1W14U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U01
4MTBA 1O2MA 1IQLA 3GY6A 4ZHMU 1MAXA 2BLOA 2Z9GA 4LXBH 5C67A 3P92A 4H4FA 1GG6C 3VGCB 1ANDA 5EQQA 4U2WA 1TLDA 1BTYA 3GICB 2PFEA 2VGCC 1SGTA 4XDEA 2GTBA 2M5TA 3GYLB 1ORFA 1Z8GA 8GCHG 1O2ZA 1O2OA 1G2MA 1GJ8B 1QL8A 2I6QA 5EXLA 4KP0A 1J17T 3SV6A 4ABBA 1FDPA 4Y10E 4CBOA 1LVYA 1SR5C 3H7TA 3LU9B 3MO9A 3HATH 2F91A 2XNIA 3QUMP 5CHAC 1O2IA 2OCVB 4FUGA 2A7JA 5GWZA 4DIIH 2XW9A 2GDEH 3DFLA 1ZJDA 2HPPH 2ZFQH 1C5RA 2ZTXA 3A8BA 2BY9X 2GV7A 4GHQA 1ESBA 1GGDC 1IQEA 4AGKA 1EATA 3GCOA 3U69H 2ODQA 1FONA 1SGIB 2P16A 3QTVH 1MKXK 3M37A 3TNTA 2FPZA 3KEEA 4HI3A 2BMGB 2Y5GA 3RXGA 3MWIU 2Z9JA 1P2KA 1LKBA 1A5GH 4NWLA 3M61U 1BA8B 1FMGA 1J16A 1ZMLA 2A7HA 1IQKA 1SVPA 3RXMA 1TE0A 4K8BA 2VINA 3LONA 2W7UA 2OP9A 1NRRH 2V6NA 2FZZA 4JCNA 1O2HA 4CRDA 4CRFA 2P8OB 2H5CA 2BTCE 3LDXH 1EAXA 1F0TA 1QJ7B 2VIOA 2YNAA 5EQSA 5TCCA 3SV7A 1HAZB 1LVOA 1FIZA 3K6YA 1HJ9A 1ZGIA 3ELAH 4Y8YA 1V2VT 2R0LA 2PWXA 3A7ZA 1UCYK 1LVBA 4B1TA 2HPQH 5DP5A 1UVPA 4K1TA 3TNSA 2IJOB 2Q6FA 2Z7FE 3FAOA 1TRYA 3MU8A 2A5IA 1RIWB 4A1XA 3H5CB 2ZHEH 4I33A 1YPMH 3NWUA 1C4Y2 4JYTA 3CS0A 1W8BH 3RXOA 4WMDA 4NCYA 1UVOA 4O97A 4O9VA 3ZVAA 2AMPA 3V13A 4F4OC 1GHZA 1NPMA 2WPKS 4ZKSU 2G4TA 4BAOB 1ZRBA 1N8OB 1IQIA 1SGCA 3DFJA 1O3BA 4NIYA 3VB6A 1GBKA 1Z1JA 1UTJA 4Q7YA 4NIXA 1BMAA 3KQEA 3ENSB 3O8DA 2ZO3H 3S9CA 3BF6H 1T4VH 2CN0H 3MU1A 1D3DB 4FU8A 1D9IA 1RJXB 1C1VH 1LCYA 1V2KT 2QYIA 5HXFA 4X8VH 1TGBA 2HNTC 2A2XH 3T62A 1Y5AT 1TOMH 4TWWA 4MNVA 4ZUHA 3LGTA 4J1YA 5FPSA 1O3PB 1AI8H 1YM0A 2VGCB 4YOJA 1YKTA 1GDNA 2Z3CA 1EZUC 3RXRA 2QF3A 1EP5A 1QA7A 5EW1H 1O2KA 1TB6H 3V7TA 1C5WB 1FY8E 3OSYA 3RXQA 1CO7E 1EP6A 1OWDA 2GZ9A 4Y76A 1QL9A 2QAAA 1TNKA 1YP9A 3PWBA 1ABJH 1FY4A 1TWXB 1LMWB 1Y3UA 3BTTE 3K9XB 1O5GH 1GHBF 3KQCA 2GD4B 4NGAH 4U32A 4E06H 3LC3A 1GI8B 2O8WA 3SO3A 3V3MA 1BT7A 1HAXB 1IQGA 