1W14U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U01
1PQ5A 1SHHB 1CGHA 4DGJA 4KELA 1SOTA 4R0IA 4FUIA 1MKXK 3P8OA 2A32A 2VIWA 1GI2A 1GJBB 3CS0A 5HM9A 3SN8A 1G32B 1TPPA 2AMDA 4JZEH 1THPB 1MD8A 1H8DH 2EI8A 1P2OA 1CE5A 3SU1A 1YBWA 2ODPA 4NZLA 4CR5A 3QLPH 1ZGIA 2PUQH 3TK6A 1Z8JB 2PKAB 1CHOG 4ESTE 1QL8A 2WPHS 1T4VH 3GY2A 1HIAA 2PTCE 3EQ0H 4THNH 4Y11E 4NCYA 4YOJA 1BTYA 1BHXF 1IHSH 1XUHA 3EYDA 2HPQH 2AERH 1MAXA 3MU1A 5FCRA 3SW2B 8GCHG 1XXFA 4YM9A 3ZZDA 4JYUH 3MU5A 5LH8A 3UUZA 4BNRA 1C5PA 1L2EA 3RMNH 1YLCA 3OTJE 1W3CA 1HNEE 2ZDVH 3RXUA 1BQYA 2FM2A 1IQLA 3AVZA 4K1EA 5AFYH 4Q7ZA 1BMMH 4I8HA 1DXWA 4Q2KA 4FVDA 1ELEE 1YCPM 1ZZZA 3HPTB 2WPLS 1ZR0A 5IDKA 3QX5H 1RGQA 5GCHG 4IW4E 1GHVH 5EW2H 2P8OB 3D49H 5E0HA 2BDGA 4K60A 4CRDA 1SL3A 1F0RA 4CR9A 1IQHA 3DA9B 1GBMA 1GJCB 4XBCA 2AGGX 3Q77A 1DWCH 1E37B 5EXMA 2UUFB 2FI5E 3BG4B 5DP4A 2W3KA 1CVWH 1GMDG 3ZZ3A 1C5TA 3TJOA 3A7WA 1S0QA 3ZZ5A 1P11E 1VGCC 2ZCKP 1C1WH 3RXSA 4X8TH 3LGVA 2I6QA 1FY3A 2ZU1A 3F9HA 3V3MA 1C4V2 2CV3A 3HGNA 2OC8A 1WCZA 1V2LT 5DO4H 3TGJE 3BTHE 1IHTH 4PROA 3E6PH 2WYGA 4R8TB 5EU8A 3TK5A 1C2IA 3ZZAA 1SI5H 4SGAE 1GJ6A 2PSXA 3SI4H 1H9IE 1O3FA 5CHAB 1EPTB 3T26A 1FPCH 4UFDH 1NU7B 5EW1H 2XC5A 3ODDA 3TGIE 4B71A 2ULLA 2HALA 3VB5A 1NRRH 1CGJE 2ZDMA 5T6GA 1NRQH 1Z8RA 1AI8H 3AW0A 1NFXA 2ANMH 3E0PB 1C4U2 1VJ9U 4DVAU 3MI4A 1G3DA 1BTXA 2HOBA 3L6PA 3M7TA 5F03A 4B1TA 1IQNA 2BY7X 1Z7KA 2CN0H 1MUEB 2OTVA 1BRCE 2FYRA 3KQEA 4AG1A 4FUHA 1HJAB 3WY8A 3PM3A 4X6NA 1IQGA 3TJNA 2R2MB 2P95A 1KLIH 1QB6A 2G5NA 3F1SB 4BXSA 2FMJA 1EJNA 1V2VT 1D6RA 3F9FA 1GMCG 2GT7A 2BOKA 1U6QA 2UUKB 2FP7B 1H9LB 1O2KA 3A88A 1B0EA 1EAIA 3IG6B 3PLPA 2EA3A 2UUYA 1L4DA 1HAVA 1ABJH 1LHCH 3GCHC 1LQDB 5C3NA 3BIUH 2CF9H 4WF8A 3RP2A 1K28D 2IJOB 3EA8A 1AZ8A 1TOMH 1E34B 1BUIA 3LU9B 2AEIH 2K1QA 3SZNA 3LONA 3KIDU 1K1MA 4KTUA 2BQ7B 6ESTA 2ANYA 4NSYA 1GI6A 2C3SA 2A7HA 1DUEA 4X2WA 1ZPBA 4XBDA 2C8WB 2BX4A 1KXBA 1S6HA 3U98H 1GBEA 1W2KH 3RMOH 2QXHA 1IAUA 1XMNB 3Q3YA 3SJKA 3RXVA 3DFJA 3SU6A 1TA2A 2FWWA 1C4Y2 4B73A 2PHBA 4D9QA 1DXPA 2KAIA 1IQKA 5DP5A 1A5GH 2GT8A 1NN6A 1CBWC 1O5GH 1ELBA 4LOYH 2FO9A 1ID5H 4BAKB 1V2RT 4NZQA 1DY9A 2ZCHP 2OUAA 1YPLH 4MVNA 1QRXA 3MO9A 1JRSA 1D3DB 2HNTC 3SORA 3ENSB 1SLVB 2R3UA 2VVCA 4X1SU 1KXCA 2W7SA 4B2CA 1UTOA 5FX6A 5AFZH 3E0NB 1B5GH 2ZKSA 3B8JA 3RXMA 1HAHH 1WV7H 2A4RA 4HI3A 5A0BA 3UQVA 3HGPA 1PYTC 3RDZA 1MQ6A 4FUBA 1T32A 1ZHPA 3F9GA 1EATA 1PPFE 1LO6A 1BRAA 2Z3CA 1TB6H 1SLXB 3V0XA 2J34A 1NRNH 3NK8A 4IC5A 2BLVA 2WPMS 2SNVA 3EA9A 3P17H 1TGTA 4NA8A 1A3EH 2O8WA 2BD7A 4GUXA 3QUMP 3P70B 1AN1E 3VGCB 1T4UH 2SGEE 3FVFB 3T2NA 1O3JA 1S83A 1GGDB 3PTBA 1TX6A 1O3MA 3SUEA 1OYTH 3V7TA 5EPNA 3IITA 3VXFH 2ZGXH 3SU4A 2D8WA 4XBBA 5E0GA 2BY8X 4ISHH 2VJ1A 1ANDA 2VIOA 1G3CA 3I77A 1FLEE 1RIWB 2WUBA 1ELCA 5HGGA 1AIXH 3QO6A 3SU3A 1DPOA 3LH3A 3DFLA 2CXVA 1MTUA 1EB2A 3KF2A 5ESBA 3MFJA 1J16A 2XNIA 4ZHLU 1ELGA 2QA9E 2R3YA 2FI4E 5K0HA 1EZSC 1FN8A 4ISIH 2Z94A 3EGKH 4U01A 2BHGA 1LPKB 1C1TA 1KXDA 1QJ1B 2CHAB 4I33A 2NWNA 2OQ5A 1GJAB 1S5SA 4K1TA 3W95A 2NU4E 3S7HB 4FU7A 5JBAS 1ESAA 4MG3A 2QF3A 1INCA 1MTNC 3LJJA 1YPHC 2ZNKH 2J2UA 1S84A 1FV9A 2ZHDA 2ILNA 2M5TA 4XFQA 3ODFA 4H42U 1Z8GA 1DS2E 2W7UA 2BB4A 1TFXA 2FOEA 3ZVGA 1WYKA 3A80A 3VB3A 4K8YA 1ZTLA 3Q3XA 1PFXC 2SGPE 1O3CA 3BTFE 1TBQH 2H5CA 1QTFA 3DT0H 1P05A 4Q7XA 2OD3B 5ETXA 1TONA 1GBDA 1NFWA 4HFPB 5JB8S 4FUFA 4QT8C 4GPGA 2QV1A 3UPEA 1F0SA 1T8LA 1LHEH 2J4IA 2BQ6B 1O2JA 2BZ6H 1HAPH 1Z1JA 6CHAB 4ZMAH 2TIOA 1XX9A 2B7DH 2WINI 1ZGVA 4GCHF 3SBKA 5FPTA 3RXAA 2BDHA 2JH5D 1QY6A 2PKSB 3P95A 1A0LA 3UOPA 1GBCA 2F9OA 1K2I1 1O3BA 2EI7A 4AFQA 3LC5A 2VWOA 4MTBA 1BMAA 1DICA 1XUJA 1JIMA 3PWBA 2JETB 3JZ1B 1W12U 5BPEA 5SGAE 1QB9A 1M9UA 1XUIA 1OX1A 1GBAA 2FOBA 4IC6A 1PQAA 2Q6GA 3VXEH 3RC6A 2GCHF 2TGDA 3BTGE 1GMHG 1CT0E 1LVYA 2W3IA 1QBOA 5A09A 2VGCC 1ESBA 3O8BA 3HATH 1SFIA 1B7XB 3ZZ7A 2I6SA 4WH6A 1O3KA 1NY22 1FIWA 1UMAH 1C2JA 3AW1A 1N1LA 1CGIE 4ZHMU 1EAXA 3MU8A 1QURH 4MDSA 1ELDE 2G5VA 3PO1C 1SGFA 4B2AA 3UQOA 3TJUA 1OWHA 3ZVCA 1TQ7B 3MYWA 2A7CA 5A8XA 1FNIA 4CRBA 1GG6B 3R3GB 5L2ZH 1MTSA 3TVJB 2R9PA 2XBXA 2ZHWH 2GMTC 4TYDA 1BZXE 2F9PA 1O2ZA 2ZDNA 4B76A 1J9CH 1C9TA 5TCAA 1PYTD 4BAOB 1BMNH 1TBZH 2BVXH 4YOGA 1P2QA 5FBEA 3GOVB 1Y8TA 1VITF 2A2XH 4FUJA 2V3OH 3U8TH 2HNTE 4NFFA 3VFEA 1C5YB 1GBJA 3SNEA 1A7SA 1FY1A 5DP6A 5EXLA 4X1PU 2A1DB 5TJXA 3MNXA 3KHVA 3VB7A 5GJ4B 4FU9A 1KSNA 4KTSA 4MPVA 3O8RA 2A7JA 3GDVA 2ZIQH 4E7NA 3A87A 3NCLA 2H5DA 3O8CA 1JIRA 2QXGA 1C2GA 3H5CB 1SFQB 1K1OA 1C5OH 1SB1H 3M3VA 3RLYH 1FDPA 1AE8H 1GI7B 2WPJS 4NG9H 2XCFA 1O3AA 1O3LA 1H9HE 2V35A 1O3HA 1NTPA 1OYQA 3RM2H 4AYVB 1ZOMA 3M61U 3SNAA 1TLDA 1GJ8B 2SGFE 5JBTA 1DVAH 1O3PB 3RXLA 1LPZB 1P2MA 1C5WB 4ABDA 2Y81A 2UWPA 3RXEA 3Q00A 4CRGA 2BDAA 3PV4A 1O37A 2A2QH 4RSPA 4ISLA 3QN7A 2GGVB 1XUKA 3T62A 4CREA 4TPYA 1H4WA 1XKBC 1G2LA 2ALVA 3URCA 4NSVA 1O3DA 3UY9A 1UHBB 2XBYA 2YNBA 1AKSA 2WPKS 1AHTH 4H6TA 1G30B 3MMGA 2ZFRH 3SJIA 1EXFA 1HAZB 3NZIA 1GHZA 2ZTYA 4NIVA 1GL0E 1BJVA 1OP0A 1LKBA 1NPMA 3UNRA 4SGBE 2LPRA 1P01A 2B0FA 3PB1E 