1GHWH 3JZ2B 1MTNB 1LHEH 1C4V2 1FQ3A 4A6LA 2ZIQH 1BMLA 1C4U2 3I78A 3SW2B 3TK5A 3O8BA 1IQJA 5TJXA 4KTSA 2Q1JA 2Y7ZA 3RXQA 1V6DA 2BQ6B 1KDQA 3M5LA 1MBMA 1PJPA 1P09A 1P57B 5AHGH 1GI0A 1NS3A 2G5VA 2FTMA 1MTSA 3UWIA 7LPRA 4ZHMU 3AASA 3SU3A 3A88A 3ESTA 3SGQE 3TPIZ 3TU7H 4KKDA 1D6RA 2PW8H 2EI6A 1QBVH 1LMWB 1VCQA 1GDNA 1ZHMA 3BIVH 1UVSH 3RC4A 1V2LT 4CRBA 1BJUA 3GY3A 4K1EA 3E90B 2GX4A 5LPFA 4D9QA 3CENA 1SGDE 3RXAA 3GYLB 2P93A 1O30A 1BZXE 1QURH 1KSNA 2J38A 2QF0A 3ATWA 2A7CA 4Q2KA 2O8UA 3K65B 4K2YA 1YPHC 4O3TA 2DE8A 3EA9A 1BT7A 2BLQA 1SGQE 2TGTA 4LK4A 1N8OB 1THRH 1JBUH 4A5TS 4DT7B 1TGNA 4NZQA 4O3UA 3QTVH 4I8KA 4UEHH 2BLOA 3EYDA 2J4IA 1HAPH 3ZYEA 2J92A 1F5RA 2BY9X 4RSPA 1QRZA 2RA3A 3SUDA 2GZ8A 2H6MA 3A7XA 2A5KA 1AWFH 2Z6BD 3SUGA 3PB1E 2BXTH 4OS4A 1HRTH 1CSOE 2BD4A 2C8ZB 2ZHEH 2FXRA 1KXAA 1P2KA 1A5IA 1TPAE 2VGCB 1O2IA 1P8VC 3L3TA 2O9QA 1UVOA 4CBOA 1Z6JH 5GCHG 1O2QA 1GMCG 1WU1A 4JK5A 5H4IB 2BLVA 1IQFA 1TNKA 4LXBH 1DWBH 4NIVA 2B5TB 1LO6A 1C1RA 3URDA 3MTYA 5E2PA 2A5AA 4INLA 4Y7BA 1PFXC 4UD9H 1FAXA 1F2SE 4BAMB 1S5SA 3BIUH 3NCLA 1UHBA 1C5MD 4JYUH 1O39A 3S0NA 1N6YA 3KN2A 2ASUB 5FCRA 1C1UH 5A8ZA 2BDHA 1T7CA 1LQDB 2UUJB 2XC4A 3ATIA 1O3CA 2FS9A 2SGDE 3SU4A 1V3XA 2V0BA 3BTQE 2XCFA 1T4VH 1MZDA 1V2JT 1WTHD 1IQEA 1TGSZ 1P03A 1KTSB 2BOKA 1C9PA 4NA9H 5DP8A 1T4UH 3RU4E 4ISLA 1HUTH 1T8LA 2FLRH 5EXMA 2EA3A 4JK6A 3ZZAA 1PQ7A 4ABHA 5FPSA 4XOJA 3HK6B 1OS8A 3ZVEA 2JETB 3F9FA 2QXHA 3MNCA 4MG3A 2F3CE 3RXGA 3QZQA 2PTNA 1GJ4H 3O8DA 4X8VH 2FLBH 2HALA 3JZ1B 3QDZB 2ZNKH 3D62A 2OINA 4Y11E 3MO3A 5HGGA 4AX9H 2ZHDA 1O37A 4YOIA 2OXSA 1EZSC 1G9IE 1GJ5H 1YPJH 2R0KA 4JMYA 5EPNA 3O8RA 3RXVA 1SQAA 2D8WA 1QB1A 2A5IA 2NU0E 