2TBSA 1MD7A 1DX5M 3P8GA 2F9PA 1SFIA 3ODFA 5L6NH 1G2LA 3NUMA 1C4U2 1S0QA 1AB9B 4FUJA 2VIPA 3MMGA 2VIVA 1Y3VA 3A86A 3EA9A 1ELVA 2TGDA 3BTME 5F8ZA 2CMYA 3QLPH 4Y8XA 3SU1A 3VPKA 2D8WA 4WJG2 3ZZ6A 5T6FA 3LGVA 1GBFA 1PJPA 1MCTA 1P12E 2FP7B 4FU7A 3H7OA 3ITIA 3L33A 4NIVA 3A8CA 3FP6E 5DP3A 1G3DA 1SOZA 2P94A 3EDXB 1P2IA 2PW8H 3UTUH 1S85A 3S0NA 1ID5H 1CT2E 2RG3A 3MO6A 1D3TB 1ETTH 1D3QB 4WMEA 2ZDMA 3ZZ8A 1A46H 4X2XA 4E05H 2VB0A 3LH3A 3FP7E 1F92A 2AS9A 4NA7A 5E0JA 1FQ3A 2YNBA 3U1JB 3MH7A 1NU7B 1YBWA 1O3DA 1GHAG 1QRWA 3QZRA 2H5DA 1MD8A 1CA8B 1O2XA 6GCHG 2BOHB 1V6DA 3Q00A 1ACBE 4HFPB 3SV2H 4Z0KA 4FUBA 3RUOA 2TRMA 2WV5A 1ARCA 3BG4B 1XUJA 3SORA 1DWEH 2DE9A 3NZIA 4TYDA 4NWKA 3LGWA 3SGAE 5LPFA 1HAVA 4NIWA 3Q3XA 1GHXH 3ZZCA 1SLUB 1TA6A 2ZU1A 2NU3E 3RXKA 3BG4C 4JMYA 2R3UA 5A8XA 3QN7A 4K69A 3S9AA 1HAOH 2A4RA 5E0GA 1IQHA 4I8LA 1LVMA 2R2WU 3T26A 1P57B 1F2SE 3NXPA 3M7UA 3MFJA 1GMHG 3ZVCA 4ZROA 2BDHA 1LHDH 1G30B 1SGDE 2SFAA 1E35B 1K9OE 2BVSH 3KQDA 3ZVEA 3QO6A 3QX5H 3AAVA 1O35A 3RM0H 1J8AA 4X6NA 1BTXA 1G9IE 1OWEA 2ZU3A 4AORA 1MTUA 1S83A 1QFKH 1LHFH 1C5MD 2FEQH 4X1NU 2F83A 2XWAA 3M3SA 5JYIA 4BTIB 2AH4X 3UQVA 1O3CA 1JOUB 1C1QA 1AKSB 1JIMA 1A3BH 1TGNA 4NG9H 1M9UA 4THNH 3GY3A 5F8XA 1EPTB 1C5QA 3AVZA 5EPYA 1DY9A 4FUFA 2ZF0H 3F9HA 1ELGA 1P09A 3BTDE 2D1JA 5A2MH 1CU1A 3M35A 1UTKA 3KQBA 3SU0A 2LNCA 1DVAH 3E91A 2V3OH 2GT7A 1SG8B 1AGJA 1HUTH 1NFWA 3ZZAA 3STJA 1YPHC 1HAHH 1TQ0B 1O31A 3GYMA 1PPGE 1BRUP 1TMTH 5CHAB 1TOCB 1MTNC 2ZPQA 4A1VA 1ZHPA 2STBE 2AEIH 2H6MA 1ARBA 1ZPBA 2SGDE 1O30A 4H6TA 1FZZA 4DGJA 1DOJA 3VXFH 1YC0A 4DW2U 2A5AA 1EAWA 1ZPCA 3LPRA 2C3SA 1Z6JH 2C93B 1Z8IB 1VJ9U 3A7YA 3UUZA 2BVRH 3NCLA 1O5FH 1P01A 5DK1A 1P2JA 2NU1E 1OXGA 3M5NA 2ZPRA 1GDUA 5A09A 1GBDA 1IQJA 4CR5A 2D2DA 1FPCH 2Z9IA 3MH5A 3QZQA 3HGPA 1FJSA 2A4OA 2OC7A 2QV1A 2H9HA 1C1UH 2BDIA 2CHAB 2F9OA 1O2TA 1O3NA 