3BTKE 3GCTG 4YOIA 5HYOA 6LPRA 1A46H 2GCTB 4FUGA 3U1JB 1W14U 2W26A 2BVSH 3A83A 1PPZA 4X6PA 4JK5A 1OPHB 1TBRH 4AX9H 1QJ6B 4J1YA 1AVGH 1RTFB 3M37A 1Z1IA 1A0JA 2R2WU 4CRAA 3VB6A 3ZVBA 1D3PB 1UTJA 3BEUA 4NGAH 3SO3A 1GVZA 2BZAA 3KEEA 1YC0A 1OS8A 5FAHA 1P9UA 2FTLE 3RXTA 4X2XA 4IN2A 4IN1A 1JWTA 1UTMA 2ANWA 1GDUA 2O8UA 5I46H 2D2DA 3SGAE 2Y7ZA 4DOQA 1O3IA 5EXNA 3G01A 9ESTA 4GLYA 3DHKH 3SUDA 1EJMA 1KLJH 1OOKB 1V2WT 3PMAB 3M36A 1C2HA 4HGCA 3PMJA 1A5HA 5F8TA 1DFPA 4Y0ZE 1NRPH 1AFEH 1UTQA 3F68H 1FJSA 3A84A 2BDIA 2FX6A 4UFGH 3GY8A 1OWDA 3QTOH 3SUFA 5A2MH 1C5LH 2NU0E 3SQHE 3RXJA 2ZDLA 2ODQA 1AB9C 4MNVA 1OWKA 2VH0A 4A7IB 1G3EA 2YOLA 1ZSKA 1V2PT 3MU0A 1QFKH 4X8SH 1O5EH 3BTEE 1ZMLA 5K7RA 1L0ZA 1EOLA 5T6FA 1YCPK 1IQFA 2ZFQH 3RXIA 2XBVA 3E3TA 1UVUH 3SNDA 3NXPA 1IQEA 4ASHA 2ZHEH 2FXRA 1SGNE 3LIWA 1AO5A 3UWIA 1TPOA 2G8TA 5HXFA 3EA7A 1DUAA 3P8FA 1FI8A 2XTTB 1DLEA 5GWZA 3M35A 2BXUH 1C5RA 1GI3A 1C2MA 5LGOA 3TPIZ 1GHWH 3MH5A 1GHXH 1CU1A 1CA0C 1HFDA 2FOAA 3S7KB 1NS3A 4ABGA 1SVPA 4X6MA 1GBKA 3RXRA 1T8MA 1AFQC 4AORA 1YF4A 2UWOA 2QIQA 2VIDA 1Z71A 2RA0A 1K1JA 1P2JA 2CMYA 2ZGJA 4X1NU 4J2YB 3W94A 4I8LA 1KLTA 1S81A 1KDQA 1P3CA 7LPRA 1GHBF 1ANBA 2O8TA 5L6NH 1UCYH 2FESH 3AAVA 4A6LA 3TU7H 2Z9IA 4LXBH 3T25A 1Z8IB 2ASUB 2Y5GA 5CE1A 1UJ1A 2SGQE 1EZQA 1A2CH 4D76A 1VCQA 2OC1A 1YPMH 1O3EA 1XXDA 2GZ7A 4BAHB 1P04A 2PGBB 3PYHA 1GWAA 1SQTA 1GVLA 5EPYA 3PLKA 3H7TA 1Y3UA 4ZAEA 3V13A 2ZCLP 4UEHH 1RTKA 4CBNA 2GCHG 4INKA 3OU0A 1SBWA 3ELAH 4K3JA 1UCYE 1MTVA 2H6MA 2H2ZA 1ORFA 1GI5A 2H1UA 3UTUH 1SGYE 2AS9A 2NU1E 2Z3EA 5E0JA 3MTYA 1O2IA 3TK9A 2JKHA 1P02A 5B6OA 4Y6DA 3MO3A 2DE8A 2GTBA 2HLCA 2RG3A 1O0DH 1GGDC 2EI6A 3ZZ4A 1FPHH 1VGCB 1QCPA 2BOHB 2ZQ2A 4UFEH 1FQ3A 1P57B 2ZFFH 2AMQA 1GCTC 2XRCA 4JZ1A 4VGCC 4XE4A 2ZP0H 2ZTZA 6GCHF 1AU8A 1AVWA 1O2QA 1ETRH 1SGQE 1YPJH 1O2YA 1MKWH 2OXSA 2ZGCA 1Q3XA 4XDEA 1E38B 5F8ZA 1MMJN 1OKXA 4NWKA 4CBOA 4GSOA 3BF6H 2AGIX 1EQ9A 4WXIA 4A5TS 5L2YH 1HIAB 1NROH 2ZGBH 4X2YA 3EE0B 1NESE 3CS7A 4OS4A 1ZYOA 2ZHQH 1AWHB 1YP9A 1O2HA 1IQJA 4WY3A 1V2TT 1ZRKA 1YM0A 1VITG 3M3SA 1HAIH 3RMMH 2AGEX 4Y8XA 3ATLA 1FIZA 2BX3A 1DANH 1V2JT 3GY4A 1V3XA 3BTME 1ZJDA 2TRMA 1W11U 1SSXA 4INHA 1GJ5H 1HUTH 4FVBA 1TE0A 3Q3KA 3OY5U 2THFB 1K1LA 2ZFTA 1A5IA 2RDLA 2ZU4A 1S6FA 4JZFH 2FS8A 1TNGA 2WV4A 1SGTA 1SGCA 1O5CB 1GL1A 3BSQA 3TGKE 4X0WU 3RXHA 3F9EA 2VNTA 4OS1A 4I8KA 1FMGA 3PMHB 1P9SA 2PTNA 2YNAA 1C5MD 1OWEA 4BAQB 1ZLRA 1LTOA 3SOSA 5FX5A 3E91A 2AIPA 1KTSB 1UTPA 2G4UA 4F4OC 2FLBH 1C1PA 4U2WA 1MZDA 1BDAA 1XKAC 1CHOF 2VB0A 1UO6A 3B23B 2BY5X 1E0FD 2PSYA 4IBLH 1NC6A 3OSYA 5C5NA 4D7GA 1J8AA 5C1XA 1QBNA 1ZSJA 1G9IE 1O32A 1FONA 3QK1A 3GCHB 5HMAA 3M3TA 8GCHF 1BB0B 1OWJA 1TMTH 2P3UB 2G55A 2H9HA 1OXGA 2Z7FE 4K69A 1B0FA 4CHAC 1DM4B 1JXPA 4OGYA 1TRMA 4UE7H 4DT7B 1C2KA 1TGNA 2G51A 2ZWLH 4NIXA 3VB4A 2STAE 1O34A 2H9EH 5LPRA 4GVUA 3AASA 4E06H 1MCTA 4YTAA 1TPAE 2O8LA 3L3TA 4ZKSU 3ZVEA 4B75A 4ZKOU 2OBOA 5DP3A 4E05H 4YO9A 1TX8A 7GCHF 5FCKA 4K5ZA 4ABJA 2GZ8A 4FUCA 1ZRBA 4IGDA 1AUJA 3I78A 3ZZBA 4YLQH 4Z0KA 1V2NT 3AAUA 4NA9H 4CRCA 1EUFA 3S9BA 1WQVH 1GMDF 1O33A 3F6UH 1CBWB 2GV7A 1QHRB 4K1SA 2G4TA 5DPAA 8KME2 1W0ZU 2ZC9H 4Q80A 2DE9A 1ETTH 4AGJA 2ZF0H 2NU2E 4B2BA 3UFAA 8LPRA 4ZXXH 2FOFA 5EQSA 2F9VA 3SV8A 4WXVA 4WMEA 1O3GA 4WJG2 1GI9B 3ZZ8A 1EJAA 4X1RU 4AFSA 5FBIA 1TOCB 1P3EA 3KGPA 2PLXA 1C5ZB 2BQWB 1ELAA 1WOFA 2F9NA 4BTIB 5FXLA 2QAAA 3UR9A 2F9UA 4AOQA 3S0NA 4B74A 1HAVB 1F7ZA 1W7GH 1QB1A 1UVPA 2FODA 5A0CA 1HAOH 2ZHFH 2UWLA 3D62A 3RU4D 1CSOE 2F83A 1ZTJA 2PKAA 5J4QA 2FI3E 2CF8H 2BTCE 4CH2B 1E35B 4HZHA 1HRTH 1SOZA 1O2TA 1QRZA 2BDBA 1BIOA 5FPSA 4ZH8A 5GIBA 1AWFH 4UFFH 3SJ8A 1LVBA 1MAYA 5BRRE 4JYTA 1G36A 3RU4E 1UTNA 1HJ8A 2VH6A 3GISB 1E36B 1HXEH 1GVKB 1N6YA 3M5OA 2Y6TA 3PWCA 4JYVH 4U32A 1C1MA 1C5SA 2O8MA 2BD3A 4JZIA 4GAWA 3BIVH 2Y7XA 1CA8B 1FAXA 3JZ2B 3CENA 3DD2H 2QXIA 1P2KA 3SQEE 1AY6H 2ZPQA 1EOJA 3RXGA 3E16B 1Q2WA 3A7XA 2FIRH 2KAIB 1GI8B 1DX5M 1GMCF 3LKWA 3TNSA 1EP6A 5T6DA 1ZMNA 2XWAA 1L1GA 1V2UT 5AVDA 5DP9A 1TALA 4GHTA 1QR3E 2F91A 4Y8YA 1PQ8A 3R0FA 4I8JA 4XOJA 4D9RA 1LMWB 1ZMJA 2HNTF 1TWXB 2J95A 1BRBE 1N8OC 4ABFA 3LOXA 3A86A 2ZQ1A 2BD9A 3ATWA 1O2WA 2D1JA 3SU5A 1O2RA 3GY6A 1K1PA 1HLTH 1YLDA 1YKTA 3SV6A 1GHBG 3MH7A 3SV2H 2VWLA 5LPEA 2PW8H 3LGIA 1BOQA 2GD4B 1QL9A 4FXGH 2HVXA 1VR1H 1D4PB 1MTNB 3A8DA 1LPGB 1EZUC 1TGBA 2DUCA 4ZHAA 5ESTE 2Y82A 3MHWU 3LPRA 3TLOA 1BTPA 1LKAA 2P94A 3GY3A 1PPBH 1RFNA 2RCEA 4YT7H 3PROA 1O2LA 2WPIS 4OGXA 1KYNA 1XVOA 1EAWA 2BY6X 1DOJA 1PPEE 1A3BH 1ZSLA 2C90B 1AVXA 3ITIA 1KXEA 1GJ7B 1YPKH 2BDYA 2VWMA 4ISNA 3TJVA 1EPTA 3MNCA 1F5KU 4U30A 1W7XH 3STJA 3SV9A 1HDTH 4BTTB 3A7VA 1NT1A 1CT4E 3MU4A 3D23A 2XYAA 2J92A 4AG2A 2GKVE 2QC2A 2WUCA 1JBUH 3U69H 4Y8ZA 1VITH 1WU1A 4MNYA 2FOGA 4IMQA 1C1QA 2FX4A 3LC3A 1V2OT 4DY7B 5E2OA 4X1QU 3T5FH 1H8IH 5H4IB 1EASA 4I31A 4RN6A 3ZYDA 1DY8A 2BVRH 4MPUA 1C2LA 2ZGHA 1GJDB 2P8OC 4UDWH 3QZQA 4NWLA 2SFAA 3QGNB 1TNJA 1UVOA 2ZFSA 1C1SA 2GVFA 4LZ1H 3ZZ9A 3C1KA 3MO6A 2SGDE 1P03A 2Y5HA 1VZQH 1XVMA 3SU0A 3BG4C 1CO7E 3DUXH 1BBRH 2VIVA 