4AG1A 2JH0D 2OUAA 1K2I1 4X1PU 2HGTH 3SHAH 3ITIA 1VITG 1CGIE 1Z6EA 3H7TA 5CE1A 3VB4A 1TAWA 1UTKA 1BBRK 1INCA 1HAOH 2PSXA 4NA7A 1SB1H 2Z3DA 3SJOA 1S83A 1TYNA 1C5SA 3GY6A 5LPRA 3QO6A 1BRBE 1OWDA 1SVPA 3LGUA 1XKAC 2A2QH 3KGPA 1YYY1 2P8OC 2AIQA 2FOFA 1YPHE 4MPWA 3E0NB 1THPB 3ZV8A 3TJVA 3KCGH 5JPMH 2FYQA 1BIOA 2HPPH 1O2WA 3G01A 1UTPA 1DY9A 2UUYA 3U1JB 3SJKA 1C1NA 1TMUH 1O2JA 4WJG2 2FPZA 3M36A 4NSYA 5A0AE 4Y0ZE 2ZC9H 1EB1H 1O2KA 4ABDA 2NWNA 5DG6A 2AYWA 1BTUA 5IYTA 1SLUB 1P2OA 4NIYA 2PUXB 1AKSA 4BXSA 4JYVH 4THNH 1Z8GA 1V2MT 3HKJB 3L6PA 1O2LA 2BX3A 2BDGA 1F0TA 2XNIA 4ABFA 1Y3WA 1UK4A 1QA7A 3MYWA 4GCHF 2ANKH 1BRUP 1BTYA 3PYHA 1ORFA 1F5LA 4MTBA 1AIXH 1HAGE 2GGVB 1W8BH 1SGRE 3K6YA 2GMTB 2Y5FA 5BPEA 1S6FA 5FHTA 2C90B 3MO6A 1Y5AT 3BG4B 1NTPA 3M3TA 3RMNH 1AD8H 1MBQA 1NRNH 2G51A 1SFIA 4FUIA 2VINA 1SGNE 3H5CB 2VWMA 2YNBA 2ZU5A 4IBLH 1G3CA 5C1XA 3P8FA 3F9GA 1NT1A 3RM0H 4ZHAA 2H9TH 4IN1A 3A7VA 3PTBA 1S6HA 4Y7AA 2XYAA 2BTCE 3T2NA 2F91A 4DW2U 1O3EA 1XUJA 3CS7A 2BY8X 3K9XB 2WPKS 3ZZ5A 2EI7A 1W0YH 2H2ZA 3RXCA 1BOQA 3UR9A 1AHTH 2ZWLH 1CO7E 1NN6A 2WYGA 5DP7A 1SGFG 4GVUA 2PFEA 1PQ8A 1DLEA 4U30A 4ABIA 1KXBA 2ZDAH 4DURA 3T28A 4K1SA 1TMBH 2W26A 1S0RA 4YOGA 1BHXF 2OC0A 1M9UA 5FX5A 2FI4E 4M7GA 1SPJA 2SNVA 1BQYA 2ZDMA 3RC5A 2QA9E 4VGCC 1EJAA 1GI8B 3BTDE 3S69A 4E05H 3GCHC 1S85A 3M37A 3ZZBA 3EE0B 3RDZA 1K1PA 1YPGH 1NPMA 3LGTA 2ZA5A 1RTKA 1ELBA 4ZKOU 1O35A 2BDCA 1HJAC 1S81A 2F9VA 4BTUB 9ESTA 3ZZ8A 4FUHA 4BOHA 1QB9A 3SU0A 3U8RH 1JIRA 1SQOA 4WXVA 1EPTA 1MCVA 3UIRA 3SU1A 4AFZA 1GVKB 1BITA 4X6MA 1K1MA 4A92A 5F03A 3E0PB 1C2GA 1L2EA 3SN8A 2ZQ1A 3PLBA 4B75A 4MLFB 4A7IB 1Y8TA 1QTFA 2CMYA 2H5DA 3SJ9A 3EGKH 1QA0A 1G3BA 