5HM2A 3K65B 5J4SA 1O3MA 1ZTKA 2ZDAH 4MQAA 4DOQA 3P8NA 1RD3B 1YCPM 3D23A 1BRBE 4AGJA 2ZDNA 1WYKA 3ZYDA 1EPTC 4ZHLU 4RKOB 3P8FA 1FIWA 3VEQB 1YLDA 2QIQA 2BDAA 2ZDLA 3SUDA 1UVUH 1EB1H 1WQVH 1GBEA 1BQYA 1ANCA 4AFQA 3A7WA 3SUFA 1WV7H 3ATMA 2ZGJA 1O38A 2DE8A 4A1TA 2BHGA 1DXWA 3GCTG 1O32A 1XX9A 3R3GB 1AZZA 2O8UA 1K1MA 5JBCS 1QY6A 1AY6H 1FI8A 1LHGH 4SGBE 2ZU4A 1RXPA 1HJ8A 1FY3A 1K22H 2ANWA 1C5VA 3UNSA 2FS9A 3TH3H 1MAYA 3RLYH 3URDA 2AIPA 4I31A 1UTMA 2EI7A 3PLKA 4F49A 1MTVA 1GMCG 3ZZ9A 1MZDA 5A0BA 4VGCC 1EX3A 1HNEE 1JRTA 1XUKA 2BLVA 3ZVDA 1O33A 1W0YH 1THRH 4Q2KA 3E6PH 4DVAU 1C5SA 1RTFB 3HGNA 5FCKA 1HB0B 3I78A 2ODYB 5SGAE 1ZZZA 1EQ9A 1OWKA 3MTYA 4QT8C 5HYOA 3P8OA 1GJ9B 3TGKE 3SU6A 1W13U 1GBTA 4B75A 3CENA 1DSTA 3PM3A 4MVNA 5HM9A 1C1TA 4CH2B 2BB4A 1B0EA 1EZQA 1HAVB 5EG4A 9ESTA 2HVXA 2BD8A 1ELBA 4WMFA 1C2GA 1F0RA 4LZ1H 1F7ZA 1OYTH 3BV9B 1C5XB 2R2MB 2FDAA 1GMDG 1C2KA 1OP0A 3E16B 4BNRA 1MBQA 2Y6TA 1BDAA 1LDTT 1QQUA 3BG8A 3I77A 3RP2A 3TK9A 1BJVA 3ZZ4A 2ZFSA 1AO5A 4ISNA 3PB1E 1KYNA 1O5CB 3RXFA 3GISB 1ZGVA 4Z6AH 3PO1C 2Z94A 8LPRA 1PPBH 3OY6U 2ZHWH 3ZZDA 5LH8A 3MOCA 2F9VA 3T2NA 1KXFA 1ZR0A 4VGCB 4DG4A 1TYNA 3SI4H 1O2YA 4INKA 4KTUA 2G8TA 1ZRKA 1P2MA 4I8KA 3RU4T 3L6PA 4CR9A 1SOTA 1FV9A 4I32A 1Z8JB 1GBIA 3PMAB 3U98H 1EKBB 3P17H 4AFZA 3SZNA 1NN6A 2GZ7A 1YYY1 1KXCA 3SU5A 2BY6X 5LPRA 3F6UH 1SPJA 2JH0D 1XUFA 2AFQB 4FVDA 1BITA 4Y7BA 1Y5UT 5BPEA 1VCWA 3M5LA 5GXPA 3A80A 3KIDU 3SU4A 1O3GA 3TK5A 2ALVA 1TQ7B 3RXUA 2A4QA 1AKSA 2A0QB 3FZDA 1DM4B 2ZU5A 1KSNA 1GHYH 2XBXA 5AHGH 1D3PB 2FLRH 4BAQB 2BD2A 3PYHA 4X0WU 2P59A 1NO9H 1EPTA 1Q31A 2Z3DA 2BM2A 4R0IA 1WSSH 4Y79A 5L2YH 1UK4A 3CS7A 1TONA 5HMAA 3ZZ3A 3ZYEA 2GCHG 1O2SA 2XC4A 2ZCLP 4OS1A 3BTGE 4XOJA 5T3HA 1HXFH 3C1KA 3P70B 4MPVA 1HPGA 1A0JA 2WPMS 1VITH 5EU8A 3NK8A 1TNIA 1GDQA 2BDCA 3VB5A 5ESBA 4B2AA 4ABDA 3QK1A 3MNBA 2XBWA 3KN2A 1OP2A 