3GCOA 3QTVH 4I8GA 4YT6H 4O97A 3H7OA 2CGAA 2IN2A 4Y71A 2VGCB 2QCYA 4JZDH 4IMZA 1C1NA 1D6WA 2Z6BD 3KQDA 3UIRA 2QN5T 1ARBA 4UD9H 2Z9KA 4D7FA 1NFYA 1O30A 1Z6EA 2BD5A 2OINA 2ZU5A 4BANB 1AUTC 3PO1B 3P6ZB 5PTPA 2Y80A 3GICB 4K8BA 1BA8B 2GV6A 5DK1A 5E2PA 3M7UA 1GHAF 1O2SA 3GDUA 5CHAC 1EPTC 4BAMB 2BD4A 2Q1JA 3BTWE 2VIPA 5A8YA 1CQQA 3GYMA 4KGAA 1F5LA 2JH0D 1AGJA 1T8OA 3UREA 2GMTB 1MKXH 3TH4H 1QRWA 5DP8A 1EKBB 4BOHA 1V2ST 3FANA 1BBRE 3OYPA 4AN7A 1EP5A 1TX7A 1YPHE 5ABWA 3A8BA 4X2VA 5C5OA 1HV7A 1MBMA 3GY5A 1LQEA 1SPJA 4DJZB 1WSSH 1THSH 1FAKH 4A1TA 2V0BA 2ZZUH 1A61H 2TBSA 1HJAC 1C5VA 4X8UH 3U8RH 2QGRA 1HAYB 3RXFA 5L30H 1W13U 1HAXB 3FP8E 1EB1H 3HKJB 3T27A 1O5AB 9LPRA 1DE7H 2Q6FA 1QJ7B 2Z9GA 4WH8A 1A0HB 1Y5AT 2OCVB 2FOHA 1SQAA 3KQCA 1DSTA 1A1RA 2IOTA 1VJAU 3RXDA 4ABIA 1NM6A 3TH3H 1OP2A 1ANCA 2OLGA 3L33A 5DP7A 2B9LA 1DWDH 2A4OA 3FZDA 5FPYA 2TGAA 4Y79A 1NU9A 1F2SE 2F9BH 1TQ0B 2VIQA 1TPSA 1FXYA 3M5NA 3U9AH 4O3UA 4AGKA 2VVVA 3MWIU 1UVSH 7GCHG 1FUJA 1QQ4A 2HWLB 1SGRE 1ZPCA 2JH6D 1DSUA 1RD3B 2ALPA 1K9OE 2FOMB 3TNTA 2A5KA 3A81A 3RM0H 3A89A 3MNSA 1P8VC 1Y59T 3I29A 4AB9A 1AE5A 1Q31A 1P12E 3S9CA 1O39A 2BY9X 2STBE 3RXPA 5CMXH 3KL6A 2J9NA 3EAJA 2D26C 1ZTKA 4Y10E 3S69A 3UOUA 2UUJB 4MQAA 4DURA 3UNSA 2CJIA 4JCNA 4YLUA 1AMHA 1O5DH 3PTNA 1FY4A 1GHYH 1SLWB 3KCGH 5TCCA 3E90B 5G4BA 1DWEH 1YCPH 3U8OH 2FLRH 5C20A 1IQIA 1ESTA 2VVUA 5C67A 4JMYA 1P2NA 1O2NA 1GMHF 1UCYK 2QYIA 1MU8B 1BTZA 1NO9H 1H1BA 1RJXB 2F3CE 4WVPE 1ELTA 1GPZA 2FDAA 3HK3B 1SHYA 2QF0A 3PLBA 2EEKA 3IWMA 1O2PA 3BTQE 3OX7U 3A85A 1WUNH 1YGCH 4DCDA 3ATIA 4A1VA 1ELVA 4GCHG 1SG8B 4NIWA 2AIQA 3U1IB 2AYWA 3SHAH 3T29A 1V6DA 2BXTH 1KIGH 1TAWA 3C27B 2C8XB 2V6NA 4I7YH 1F0UA 2G00A 4DIHH 4E7RG 1V2MT 1JOUB 2IPHA 2XWBI 4GHQA 2BD2A 3LT3A 1V2KT 1O2UA 1CHGA 1W10U 1BTWA 1T7CA 1MU6B 3MNBA 1TNHA 2SGAA 2A31A 4LZ4B 2BMGB 4AYYB 3ZYEA 1BRUP 1SGEE 2O9QA 1IOEA 3KNXA 3LGWA 4WMFA 3FAOA 1QGFA 2R0KA 3LH1A 4MNWA 3VGCC 3ZV9A 3LGUA 3SHCH 3MH6A 3RC4A 1AB9B 3RXQA 2OC0A 3GYLB 1AKSB 1VCPA 5GPIB 4ABAA 1O2MA 2HPPH 4RKJB 4WWYA 2AMPA 5JYIA 1MKWK 3ATMA 3A7YA 3BTTE 2A0QB 3RUOA 2B5TB 2QXJA 2TGPZ 1TMUH 1RIWC 1FY5A 1NFUA 3SUGA 2ZU3A 2ODYB 3A7TA 5C2ZA 1KXAA 1F5RA 5FHTA 2BD8A 1BMLA 4YESB 1UTLM 5IYTA 3SGQE 1L1JA 4CH8B 3ZVAA 4ZKRU 1PQ7A 1TRYA 2R0LA 2P93A 3CP7A 1CA0B 2Z9LA 3V12A 3ZZ6A 2CHAC 1T31A 4Y76A 5C1YA 3BTDE 4I32A 3K9XB 1AFQB 2FPZA 3UNQA 3STIA 5EQQA 4WMDA 1PJPA 1C1RA 1X7AC 4Y7AA 3ZVDA 4X6OA 2BLWA 1TNKA 1JRTA 1FZZA 1O38A 1UK4A 1GBLA 1SGDE 2W5EA 5EOKA 1ANEA 3P8GA 1C2FA 4M7GA 1ACBE 3O8DA 1C5XB 2BLQA 3B9FH 1O36A 2LNCA 1C1OA 3Q76A 5DGJA 5EODA 2NU3E 1LVMA 5AF9H 3NPSA 3SJOA 1LHGH 3TH2H 1ZJKA 1Z6JH 3M5LA 1C2DA 3M5MA 3GCTF 1YPGH 2FS9A 5GDSH 3A8CA 2PFEA 2FEQH 1O3NA 2OQUA 1D9IA 1OSSA 2XC0A 1TYNA 1DT2A 1Y5UT 3LGYA 1N6XA 5DJ7A 2XXLA 2Z9JA 3NKKA 5JB9S 2XC4A 3NUMA 4TPIZ 4TY6A 1UVTH 3BEFB 7ESTE 4YZUA 1VCWA 4K2YA 3K65B 4ZUHA 3D65E 2A45B 3ZZCA 1RS0A 4DIIH 6CHAC 4HTCH 1QL7A 2P3FH 1W0YH 3A7ZA 3BG8A 2GP9B 1EX3A 2VINA 5EG4A 1GI4A 1ZHRA 2C8ZB 2ESTE 2PKSC 4FUEA 4BXWA 2HRVA 1ARCA 2ZPRA 1ZPZA 3ATKA 1SC8U 4ZROA 4XSKU 2PV9B 8ESTE 2GZ9A 3PMBB 1WTHD 3S9AA 1W8BH 5GCHF 1G2MA 2ZTXA 5A8ZA 2JETC 3RXBA 1GCTB 1TMBH 4VGCB 1AQ7A 2A4GA 1F92A 1GHAG 4TY7A 2ZG0H 1A4WH 4MNXA 1S0RA 1GDNA 3FZZA 1S82A 5F6MA 3ESTA 3FFGA 1QQUA 3VEQB 4RKOB 2P3TB 4F49A 2XBWA 2A4QA 2J94A 1MH0A 1KDQB 1RTLA 4A92A 5HM2A 4MPXA 1K22H 3SNBA 2BM2A 3HK6B 1OWIA 1QBVH 3BN9A 4H6SB 1BCUH 4OS5A 1PPGE 1MQ5A 4NA7A 5DG6A 3UR6A 2ZECA 2A5AA 4AFUA 1UK2A 3K2UA 1DITH 2RA3A 1HB0B 4ZKNU 1GG6C 4A1XA 1O5BB 1UHBA 5JBBS 2TPIZ 2H9TH 3KQBA 2PWXA 3SI3H 5E8EH 5A0AE 2GDEH 4ABBA 1LHDH 2QY0B 1AD8H 1LHFH 3QWCH 4MLFB 1BTHH 2ZEBA 3E1XB 4FUDA 5F8XA 2BYAX 4UONA 4OS7A 3OY6U 3RLWH 5EQRA 1TABE 2HGTH 3RXKA 4CRFA 1SLUB 4MPWA 1YYY1 2Z3DA 4ABEA 1EAUA 1WQSA 1J15A 1MBQA 4DG4A 1ETSH 1C9PA 2PUXB 3N7OA 3RC5A 1GBTA 1THRH 1BJUA 2EC9H 2ZDKA 1C5UA 2J38A 1PPHE 2ZU2A 2GX4A 1GCDA 4KP0A 2V3HH 1O2GH 1SGPE 1BTUA 1TNIA 1DLKB 2OBQA 2OP9A 5J4SA 3BV9B 3LGTA 4INLA 1OP8A 1O31A 1EZXC 1HXFH 4AFZA 2C4FH 2ZDAH 3EDXB 1GJ4H 1XUGA 3FP6E 4O3TA 3LDXH 1P2IA 3K6ZA 3LJOA 4CHAB 1QNJA 1D3QB 4LK4A 3MH4A 1AZZA 1DWBH 4Q7YA 1J17T 1HJ9A 3A82A 4H4FA 4O03A 4TWWA 3SGBE 5C1UA 5I25A 1Y3XA 1GBHA 3FP7E 3T28A 1GDQA 1C1VH 5JPMH 4Y0YE 1YPEH 1C5NH 1O2XA 1MCVA 1MZAA 1TNLA 1TGCA 7KMEH 1TIOA 2ZI2H 1C1UH 2ANKH 4FU8A 1G3BA 1Y3WA 1O35A 1LDTT 4TWYA 1S85A 1O3OA 3GDSA 1PPCE 3A8AA 5JDUB 1ABIH 2B8OH 3P92A 2FOCA 2P16A 1TGSZ 2FTMA 3NWUA 3SU2A 1ELFA 1O5FH 3RXCA 3RU4T 4DW2U 5JBCS 2ZO3H 3SV7A 2FYQA 1SQOA 2AH4X 1UK3A 3GCNA 1WTGH 1ZHMA 3M7QA 3HKIB 1LCYA 5EGMA 1WBGB 2FZZA 1SR5C 1HYLA 4NIYA 2A5IA 2GCTC 1NZQH 4D8NA 3URDA 3SNCA 3ZVFA 1L4ZA 1HCGA 1GI0A 5DKMA 1QA7A 2Q6DA 1BITA 4KTCA 1GI1A 1MTWA 2ZPSA 3ZV8A 4BTUB 1SGFG 1NRSH 3TITA 2VWNA 5LPFA 1SMFE 4X8VH 5T3HA 1K1IA 2XCNA 1DDJA 1HGTH 2GDDA 1MD7A 1CT2E 3MOCA 4AZ2B 2Y5FA 1GBFA 2ZFPH 1HBTH 2P59A 2XW9A 3KN2A 3QDZB 2G81E 1K21H 1IQMA 4OS2A 3TIUA 1BHXB 1JMOH 3E8LA 1XM1A 1GJ9B 3UWJH 1J14A 2C93B 2OC7A 1T8NA 1KTTB 1KXFA 1O2VA 1FY8E 6GCHG 1GBBA 1O2OA 1XUFA 1FN6A 2C8YB 1GBIA 1C2EA 1QA0A 1P0SH 1TA6A 4OS6A 2VU8E 1BBRK 1TRNA 1RRKA 1HPGA 1L1NA 4ISOA 1F0TA 4IS5A 4Z6AH 3P8NA 4NFEA 1Y3YA 1P10A 2PGQB 1HAGE 1LVOA 4ABHA 4AB8A 1V2QT 2AFQB 1C5QA 3K6YA 1WAYB 1RXPA 1Y5BT 2BDCA 3GY7A 2G52A 1KY9A 5GXPA 1P09A 3QGJA 1G37A 1P06A 3QZRA 4Y7BA 3RMLH 2WV5A 4ZXYH 1QIXB 2PR3A 3VPKA 1Y3VA 1BT7A 2SNWA 4JK6A 2ZA5A 1K1NA 1N8OB 1SGIB 2TGTA 3BEIB 2BLOA 3SJ9A 3RXOA 4KKDA 1UTKA 4O9VA 5AHGH 2WYJA 1D3TB