1V2RT 2FOGA 1QL7A 1B5GH 3RU4D 1UTOA 1DFPA 4MNVA 3ZZ7A 2BY6X 3NWUA 1J16A 5E0HA 4O97A 2QYIA 2J9NA 3H7OA 4FU7A 4OS5A 4ABEA 3A8CA 3MU0A 1FN6A 1MCTA 3RMMH 1HAXB 1WQSA 1VR1H 2W3IA 2BLWA 3ZZ9A 2P16A 3TJNA 1OPHB 1PPFE 3RUOA 3NUMA 3LC5A 1SGIB 2BHGA 5I46H 3PLKA 1UVPA 2GCHG 2ZEBA 1LKAA 1PYTC 3CP7A 1ZTKA 5JBTA 1O3BA 5T6DA 4Y8ZA 4YO9A 3GY2A 1FONA 2QC2A 4FU8A 3SU6A 2BD2A 2PGBB 1TIOA 2P3UB 4TY6A 3EQ0H 2FOEA 1VJAU 1O3NA 3ZVBA 3C27B 1DXWA 2FTLE 4X2XA 1IQNA 1YLDA 4J1YA 1ELCA 1O3OA 2JKHA 2BOHB 2FI5E 2WV5A 3A86A 3SNCA 1O2PA 1TQ0B 2HLCA 4OS7A 1N1LA 1TQ7B 1C2LA 1RGQA 1W13U 4ISNA 4BAOB 1ELGA 4FUBA 4TWYA 2BQ7B 2F9OA 3RXMA 1PQAA 3W94A 3VPKA 2F9NA 1TNLA 1O34A 1AWHB 4FUCA 1ZYOA 1O3AA 1LPKB 2P3FH 2ZU3A 3TGKE 1WAYB 3B9FH 3U9AH 1OYQA 4E7RG 5EW1H 2BQWB 3KQCA 4XBDA 1WSSH 4JZEH 1GI3A 2PHBA 4BTIB 4IW4E 2Z94A 2LNCA 2ZDKA 1L4DA 2P8OB 2ZFSA 1GJBB 3F68H 4NGAH 4NG9H 1GJDB 4AB9A 3ZVFA 3C1KA 4B73A 1JOUB 5GCHF 1D3TB 2XW9A 5A0BA 1EP6A 4IS5A 3P95A 3OTJE 2EI8A 2Z9IA 4A1XA 3UNRA 1SGFA 5EG4A 2AIPA 1WV7H 2Z9LA 3GCOA 5DK1A 2Y80A 1EB2A 2ZCKP 2A45B 3DUXH 4B71A 5GXPA 1V2VT 1GJ6A 2ZGCA 3TNSA 2ZHWH 1TOCB 3SHCH 1A5HA 2GDDA 1QNJA 3V7TA 2G4TA 1AY6H 1BJVA 2VVUA 2ZZUH 1TBRH 1LVOA 2ZFRH 4LZ1H 1PPCE 2A32A 3LT3A 2H9HA 4LOYH 4IGDA 4UFDH 3M61U 3MU1A 4NWLA 2ZCHP 1LDTT 1MKXH 1VGCC 3RXPA 2FYRA 1A0JA 1K1NA 1GHZA 1V2OT 2GT7A 1CHOF 4X8SH 1KLTA 1IQLA 4INKA 1DS2E 2SGAA 1SGYE 3ATKA 1ZPBA 1Y3XA 1AQ7A 5PTPA 2A31A 1HAHH 1NFWA 3VXEH 1H8IH 1IQMA 1GHBG 1PPGE 4SGBE 1SR5C 2O8LA 2XRCA 3Q3KA 5F8ZA 1ARCA 1GL0E 5EQQA 1P3EA 1YGCH 2D26C 1AE8H 3FP8E 2CHAC 2J2UA 1HB0B 1HIAB 1FIWA 1V2KT 1Y5UT 3E3TA 1V2UT 1BTXA 1LCYA 1CHGA 1FJSA 2BDIA 2WUCA 5FPYA 4IMQA 8GCHF