chains in the Genus database with same CATH superfamily
1PQ5A 1SHHB 2J98A 1CGHA 4DGJA 4KELA 1SOTA 4R0IA 4FUIA 1MKXK 3P8OA 2A32A 2VIWA 1GI2A 1GJBB 3CS0A 5HM9A 3SN8A 1G32B 1TPPA 2AMDA 4JZEH 1THPB 1MD8A 1H8DH 2EI8A 1P2OA 1CE5A 3SU1A 2PP6A 1YBWA 2ODPA 4NZLA 4CR5A 2V3MA 3QLPH 1ZGIA 2PUQH 3TK6A 1Z8JB 2PKAB 1CHOG 4ESTE 1QL8A 2W6ID 2WPHS 1T4VH 3GY2A 1HIAA 2PTCE 3EQ0H 4THNH 4Y11E 4NCYA 4YOJA 1BTYA 1BHXF 1IHSH 1XUHA 3EYDA 2HPQH 2AERH 1MAXA 3MU1A 5FCRA 3SW2B 8GCHG 1XXFA 4YM9A 3ZZDA 4JYUH 3MU5A 5LH8A 3UUZA 4BNRA 1C5PA 1L2EA 3RMNH 1YLCA 3OTJE 1W3CA 1HNEE 2ZDVH 3RXUA 1BQYA 2FM2A 1IQLA 3AVZA 4I86A 4K1EA 5AFYH 4Q7ZA 1BMMH 4I8HA 1DXWA 4Q2KA 4FVDA 1ELEE 1YCPM 1ZZZA 3HPTB 2WPLS 1ZR0A 5IDKA 3QX5H 1RGQA 5GCHG 4IW4E 1GHVH 5EW2H 2P8OB 3D49H 5E0HA 2BDGA 4K60A 4CRDA 1SL3A 1F0RA 4CR9A 1IQHA 3DA9B 1GBMA 1GJCB 4XBCA 2AGGX 3Q77A 1E1RD 1DWCH 2JDID 1E37B 5EXMA 2UUFB 2FI5E 3BG4B 5DP4A 2W3KA 1CVWH 1GMDG 3ZZ3A 1C5TA 3TJOA 3A7WA 3DSPA 1S0QA 3ZZ5A 1P11E 1VGCC 2ZCKP 1C1WH 3RXSA 4X8TH 3N7EA 3LGVA 2I6QA 1FY3A 2ZU1A 3F9HA 3V3MA 1C4V2 2CV3A 3HGNA 2OC8A 1WCZA 1V2LT 5DO4H 3TGJE 3BTHE 1IHTH 4TT3D 4PROA 3E6PH 2WYGA 4R8TB 5EU8A 3TK5A 1C2IA 3ZZAA 1SI5H 4SGAE 5T1VA 1GJ6A 3ZIAD 2PSXA 3SI4H 1H9IE 1O3FA 5CHAB 1EPTB 3T26A 1FPCH 4UFDH 1NU7B 5EW1H 2XC5A 3ODDA 3TGIE 4B71A 2ULLA 2HALA 3VB5A 1NRRH 1CGJE 2ZDMA 5T6GA 1NRQH 1Z8RA 1AI8H 3AW0A 1NFXA 2ANMH 3E0PB 1C4U2 1VJ9U 2EQNA 4DVAU 3MI4A 1G3DA 1BTXA 2HOBA 3L6PA 3M7TA 5F03A 4B1TA 1IQNA 2BY7X 1Z7KA 2CN0H 1MUEB 2OTVA 1BRCE 1YLNA 2FYRA 3KQEA 4AG1A 4FUHA 1HJAB 3WY8A 3PM3A 4X6NA 1IQGA 3TJNA 5C94A 2R2MB 2P95A 1KLIH 1QB6A 2G5NA 3F1SB 4BXSA 2FMJA 1EJNA 3OEED 1V2VT 1D6RA 3F9FA 1GMCG 2GT7A 1SQRA 2BOKA 1U6QA 2UUKB 2FP7B 1H9LB 1O2KA 4P00A 3A88A 1B0EA 2WZQA 5B6LA 1EAIA 3IG6B 3PLPA 2EA3A 2UUYA 1L4DA 1HAVA 1ABJH 1LHCH 2YMSB 3GCHC 1LQDB 5C3NA 3BIUH 3PRDA 2CF9H 4WF8A 3RP2A 5HIZA 1K28D 2IJOB 3EA8A 1AZ8A 1TOMH 1E34B 1BUIA 3LU9B 2AEIH 2K1QA 3SZNA 1NBME 3LONA 3KIDU 1K1MA 4KTUA 2BQ7B 6ESTA 2ANYA 4NSYA 1GI6A 2C3SA 2A7HA 1DUEA 4X2WA 1ZPBA 3VG8A 4XBDA 2C8WB 2BX4A 1KXBA 1S6HA 3U98H 1GBEA 2RDEA 1W2KH 3RMOH 2QXHA 2WPDD 1IAUA 1XMNB 3Q3YA 3SJKA 3RXVA 3DFJA 3SU6A 1TA2A 2FWWA 1C4Y2 4B73A 2PHBA 4D9QA 1DXPA 2KAIA 1IQKA 5DP5A 1A5GH 2GT8A 1NN6A 1CBWC 1O5GH 1ELBA 4LOYH 4FOUC 2FO9A 1ID5H 4BAKB 1V2RT 4NZQA 1DY9A 2ZCHP 2OUAA 1YPLH 4MVNA 1QRXA 3MO9A 1JRSA 1D3DB 2HNTC 3SORA 3ENSB 1QZ8A 1H8HD 1SLVB 2R3UA 2VVCA 4X1SU 5DSFA 1KXCA 2W7SA 4B2CA 1UTOA 5FX6A 5AFZH 3E0NB 1B5GH 2ZKSA 3B8JA 2M2AA 3RXMA 1HAHH 1WV7H 2A4RA 4HI3A 5A0BA 3UQVA 3DSGA 3HGPA 1PYTC 3RDZA 1MQ6A 4FUBA 2JIZD 1T32A 1ZHPA 3FN8A 3F9GA 1EATA 1PPFE 1LO6A 1BRAA 2Z3CA 1TB6H 1SLXB 3V0XA 2J34A 1NRNH 3NK8A 2YMSD 4IC5A 2BLVA 2WPMS 2SNVA 3EA9A 3P17H 1TGTA 4NA8A 3FKSD 1A3EH 2O8WA 2BD7A 4GUXA 3QUMP 2JJ2D 3P70B 1AN1E 3VGCB 1T4UH 2SGEE 3FVFB 3T2NA 1O3JA 1S83A 1GGDB 3PTBA 1TX6A 1O3MA 2VBCA 3SUEA 1OYTH 3V7TA 5EPNA 3IITA 3VXFH 2ZGXH 3SU4A 2D8WA 4XBBA 5E0GA 2BY8X 2F43B 2VJ1A 1ANDA 2VIOA 4ISHH 1G3CA 3I77A 1FLEE 1RIWB 2WUBA 1ELCA 3DCLA 5HGGA 1AIXH 3QO6A 3SU3A 1DPOA 3LH3A 3DFLA 2CXVA 1MTUA 1EB2A 3KF2A 5ESBA 3MFJA 1J16A 2XNIA 4ZHLU 1ELGA 2QA9E 2R3YA 2FI4E 5K0HA 1EZSC 1FN8A 4ISIH 2Z94A 3EGKH 4U01A 2BHGA 1LPKB 1C1TA 1KXDA 1QJ1B 2CHAB 4I33A 2NWNA 2OQ5A 1GJAB 1S5SA 4K1TA 3W95A 2NU4E 3S7HB 4FU7A 5JBAS 1ESAA 4MG3A 2QF3A 1INCA 1MTNC 3LJJA 1YPHC 2ZNKH 2J2UA 1S84A 1FV9A 2ZHDA 2ILNA 2M5TA 4XFQA 3ODFA 4H42U 1Z8GA 1DS2E 2W7UA 2BB4A 1TFXA 2FOEA 3ZVGA 1WYKA 3A80A 3VB3A 1MABB 4B6EA 4K8YA 1ZTLA 3Q3XA 1PFXC 2SGPE 1O3CA 3BTFE 1TBQH 2H5CA 1QTFA 3DT0H 1P05A 4Q7XA 2OD3B 2AHME 5ETXA 5IK2D 1TONA 1GBDA 1NFWA 4HFPB 5JB8S 1YY3A 4FUFA 4QT8C 4GPGA 2QV1A 3UPEA 1F0SA 1T8LA 1LHEH 2J4IA 2BQ6B 1O2JA 2BZ6H 1HAPH 1Z1JA 6CHAB 3W1EA 4ZMAH 2TIOA 1XX9A 2B7DH 2WINI 1ZGVA 4GCHF 3SBKA 5FPTA 3RXAA 2BDHA 2JH5D 1QY6A 2PKSB 3P95A 1A0LA 3UOPA 1GBCA 2F9OA 1K2I1 1O3BA 2EI7A 4AFQA 3LC5A 2VWOA 4MTBA 1BMAA 1DICA 1XUJA 1JIMA 3PWBA 2JETB 3JZ1B 1W12U 5BPEA 5SGAE 1QB9A 1M9UA 1XUIA 1OX1A 1GBAA 2FOBA 4IC6A 1PQAA 2Q6GA 3VXEH 3RC6A 2GCHF 2TGDA 3BTGE 1GMHG 1CT0E 1LVYA 2W3IA 1QBOA 5A09A 2VGCC 1ESBA 3O8BA 3HATH 1SFIA 1B7XB 3ZZ7A 2I6SA 4WH6A 1O3KA 1NY22 1FIWA 1UMAH 1C2JA 3AW1A 1N1LA 1CGIE 4ZHMU 1EAXA 3MU8A 1QURH 4MDSA 1ELDE 2G5VA 3PO1C 1SGFA 4B2AA 3UQOA 3TJUA 1OWHA 3ZVCA 1TQ7B 3MYWA 2A7CA 5A8XA 1FNIA 4CRBA 1GG6B 3R3GB 5L2ZH 1MTSA 3TVJB 2R9PA 2XBXA 2ZHWH 2GMTC 4TYDA 1BZXE 2F9PA 1O2ZA 2ZDNA 4B76A 1J9CH 1C9TA 5TCAA 1PYTD 4BAOB 1BMNH 1TBZH 2BVXH 4YOGA 1P2QA 5FBEA 3GOVB 1Y8TA 5EJLA 1VITF 2A2XH 1H8ED 4FUJA 2V3OH 3U8TH 2HNTE 4NFFA 3VFEA 1C5YB 1GBJA 3SNEA 1A7SA 1FY1A 5DP6A 5EXLA 4X1PU 2A1DB 5TJXA 3MNXA 3KHVA 3VB7A 2WHXA 5GJ4B 4FU9A 3EE7A 1KSNA 4KTSA 4MPVA 3O8RA 1E79D 2A7JA 3GDVA 2ZIQH 4E7NA 3A87A 3NCLA 2H5DA 3O8CA 1OHHD 1JIRA 2QXGA 1C2GA 3H5CB 1SFQB 1K1OA 1C5OH 1SB1H 3M3VA 3F0PA 3RLYH 1FDPA 1AE8H 1GI7B 2WPJS 4NG9H 2XCFA 1O3AA 1O3LA 1H9HE 2V35A 1O3HA 1NTPA 1OYQA 3RM2H 4AYVB 1ZOMA 3M61U 3SNAA 1TLDA 1GJ8B 2SGFE 5JBTA 1DVAH 1O3PB 3RXLA 1LPZB 1P2MA 1C5WB 4ABDA 2Y81A 2UWPA 3RXEA 3Q00A 5EJZA 4CRGA 2BDAA 3PV4A 1O37A 2A2QH 4RSPA 4ISLA 3QN7A 2GGVB 1XUKA 3T62A 4CREA 4TPYA 1H4WA 1XKBC 1G2LA 2ALVA 3URCA 4NSVA 1O3DA 3UY9A 1UHBB 2XBYA 2YNBA 1AKSA 2WPKS 1AHTH 4H6TA 1G30B 3MMGA 2ZFRH 3SJIA 1EXFA 1HAZB 3NZIA 1GHZA 2ZTYA 4NIVA 1GL0E 1BJVA 1OP0A 1LKBA 1NPMA 4AC9A 4SGBE 3UNRA 2LPRA 4DT4A 1P01A 2B0FA 3PB1E 5KECA 3BTKE 3GCTG 4YOIA 5HYOA 6LPRA 1A46H 2GCTB 2HLDD 4FUGA 3U1JB 1W14U 2W26A 2BVSH 3A83A 1PPZA 4X6PA 4JK5A 1OPHB 1TBRH 4AX9H 1QJ6B 4J1YA 1AVGH 1RTFB 3M37A 1Z1IA 1A0JA 2R2WU 4CRAA 3VB6A 3ZVBA 3N7DA 1D3PB 1UTJA 3BEUA 4NGAH 3SO3A 1GVZA 2BZAA 3KEEA 1YC0A 1OS8A 5FAHA 1P9UA 2FTLE 3RXTA 4X2XA 4IN2A 5C17A 4IN1A 1JWTA 1UTMA 2ANWA 1GDUA 2O8UA 5I46H 2D2DA 3SGAE 2Y7ZA 4DOQA 1O3IA 5EXNA 3G01A 9ESTA 4GLYA 3DHKH 3SUDA 1EJMA 1KLJH 1OOKB 1V2WT 3PMAB 3M36A 1C2HA 4HGCA 3PMJA 1A5HA 5F8TA 1DFPA 4Y0ZE 1NRPH 1AFEH 1UTQA 3F68H 1COWD 1FJSA 3A84A 2BDIA 2FX6A 4UFGH 3GY8A 1OWDA 3QTOH 3SUFA 5A2MH 1C5LH 2NU0E 3SQHE 5F53A 2WV9A 3RXJA 2ZDLA 2ODQA 1AB9C 4MNVA 1OWKA 2VH0A 4A7IB 1G3EA 2YOLA 1ZSKA 1BMFD 1V2PT 3MU0A 1QFKH 4X8SH 1O5EH 3BTEE 1ZMLA 5K7RA 1L0ZA 1EOLA 5T6FA 1YCPK 1IQFA 2ZFQH 4Q4LA 2XBVA 3E3TA 3RXIA 1UVUH 3SNDA 3NXPA 1IQEA 4ASHA 2ZHEH 2FXRA 1SGNE 3LIWA 1AO5A 3UWIA 1TPOA 2G8TA 5HXFA 2QE7D 3F2FA 3EA7A 1DUAA 3P8FA 1FI8A 2XTTB 1DLEA 5GWZA 3M35A 2BXUH 1C5RA 1GI3A 1C2MA 5LGOA 3TPIZ 1GHWH 3MH5A 1GHXH 1CU1A 1CA0C 1HFDA 2FOAA 3S7KB 1NS3A 4ABGA 1SVPA 4X6MA 1GBKA 3RXRA 1T8MA 1AFQC 4AORA 1YF4A 2UWOA 2QIQA 2QF5A 1Z71A 2IPQX 2RA0A 1K1JA 1P2JA 2CMYA 2VIDA 2ZGJA 4X1NU 4J2YB 3W94A 4I8LA 1KLTA 1S81A 1KDQA 1P3CA 7LPRA 1GHBF 1ANBA 2O8TA 5L6NH 1UCYH 2FESH 3UAIC 3AAVA 5HKKD 4A6LA 3TU7H 4P02A 2Z9IA 4LXBH 3T25A 1Z8IB 2ASUB 2Y5GA 3KYGA 5CE1A 4ASUD 1UJ1A 2SGQE 3PV5A 1EZQA 3SZEA 1A2CH 4D76A 4XRNA 5KGOA 1VCQA 1NBMD 2OC1A 1YPMH 1O3EA 1XXDA 2GZ7A 4BAHB 1P04A 2K8IA 2PGBB 3PYHA 1GWAA 1SQTA 1GVLA 5EPYA 3PLKA 3H7TA 5HIYA 1Y3UA 4ZAEA 3V13A 2ZCLP 4UEHH 1RTKA 4CBNA 2GCHG 4INKA 3OU0A 1SBWA 3ELAH 4K3JA 1UCYE 1MTVA 2H6MA 2H2ZA 1ORFA 3WWBA 1GI5A 2H1UA 3UTUH 1SGYE 2AS9A 2NU1E 2Z3EA 5E0JA 3MTYA 1O2IA 3TK9A 2JKHA 3OFND 1P02A 5B6OA 2J98B 4Y6DA 3KYFA 3MO3A 2DE8A 2GTBA 2HLCA 2RG3A 1O0DH 1GGDC 2EI6A 3ZZ4A 1FPHH 1VGCB 1QCPA 2BOHB 2J97A 2ZQ2A 1FQ3A 4UFEH 1P57B 2ZFFH 2AMQA 1GCTC 2XRCA 3F2HA 4JZ1A 4VGCC 3U28C 4XE4A 2ZP0H 2ZTZA 6GCHF 1AU8A 1AVWA 1O2QA 1ETRH 1SGQE 1YPJH 1O2YA 2KCOA 1MKWH 2OXSA 2ZGCA 1Q3XA 4XDEA 1E38B 5F8ZA 1MMJN 1OKXA 4NWKA 4ACAA 4CBOA 4GSOA 3BF6H 2AGIX 1EQ9A 4WXIA 4A5TS 5L2YH 1HIAB 1NROH 3UB0A 2ZGBH 4X2YA 3EE0B 1NESE 3CS7A 1VKYA 4OS4A 1ZYOA 2ZHQH 1AWHB 1YP9A 1O2HA 1IQJA 4WY3A 1V2TT 1ZRKA 1YM0A 1VITG 3M3SA 1HAIH 3RMMH 2AGEX 4Y8XA 3ATLA 1FIZA 2BX3A 1DANH 1V2JT 3GY4A 1V3XA 3BTME 1ZJDA 2TRMA 1W11U 1SSXA 4INHA 1GJ5H 1HUTH 4FVBA 1TE0A 3Q3KA 3OY5U 2THFB 1K1LA 2ZFTA 1A5IA 2RDLA 2ZU4A 1S6FA 4JZFH 2FS8A 1TNGA 2WV4A 1SGTA 1SGCA 1O5CB 1GL1A 3BSQA 3TGKE 4X0WU 3RXHA 3F9EA 2VNTA 4OS1A 4I8KA 1FMGA 3PMHB 1P9SA 2PTNA 2YNAA 1C5MD 1OWEA 4BAQB 1ZLRA 1LTOA 3SOSA 5FX5A 3E91A 2AIPA 1KTSB 1UTPA 2G4UA 4F4OC 2FLBH 1C1PA 4U2WA 1MZDA 2KCAA 1BDAA 1XKAC 1CHOF 2VB0A 1UO6A 3MQKC 3B23B 2BY5X 1E0FD 2PSYA 4IBLH 1NC6A 3OSYA 5C5NA 4D7GA 1J8AA 5C1XA 1QBNA 1ZSJA 1G9IE 1O32A 1FONA 3QK1A 3GCHB 5HMAA 3M3TA 8GCHF 1BB0B 1OWJA 1TMTH 2P3UB 2G55A 2H9HA 1OXGA 2Z7FE 1EFRD 4K69A 1B0FA 4CHAC 1DM4B 1JXPA 4OGYA 1TRMA 4UE7H 4DT7B 1C2KA 1TGNA 2G51A 2ZWLH 4NIXA 3VB4A 2STAE 1O34A 1S6LA 2H9EH 5LPRA 4GVUA 3AASA 4E06H 1MCTA 4YTAA 1TPAE 2O8LA 3L3TA 4ZKSU 3ZVEA 4B75A 5CDFE 4ZKOU 2OBOA 5DP3A 4E05H 4YO9A 1TX8A 3N99A 7GCHF 3OEHD 5FCKA 4K5ZA 4ABJA 2GZ8A 4FUCA 1ZRBA 4IGDA 1AUJA 3I78A 3ZZBA 4YLQH 4Z0KA 1V2NT 3AAUA 4NA9H 4CRCA 1EUFA 3S9BA 1WQVH 1GMDF 1O33A 3F6UH 1CBWB 2GV7A 1QHRB 4K1SA 2G4TA 5DPAA 8KME2 1W0ZU 2ZC9H 4Q80A 2GJGA 2DE9A 1ETTH 4AGJA 2ZF0H 2NU2E 4B2BA 3UFAA 8LPRA 4ZXXH 2FOFA 5EQSA 2F9VA 3SV8A 4WXVA 4WMEA 1O3GA 4WJG2 1GI9B 3ZZ8A 1EJAA 4X1RU 4AFSA 1FX0B 5FBIA 1TOCB 1P3EA 3KGPA 2PLXA 1C5ZB 2BQWB 1ELAA 1WOFA 2F9NA 4BTIB 5FXLA 2QAAA 3UR9A 2F9UA 2V7QD 4AOQA 3S0NA 4B74A 1HAVB 1F7ZA 1W7GH 1QB1A 1UVPA 2FODA 5A0CA 1HAOH 2ZHFH 2UWLA 3D62A 3RU4D 2KCYA 1CSOE 2F83A 1ZTJA 2PKAA 5J4QA 2FI3E 2CF8H 2BTCE 3KQ5A 4CH2B 1E35B 4HZHA 1HRTH 1SOZA 1O2TA 1QRZA 2BDBA 1BIOA 5FPSA 2JJ1D 4ZH8A 5GIBA 1AWFH 4UFFH 3SJ8A 1LVBA 1MAYA 5BRRE 4JYTA 1G36A 2KX4A 3RU4E 1UTNA 1HJ8A 2VH6A 3GISB 1E36B 1HXEH 1GVKB 1N6YA 3M5OA 2Y6TA 3PWCA 3F3BA 4JYVH 4U32A 1C1MA 1C5SA 2O8MA 2BD3A 4JZIA 4GAWA 3BIVH 2Y7XA 1CA8B 4RT0A 1FAXA 3JZ2B 3CENA 3DD2H 2QXIA 1P2KA 3SQEE 1AY6H 2ZPQA 1EOJA 3RXGA 3E16B 1Q2WA 4OM9A 3A7XA 2FIRH 2KAIB 1GI8B 1DX5M 1GMCF 3LKWA 3TNSA 1EP6A 5T6DA 1ZMNA 2XWAA 1L1GA 1V2UT 5AVDA 5DP9A 1TALA 4GHTA 1QR3E 2F91A 4Y8YA 2L74A 1PQ8A 3R0FA 4I8JA 2KR7A 4XOJA 4D9RA 1LMWB 1ZMJA 2HNTF 1TWXB 2J95A 1BRBE 1N8OC 4ABFA 3LOXA 3A86A 2ZQ1A 3WWFA 2BD9A 3ATWA 3FO8D 1O2WA 2D1JA 3SU5A 1O2RA 3GY6A 1K1PA 1HLTH 1YLDA 1YKTA 3SV6A 1GHBG 3MH7A 3SV2H 2VWLA 5LPEA 2PW8H 3LGIA 1BOQA 2GD4B 1QL9A 4FXGH 2HVXA 1VR1H 1D4PB 1MTNB 3A8DA 1LPGB 1EZUC 1TGBA 2DUCA 4ZHAA 5ESTE 2Y82A 3MHWU 3LPRA 3TLOA 1BTPA 1LKAA 2P94A 3F0OA 3GY3A 1PPBH 1RFNA 2RCEA 4YT7H 3PROA 1O2LA 2WPIS 4OGXA 1KYNA 1XVOA 1EAWA 2BY6X 1DOJA 1PPEE 1A3BH 1ZSLA 2C90B 1AVXA 3ITIA 1KXEA 1GJ7B 1YPKH 2BDYA 2VWMA 4ISNA 3TJVA 1EPTA 3MNCA 1F5KU 2EY4C 4U30A 1W7XH 3STJA 3SV9A 1HDTH 4BTTB 3A7VA 1NT1A 1CT4E 3MU4A 3D23A 2XYAA 2J92A 4AG2A 2GKVE 2QC2A 2WUCA 1JBUH 3U69H 4Y8ZA 1VITH 5FL7D 1WU1A 4MNYA 2FOGA 4IMQA 2OK5A 1C1QA 2FX4A 3LC3A 1V2OT 4DY7B 5E2OA 4X1QU 3T5FH 1H8IH 5H4IB 1EASA 4I31A 4RN6A 3ZYDA 1DY8A 5KEDA 2BVRH 4MPUA 1C2LA 2ZGHA 1GJDB 2P8OC 3NRLA 4UDWH 3QZQA 4NWLA 2SFAA 3QGNB 1TNJA 1UVOA 2ZFSA 1C1SA 2GVFA 4LZ1H 1SKYE 3ZZ9A 3C1KA 3MO6A 2SGDE 1P03A 3SYJA 2QF4A 2Y5HA 1VZQH 1XVMA 3SU0A 3BG4C 1CO7E 3DUXH 1BBRH 2VIVA 3GCOA 3QTVH 4Z1MD 4I8GA 4YT6H 4O97A 3H7OA 2CGAA 2IN2A 4Y71A 2VGCB 2QCYA 4JZDH 2KCPA 4IMZA 1C1NA 1D6WA 2Z6BD 3KQDA 3UIRA 2QN5T 1ARBA 4UD9H 2Z9KA 4D7FA 1NFYA 1O30A 1Z6EA 2BD5A 2OINA 2ZU5A 4BANB 1AUTC 3PO1B 3P6ZB 5PTPA 2Y80A 3GICB 4K8BA 1BA8B 2GV6A 5DK1A 5E2PA 3M7UA 1GHAF 1O2SA 3GDUA 5CHAC 1EPTC 4BAMB 2BD4A 2Q1JA 3BTWE 2VIPA 5A8YA 1CQQA 3GYMA 4KGAA 1F5LA 2JH0D 1AGJA 1T8OA 3UREA 2GMTB 1MKXH 3TH4H 1QRWA 5DP8A 1EKBB 4BOHA 1V2ST 3FANA 1BBRE 3OYPA 4AN7A 1EP5A 4B6FA 3WW7A 1TX7A 1YPHE 5ABWA 3A8BA 4X2VA 2L6OA 2XNDD 1HV7A 1MBMA 3GY5A 5C5OA 1LQEA 1SPJA 4DJZB 1WSSH 1THSH 1FAKH 4A1TA 2V0BA 2ZZUH 1A61H 2TBSA 1HJAC 1C5VA 4X8UH 3U8RH 2QGRA 1HAYB 3RXFA 5L30H 1W13U 1HAXB 3FP8E 1EB1H 3HKJB 3T27A 1O5AB 2RFKC 9LPRA 1DE7H 2Q6FA 1QJ7B 2Z9GA 4WH8A 1A0HB 1Y5AT 2OCVB 2FOHA 1SQAA 3KQCA 1DSTA 1A1RA 3GS9A 2IOTA 1VJAU 3RXDA 4ABIA 1NM6A 3TH3H 1OP2A 1ANCA 2OLGA 3L33A 5DP7A 2B9LA 1DWDH 2A4OA 3FZDA 5FPYA 2TGAA 4Y79A 1NU9A 1F2SE 2F9BH 1TQ0B 2VIQA 1TPSA 2YMSC 1FXYA 3M5NA 3U9AH 4O3UA 1K0HA 4AGKA 2VVVA 3MWIU 1UVSH 7GCHG 1FUJA 1QQ4A 2HWLB 1SGRE 1ZPCA 2JH6D 2KM0A 1DSUA 1RD3B 2ALPA 1K9OE 2FOMB 3TNTA 2A5KA 3A81A 3RM0H 3A89A 3MNSA 1P8VC 1Y59T 3I29A 4AB9A 1AE5A 1Q31A 1P12E 3S9CA 1O39A 2KFWA 2BY9X 3AK5A 2STBE 3RXPA 5CMXH 3KL6A 2J9NA 4FETA 3EAJA 2D26C 1ZTKA 4Y10E 3S69A 3UOUA 2UUJB 4MQAA 4DURA 3UNSA 1KMHB 2CJIA 4JCNA 4YLUA 1AMHA 1O5DH 3PTNA 1FY4A 1GHYH 1SLWB 3KCGH 5TCCA 3E90B 4F48B 5G4BA 1DWEH 1YCPH 3U8OH 2FLRH 3PRBA 5C20A 1IQIA 1ESTA 2VVUA 5C67A 4JMYA 1P2NA 5C0TA 2F4LA 1O2NA 1GMHF 1UCYK 2QYIA 1MU8B 1BTZA 1NO9H 1H1BA 1RJXB 2F3CE 4WVPE 1ELTA 1GPZA 2FDAA 3HK3B 1SHYA 2QF0A 1UW7A 3PLBA 2EEKA 3IWMA 1O2PA 3BTQE 3OX7U 3A85A 1WUNH 1YGCH 4DCDA 3ATIA 4A1VA 1ELVA 4GCHG 1SG8B 4NIWA 2AIQA 3U1IB 2AYWA 3SHAH 3T29A 1V6DA 2BXTH 1KIGH 1TAWA 3C27B 2C8XB 2V6NA 4I7YH 1F0UA 2G00A 4DIHH 4E7RG 1V2MT 1JOUB 2IPHA 2XWBI 4GHQA 2BD2A 3FOAA 3LT3A 1V2KT 1O2UA 4RI0A 4RT1A 1CHGA 1W10U 1BTWA 1T7CA 1MU6B 3MNBA 1TNHA 2SGAA 2A31A 4LZ4B 2BMGB 4AYYB 3ZYEA 1BRUP 1SGEE 2O9QA 1IOEA 3KNXA 3LGWA 4WMFA 3FAOA 1QGFA 2R0KA 3LH1A 4MNWA 3VGCC 3ZV9A 3LGUA 3SHCH 3MH6A 3RC4A 1AB9B 3RXQA 2OC0A 3GYLB 1AKSB 1VCPA 5GPIB 4ABAA 1O2MA 2HPPH 4RKJB 4WWYA 2AMPA 5JYIA 1MKWK 3ATMA 3A7YA 3BTTE 2A0QB 2WSSD 3RUOA 2B5TB 2QXJA 2TGPZ 1TMUH 1RIWC 3F2GA 1FY5A 1NFUA 3SUGA 2ZU3A 2ODYB 3A7TA 5C2ZA 1KXAA 1F5RA 5FHTA 2BD8A 1BMLA 4ZCNA 4YESB 1UTLM 5IYTA 3SGQE 1L1JA 4CH8B 3ZVAA 4ZKRU 1PQ7A 1TRYA 2R0LA 2P93A 3CP7A 1CA0B 2Z9LA 3V12A 3ZZ6A 2CHAC 1T31A 4Y76A 5C1YA 3BTDE 4I32A 3K9XB 1AFQB 2FPZA 3UNQA 3STIA 5EQQA 4WMDA 1PJPA 1C1RA 1X7AC 4Y7AA 3ZVDA 4X6OA 2BLWA 1TNKA 1JRTA 1FZZA 1O38A 1UK4A 1GBLA 1SGDE 2W5EA 5EOKA 1ANEA 3P8GA 1C2FA 4M7GA 1ACBE 3O8DA 1C5XB 2BLQA 3B9FH 1O36A 2LNCA 1C1OA 3Q76A 5DGJA 5EODA 2NU3E 1LVMA 5AF9H 3NPSA 3SJOA 4ACBA 1LHGH 3TH2H 1ZJKA 1Z6JH 3DSOA 3M5LA 1C2DA 3OAAD 3M5MA 3GCTF 1YPGH 2FS9A 5GDSH 3A8CA 2PFEA 2FEQH 1O3NA 2OQUA 3PV2A 1D9IA 1OSSA 2XC0A 1TYNA 1DT2A 1Y5UT 3LGYA 1N6XA 5DJ7A 2XXLA 2Z9JA 3NKKA 5JB9S 2XC4A 3NUMA 4TPIZ 5EIYA 4TY6A 4HG6A 1UVTH 3BEFB 7ESTE 4YZUA 1VCWA 4K2YA 3K65B 4ZUHA 3D65E 2A45B 3ZZCA 5C0UA 1RS0A 4DIIH 6CHAC 4HTCH 1QL7A 2P3FH 1W0YH 5CHBA 2K0QA 3A7ZA 3BG8A 2GP9B 1EX3A 2VINA 5EG4A 1GI4A 1ZHRA 2C8ZB 2ESTE 2PKSC 4FUEA 4BXWA 2HRVA 1ARCA 2ZPRA 1ZPZA 5GNDA 3ATKA 1SC8U 4ZROA 4XSKU 2PV9B 8ESTE 2GZ9A 3PMBB 1WTHD 3S9AA 1W8BH 5GCHF 1G2MA 2ZTXA 5A8ZA 2JETC 3RXBA 1GCTB 1TMBH 4TSFD 1AQ7A 4VGCB 2A4GA 1F92A 1GHAG 4TY7A 2ZG0H 1A4WH 4MNXA 1S0RA 1GDNA 3FZZA 1S82A 5F6MA 3ESTA 3FFGA 1QQUA 3VEQB 4RKOB 2P3TB 4F49A 2XBWA 1YWUA 2A4QA 2J94A 1MH0A 1KDQB 5EJ1A 2IJD1 1RTLA 4A92A 5HM2A 4MPXA 1K22H 3SNBA 2BM2A 3HK6B 1OWIA 1QBVH 3BN9A 4H6SB 1BCUH 4OS5A 1PPGE 1MQ5A 4NA7A 5DG6A 3UR6A 2ZECA 2A5AA 4AFUA 1UK2A 3K2UA 1DITH 2RA3A 1HB0B 4ZKNU 1GG6C 2LP6A 4A1XA 1O5BB 1UHBA 5JBBS 2TPIZ 2H9TH 3KQBA 2PWXA 3SI3H 5E8EH 5A0AE 2GDEH 4ABBA 1LHDH 2QY0B 1AD8H 1LHFH 3QWCH 4MLFB 1BTHH 2ZEBA 3E1XB 3H09A 4FUDA 5F8XA 2BYAX 4UONA 4OS7A 3OY6U 3RLWH 5EQRA 1TABE 2HGTH 3RXKA 2CK3D 4CRFA 1SLUB 4MPWA 1YYY1 2Z3DA 4ABEA 1EAUA 1WQSA 1J15A 1MBQA 4DG4A 1ETSH 1C9PA 2PUXB 3N7OA 3RC5A 1GBTA 1THRH 1BJUA 2EC9H 2ZDKA 1C5UA 2J38A 1PPHE 2ZU2A 2GX4A 1GCDA 4KP0A 2V3HH 1O2GH 1WXRA 1SGPE 1BTUA 1TNIA 1DLKB 2OBQA 4F55A 2OP9A 5J4SA 3BV9B 3LGTA 4INLA 1OP8A 1O31A 1EZXC 1HXFH 3OTPA 4AFZA 2C4FH 2ZDAH 3EDXB 1GJ4H 1XUGA 3FP6E 4O3TA 3LDXH 1P2IA 3K6ZA 3LJOA 4CHAB 1QNJA 1D3QB 4LK4A 3MH4A 5DN6D 1AZZA 1DWBH 4Q7YA 1J17T 1HJ9A 3A82A 4H4FA 4O03A 4TWWA 3SGBE 5C1UA 5I25A 1Y3XA 3OE7D 1GBHA 3FP7E 3T28A 1GDQA 1C1VH 5JPMH 4Y0YE 1YPEH 1C5NH 2XOKD 1O2XA 1MCVA 1MZAA 1TNLA 1TGCA 7KMEH 1TIOA 2ZI2H 1C1UH 2ANKH 4FU8A 1G3BA 1Y3WA 1O35A 1LDTT 4TWYA 1S85A 1O3OA 3GDSA 1PPCE 3A8AA 5JDUB 1ABIH 2B8OH 3P92A 2FOCA 2P16A 1TGSZ 2FTMA 3NWUA 3SU2A 1ELFA 1O5FH 3RXCA 3RU4T 4DW2U 5JBCS 2ZO3H 3SV7A 2FYQA 1SQOA 2AH4X 1UK3A 3GCNA 1WTGH 1ZHMA 3M7QA 3HKIB 1LCYA 5EGMA 1WBGB 2FZZA 1SR5C 1HYLA 4NIYA 2A5IA 2GCTC 1NZQH 4D8NA 4M9FA 3URDA 2J5UA 3SNCA 3ZVFA 1L4ZA 1HCGA 1GI0A 5DKMA 1QA7A 2Q6DA 1BITA 4KTCA 1GI1A 1MTWA 2ZPSA 3ZV8A 4BTUB 1SGFG 2KZ4A 1NRSH 1W0KD 3TITA 2VWNA 5LPFA 1SMFE 4X8VH 5T3HA 1K1IA 2XCNA 1DDJA 1HGTH 2GDDA 1MD7A 1CT2E 3MOCA 1E1QD 4AZ2B 2Y5FA 1GBFA 2ZFPH 1HBTH 2P59A 2XW9A 3KN2A 3QDZB 2G81E 1K21H 1IQMA 4OS2A 3TIUA 1BHXB 1JMOH 3E8LA 1XM1A 1GJ9B 3UWJH 1J14A 2C93B 2OC7A 1WDIA 1T8NA 1KTTB 1KXFA 1O2VA 1FY8E 6GCHG 1GBBA 1O2OA 1XUFA 1FN6A 2C8YB 1GBIA 1C2EA 1QA0A 1P0SH 1TA6A 4OS6A 2VU8E 1BBRK 1TRNA 1RRKA 1HPGA 1L1NA 1W0JD 4ISOA 1F0TA 4IS5A 4Z6AH 3P8NA 4NFEA 1Y3YA 1P10A 2PGQB 1HAGE 1LVOA 4ABHA 4YXWD 4AB8A 1V2QT 2AFQB 1C5QA 3K6YA 1WAYB 1RXPA 1Y5BT 2BDCA 3GY7A 2G52A 1KY9A 4Q63A 5GXPA 1P09A 3QGJA 1G37A 1P06A 3QZRA 4Y7BA 3RMLH 2WV5A 4ZXYH 1QIXB 2PR3A 3VPKA 1Y3VA 1BT7A 2LELA 3CNRA 2SNWA 4JK6A 2ZA5A 4XD7D 1K1NA 1N8OB 1SGIB 2TGTA 3BEIB 2BLOA 3SJ9A 3RXOA 2W6JD 4KKDA 1UTKA 4O9VA 2HVYB 5AHGH 2WYJA 1D3TB
chains in the Genus database with same CATH topology
1PQ5A 1SHHB 1CGHA 4DGJA 4KELA 1SOTA 4R0IA 4FUIA 1MKXK 3P8OA 2A32A 2VIWA 1GI2A 1GJBB 3CS0A 5HM9A 3SN8A 1G32B 1TPPA 2AMDA 4JZEH 1THPB 1MD8A 1H8DH 2EI8A 1P2OA 1CE5A 3SU1A 1YBWA 2ODPA 4NZLA 4CR5A 3QLPH 1ZGIA 2PUQH 3TK6A 1Z8JB 2PKAB 1CHOG 4ESTE 1QL8A 2WPHS 1T4VH 3GY2A 1HIAA 2PTCE 3EQ0H 4THNH 4Y11E 4NCYA 4YOJA 1BTYA 1BHXF 1IHSH 1XUHA 3EYDA 2HPQH 2AERH 1MAXA 3MU1A 5FCRA 3SW2B 8GCHG 1XXFA 4YM9A 3ZZDA 4JYUH 3MU5A 5LH8A 3UUZA 4BNRA 1C5PA 1L2EA 3RMNH 1YLCA 3OTJE 1W3CA 1HNEE 2ZDVH 3RXUA 1BQYA 2FM2A 1IQLA 3AVZA 4K1EA 5AFYH 4Q7ZA 1BMMH 4I8HA 1DXWA 4Q2KA 4FVDA 1ELEE 1YCPM 1ZZZA 3HPTB 2WPLS 1ZR0A 5IDKA 3QX5H 1RGQA 5GCHG 4IW4E 1GHVH 5EW2H 2P8OB 3D49H 5E0HA 2BDGA 4K60A 4CRDA 1SL3A 1F0RA 4CR9A 1IQHA 3DA9B 1GBMA 1GJCB 4XBCA 2AGGX 3Q77A 1DWCH 1E37B 5EXMA 2UUFB 2FI5E 3BG4B 5DP4A 2W3KA 1CVWH 1GMDG 3ZZ3A 1C5TA 3TJOA 3A7WA 1S0QA 3ZZ5A 1P11E 1VGCC 2ZCKP 1C1WH 3RXSA 4X8TH 3LGVA 2I6QA 1FY3A 2ZU1A 3F9HA 3V3MA 1C4V2 2CV3A 3HGNA 2OC8A 1WCZA 1V2LT 5DO4H 3TGJE 3BTHE 1IHTH 4PROA 3E6PH 2WYGA 4R8TB 5EU8A 3TK5A 1C2IA 3ZZAA 1SI5H 4SGAE 1GJ6A 2PSXA 3SI4H 1H9IE 1O3FA 5CHAB 1EPTB 3T26A 1FPCH 4UFDH 1NU7B 5EW1H 2XC5A 3ODDA 3TGIE 4B71A 2ULLA 2HALA 3VB5A 1NRRH 1CGJE 2ZDMA 5T6GA 1NRQH 1Z8RA 1AI8H 3AW0A 1NFXA 2ANMH 3E0PB 1C4U2 1VJ9U 4DVAU 3MI4A 1G3DA 1BTXA 2HOBA 3L6PA 3M7TA 5F03A 4B1TA 1IQNA 2BY7X 1Z7KA 2CN0H 1MUEB 2OTVA 1BRCE 2FYRA 3KQEA 4AG1A 4FUHA 1HJAB 3WY8A 3PM3A 4X6NA 1IQGA 3TJNA 2R2MB 2P95A 1KLIH 1QB6A 2G5NA 3F1SB 4BXSA 2FMJA 1EJNA 1V2VT 1D6RA 3F9FA 1GMCG 2GT7A 2BOKA 1U6QA 2UUKB 2FP7B 1H9LB 1O2KA 3A88A 1B0EA 1EAIA 3IG6B 3PLPA 2EA3A 2UUYA 1L4DA 1HAVA 1ABJH 1LHCH 3GCHC 1LQDB 5C3NA 3BIUH 2CF9H 4WF8A 3RP2A 1K28D 2IJOB 3EA8A 1AZ8A 1TOMH 1E34B 1BUIA 3LU9B 2AEIH 2K1QA 3SZNA 3LONA 3KIDU 1K1MA 4KTUA 2BQ7B 6ESTA 2ANYA 4NSYA 1GI6A 2C3SA 2A7HA 1DUEA 4X2WA 1ZPBA 4XBDA 2C8WB 2BX4A 1KXBA 1S6HA 3U98H 1GBEA 1W2KH 3RMOH 2QXHA 1IAUA 1XMNB 3Q3YA 3SJKA 3RXVA 3DFJA 3SU6A 1TA2A 2FWWA 1C4Y2 4B73A 2PHBA 4D9QA 1DXPA 2KAIA 1IQKA 5DP5A 1A5GH 2GT8A 1NN6A 1CBWC 1O5GH 1ELBA 4LOYH 2FO9A 1ID5H 4BAKB 1V2RT 4NZQA 1DY9A 2ZCHP 2OUAA 1YPLH 4MVNA 1QRXA 3MO9A 1JRSA 1D3DB 2HNTC 3SORA 3ENSB 1SLVB 2R3UA 2VVCA 4X1SU 1KXCA 2W7SA 4B2CA 1UTOA 5FX6A 5AFZH 3E0NB 1B5GH 2ZKSA 3B8JA 3RXMA 1HAHH 1WV7H 2A4RA 4HI3A 5A0BA 3UQVA 3HGPA 1PYTC 3RDZA 1MQ6A 4FUBA 1T32A 1ZHPA 3F9GA 1EATA 1PPFE 1LO6A 1BRAA 2Z3CA 1TB6H 1SLXB 3V0XA 2J34A 1NRNH 3NK8A 4IC5A 2BLVA 2WPMS 2SNVA 3EA9A 3P17H 1TGTA 4NA8A 1A3EH 2O8WA 2BD7A 4GUXA 3QUMP 3P70B 1AN1E 3VGCB 1T4UH 2SGEE 3FVFB 3T2NA 1O3JA 1S83A 1GGDB 3PTBA 1TX6A 1O3MA 3SUEA 1OYTH 3V7TA 5EPNA 3IITA 3VXFH 2ZGXH 3SU4A 2D8WA 4XBBA 5E0GA 2BY8X 4ISHH 2VJ1A 1ANDA 2VIOA 1G3CA 3I77A 1FLEE 1RIWB 2WUBA 1ELCA 5HGGA 1AIXH 3QO6A 3SU3A 1DPOA 3LH3A 3DFLA 2CXVA 1MTUA 1EB2A 3KF2A 5ESBA 3MFJA 1J16A 2XNIA 4ZHLU 1ELGA 2QA9E 2R3YA 2FI4E 5K0HA 1EZSC 1FN8A 4ISIH 2Z94A 3EGKH 4U01A 2BHGA 1LPKB 1C1TA 1KXDA 1QJ1B 2CHAB 4I33A 2NWNA 2OQ5A 1GJAB 1S5SA 4K1TA 3W95A 2NU4E 3S7HB 4FU7A 5JBAS 1ESAA 4MG3A 2QF3A 1INCA 1MTNC 3LJJA 1YPHC 2ZNKH 2J2UA 1S84A 1FV9A 2ZHDA 2ILNA 2M5TA 4XFQA 3ODFA 4H42U 1Z8GA 1DS2E 2W7UA 2BB4A 1TFXA 2FOEA 3ZVGA 1WYKA 3A80A 3VB3A 4K8YA 1ZTLA 3Q3XA 1PFXC 2SGPE 1O3CA 3BTFE 1TBQH 2H5CA 1QTFA 3DT0H 1P05A 4Q7XA 2OD3B 5ETXA 1TONA 1GBDA 1NFWA 4HFPB 5JB8S 4FUFA 4QT8C 4GPGA 2QV1A 3UPEA 1F0SA 1T8LA 1LHEH 2J4IA 2BQ6B 1O2JA 2BZ6H 1HAPH 1Z1JA 6CHAB 4ZMAH 2TIOA 1XX9A 2B7DH 2WINI 1ZGVA 4GCHF 3SBKA 5FPTA 3RXAA 2BDHA 2JH5D 1QY6A 2PKSB 3P95A 1A0LA 3UOPA 1GBCA 2F9OA 1K2I1 1O3BA 2EI7A 4AFQA 3LC5A 2VWOA 4MTBA 1BMAA 1DICA 1XUJA 1JIMA 3PWBA 2JETB 3JZ1B 1W12U 5BPEA 5SGAE 1QB9A 1M9UA 1XUIA 1OX1A 1GBAA 2FOBA 4IC6A 1PQAA 2Q6GA 3VXEH 3RC6A 2GCHF 2TGDA 3BTGE 1GMHG 1CT0E 1LVYA 2W3IA 1QBOA 5A09A 2VGCC 1ESBA 3O8BA 3HATH 1SFIA 1B7XB 3ZZ7A 2I6SA 4WH6A 1O3KA 1NY22 1FIWA 1UMAH 1C2JA 3AW1A 1N1LA 1CGIE 4ZHMU 1EAXA 3MU8A 1QURH 4MDSA 1ELDE 2G5VA 3PO1C 1SGFA 4B2AA 3UQOA 3TJUA 1OWHA 3ZVCA 1TQ7B 3MYWA 2A7CA 5A8XA 1FNIA 4CRBA 1GG6B 3R3GB 5L2ZH 1MTSA 3TVJB 2R9PA 2XBXA 2ZHWH 2GMTC 4TYDA 1BZXE 2F9PA 1O2ZA 2ZDNA 4B76A 1J9CH 1C9TA 5TCAA 1PYTD 4BAOB 1BMNH 1TBZH 2BVXH 4YOGA 1P2QA 5FBEA 3GOVB 1Y8TA 1VITF 2A2XH 4FUJA 2V3OH 3U8TH 2HNTE 4NFFA 3VFEA 1C5YB 1GBJA 3SNEA 1A7SA 1FY1A 5DP6A 5EXLA 4X1PU 2A1DB 5TJXA 3MNXA 3KHVA 3VB7A 5GJ4B 4FU9A 1KSNA 4KTSA 4MPVA 3O8RA 2A7JA 3GDVA 2ZIQH 4E7NA 3A87A 3NCLA 2H5DA 3O8CA 1JIRA 2QXGA 1C2GA 3H5CB 1SFQB 1K1OA 1C5OH 1SB1H 3M3VA 3RLYH 1FDPA 1AE8H 1GI7B 2WPJS 4NG9H 2XCFA 1O3AA 1O3LA 1H9HE 2V35A 1O3HA 1NTPA 1OYQA 3RM2H 4AYVB 1ZOMA 3M61U 3SNAA 1TLDA 1GJ8B 2SGFE 5JBTA 1DVAH 1O3PB 3RXLA 1LPZB 1P2MA 1C5WB 4ABDA 2Y81A 2UWPA 3RXEA 3Q00A 4CRGA 2BDAA 3PV4A 1O37A 2A2QH 4RSPA 4ISLA 3QN7A 2GGVB 1XUKA 3T62A 4CREA 4TPYA 1H4WA 1XKBC 1G2LA 2ALVA 3URCA 4NSVA 1O3DA 3UY9A 1UHBB 2XBYA 2YNBA 1AKSA 2WPKS 1AHTH 4H6TA 1G30B 3MMGA 2ZFRH 3SJIA 1EXFA 1HAZB 3NZIA 1GHZA 2ZTYA 4NIVA 1GL0E 1BJVA 1OP0A 1LKBA 1NPMA 3UNRA 4SGBE 2LPRA 1P01A 2B0FA 3PB1E 3BTKE 3GCTG 4YOIA 5HYOA 6LPRA 1A46H 2GCTB 4FUGA 3U1JB 1W14U 2W26A 2BVSH 3A83A 1PPZA 4X6PA 4JK5A 1OPHB 1TBRH 4AX9H 1QJ6B 4J1YA 1AVGH 1RTFB 3M37A 1Z1IA 1A0JA 2R2WU 4CRAA 3VB6A 3ZVBA 1D3PB 1UTJA 3BEUA 4NGAH 3SO3A 1GVZA 2BZAA 3KEEA 1YC0A 1OS8A 5FAHA 1P9UA 2FTLE 3RXTA 4X2XA 4IN2A 4IN1A 1JWTA 1UTMA 2ANWA 1GDUA 2O8UA 5I46H 2D2DA 3SGAE 2Y7ZA 4DOQA 1O3IA 5EXNA 3G01A 9ESTA 4GLYA 3DHKH 3SUDA 1EJMA 1KLJH 1OOKB 1V2WT 3PMAB 3M36A 1C2HA 4HGCA 3PMJA 1A5HA 5F8TA 1DFPA 4Y0ZE 1NRPH 1AFEH 1UTQA 3F68H 1FJSA 3A84A 2BDIA 2FX6A 4UFGH 3GY8A 1OWDA 3QTOH 3SUFA 5A2MH 1C5LH 2NU0E 3SQHE 3RXJA 2ZDLA 2ODQA 1AB9C 4MNVA 1OWKA 2VH0A 4A7IB 1G3EA 2YOLA 1ZSKA 1V2PT 3MU0A 1QFKH 4X8SH 1O5EH 3BTEE 1ZMLA 5K7RA 1L0ZA 1EOLA 5T6FA 1YCPK 1IQFA 2ZFQH 3RXIA 2XBVA 3E3TA 1UVUH 3SNDA 3NXPA 1IQEA 4ASHA 2ZHEH 2FXRA 1SGNE 3LIWA 1AO5A 3UWIA 1TPOA 2G8TA 5HXFA 3EA7A 1DUAA 3P8FA 1FI8A 2XTTB 1DLEA 5GWZA 3M35A 2BXUH 1C5RA 1GI3A 1C2MA 5LGOA 3TPIZ 1GHWH 3MH5A 1GHXH 1CU1A 1CA0C 1HFDA 2FOAA 3S7KB 1NS3A 4ABGA 1SVPA 4X6MA 1GBKA 3RXRA 1T8MA 1AFQC 4AORA 1YF4A 2UWOA 2QIQA 2VIDA 1Z71A 2RA0A 1K1JA 1P2JA 2CMYA 2ZGJA 4X1NU 4J2YB 3W94A 4I8LA 1KLTA 1S81A 1KDQA 1P3CA 7LPRA 1GHBF 1ANBA 2O8TA 5L6NH 1UCYH 2FESH 3AAVA 4A6LA 3TU7H 2Z9IA 4LXBH 3T25A 1Z8IB 2ASUB 2Y5GA 5CE1A 1UJ1A 2SGQE 1EZQA 1A2CH 4D76A 1VCQA 2OC1A 1YPMH 1O3EA 1XXDA 2GZ7A 4BAHB 1P04A 2PGBB 3PYHA 1GWAA 1SQTA 1GVLA 5EPYA 3PLKA 3H7TA 1Y3UA 4ZAEA 3V13A 2ZCLP 4UEHH 1RTKA 4CBNA 2GCHG 4INKA 3OU0A 1SBWA 3ELAH 4K3JA 1UCYE 1MTVA 2H6MA 2H2ZA 1ORFA 1GI5A 2H1UA 3UTUH 1SGYE 2AS9A 2NU1E 2Z3EA 5E0JA 3MTYA 1O2IA 3TK9A 2JKHA 1P02A 5B6OA 4Y6DA 3MO3A 2DE8A 2GTBA 2HLCA 2RG3A 1O0DH 1GGDC 2EI6A 3ZZ4A 1FPHH 1VGCB 1QCPA 2BOHB 2ZQ2A 4UFEH 1FQ3A 1P57B 2ZFFH 2AMQA 1GCTC 2XRCA 4JZ1A 4VGCC 4XE4A 2ZP0H 2ZTZA 6GCHF 1AU8A 1AVWA 1O2QA 1ETRH 1SGQE 1YPJH 1O2YA 1MKWH 2OXSA 2ZGCA 1Q3XA 4XDEA 1E38B 5F8ZA 1MMJN 1OKXA 4NWKA 4CBOA 4GSOA 3BF6H 2AGIX 1EQ9A 4WXIA 4A5TS 5L2YH 1HIAB 1NROH 2ZGBH 4X2YA 3EE0B 1NESE 3CS7A 4OS4A 1ZYOA 2ZHQH 1AWHB 1YP9A 1O2HA 1IQJA 4WY3A 1V2TT 1ZRKA 1YM0A 1VITG 3M3SA 1HAIH 3RMMH 2AGEX 4Y8XA 3ATLA 1FIZA 2BX3A 1DANH 1V2JT 3GY4A 1V3XA 3BTME 1ZJDA 2TRMA 1W11U 1SSXA 4INHA 1GJ5H 1HUTH 4FVBA 1TE0A 3Q3KA 3OY5U 2THFB 1K1LA 2ZFTA 1A5IA 2RDLA 2ZU4A 1S6FA 4JZFH 2FS8A 1TNGA 2WV4A 1SGTA 1SGCA 1O5CB 1GL1A 3BSQA 3TGKE 4X0WU 3RXHA 3F9EA 2VNTA 4OS1A 4I8KA 1FMGA 3PMHB 1P9SA 2PTNA 2YNAA 1C5MD 1OWEA 4BAQB 1ZLRA 1LTOA 3SOSA 5FX5A 3E91A 2AIPA 1KTSB 1UTPA 2G4UA 4F4OC 2FLBH 1C1PA 4U2WA 1MZDA 1BDAA 1XKAC 1CHOF 2VB0A 1UO6A 3B23B 2BY5X 1E0FD 2PSYA 4IBLH 1NC6A 3OSYA 5C5NA 4D7GA 1J8AA 5C1XA 1QBNA 1ZSJA 1G9IE 1O32A 1FONA 3QK1A 3GCHB 5HMAA 3M3TA 8GCHF 1BB0B 1OWJA 1TMTH 2P3UB 2G55A 2H9HA 1OXGA 2Z7FE 4K69A 1B0FA 4CHAC 1DM4B 1JXPA 4OGYA 1TRMA 4UE7H 4DT7B 1C2KA 1TGNA 2G51A 2ZWLH 4NIXA 3VB4A 2STAE 1O34A 2H9EH 5LPRA 4GVUA 3AASA 4E06H 1MCTA 4YTAA 1TPAE 2O8LA 3L3TA 4ZKSU 3ZVEA 4B75A 4ZKOU 2OBOA 5DP3A 4E05H 4YO9A