1ZSKA 5IYTA 1V2JT 3QWCH 2ZP0H 2FYQA 4JYVH 4OS4A 5IDKA 2BY7X 1Y59T 2FI3E 1O5BB 1SMFE 4X1QU 4I8JA 4NSYA 1W12U 2WINI 4WXIA 5C1UA 5FCRA 2EC9H 2ZFPH 1HAGE 1UK2A 4U01A 1DWDH 3ATWA 3DD2H 2PUXB 3RM2H 2PLXA 2PTNA 1BUIA 2GP9B 1DFPA 5DP7A 2ZFFH 2AGIX 1QJ6B 1ZMNA 2WPIS 1TA2A 1AVGH 1OS8A 4JZIA 4NA8A 4WH8A 2PKAA 1TGTA 1LPZB 5AFZH 2C90B 4JZEH 1LHEH 4RSPA 4ISIH 1JWTA 1XKAC 2A32A 3OU0A 1EAUA 1KXBA 3PTBA 3EE0B 4IMQA 2C8ZB 1DDJA 3NKKA 1NU9A 2ZQ1A 2CXVA 4IGDA 1IAUA 2BYAX 1N8OC 5A0CA 1V2UT 3E0NB 3ZZ7A 1QBOA 1YCPH 5F03A 2BX4A 3ZVBA 1T8MA 1O3IA 2AMDA 2YOLA 2FI5E 1ZLRA 4MNWA 2FX6A 2P3UB 4DY7B 1WOFA 4FU9A 1A7SA 1HBTH 4J2YB 1XVMA 1OWHA 4YOIA 3T28A 1C1WH 1QJ1B 5LPEA 1DT2A 1N1LA 1AMHA 3ZVFA 4Q7ZA 1TFXA 1T4UH 1W3CA 3EGKH 5BRRE 1XUHA 3I29A 5FX6A 4BXWA 2ZTZA 2FOAA 2PV9B 3UOPA 1TX6A 1UO6A 2FLBH 2ZKSA 4CRAA 3LKWA 1ABIH 2G5VA 1CE5A 4ZHAA 1FXYA 3TJNA 8GCHF 3T27A 3UNRA 4X1SU 1KTSB 4JZFH 1O2UA 5GCHG 1P05A 3SUEA 1HRTH 2UWLA 3MU4A 1GHWH 1ELFA 4OS5A 1P03A 2AIQA 4I7YH 2FMJA 1AFEH 1ETSH 2GT8A 4RKJB 2FXRA 1VGCC 4UONA 1VCQA 3UR9A 3PMJA 4CBNA 1O3AA 2QA9E 2VIQA 4BOHA 4UFGH 1MMJN 2ZFTA 1XVOA 1OSSA 1AWFH 2ZWLH 3O8RA 4TY6A 2ZCHP 1EAIA 1OWJA 1W11U 2SGPE 3RC4A 1EASA 4ISHH 1H8DH 2PTCE 1A61H 1GCDA 5JB8S 5GPIB 7KMEH 2GX4A 3Q77A 3A82A 1WAYB 1YPKH 2BD9A 1C5TA 2VH6A 1MTWA 1BMLA 1TRMA 1KLJH 2QXJA 3EAJA 1WTGH 2H2ZA 3SBKA 1RGQA 4GSOA 1QB6A 2FWWA 3OYPA 1YPGH 1GI2A 4CH8B 1H9HE 2VWNA 1ETRH 5C20A 1GI4A 1W10U 1MU6B 1K1NA 1KY9A 4CRCA 1PQAA 2TGTA 1GCTC 3GY2A 4X6MA 1V2NT 3D65E 3DUXH 1QIXB 3SN8A 1SLXB 3FANA 1O2JA 2PGQB 2ZG0H 4AYYB 2BX3A 5AFYH 1TBRH 1Z8RA 2EI6A 4MDSA 4KTCA 3T25A 1DUEA 4Y11E 1MBMA 2O8LA 5A0AE 1TNHA 3LJOA 3PMBB 3ATIA 1UVSH 2OD3B 3TK6A 1FN6A 2UWOA 3KHVA 1TBQH 3P95A 2ZZUH 3S7HB 4MPUA 4WVPE 2XXLA 2D26C 4DCDA 3Q3YA 1E0FD 3TU7H 4UEHH 1C2FA 2EEKA 1V2RT 1O5AB 1GVLA 3D62A 1BTWA 1C5PA 3RLWH 2JH5D 2ZQ2A 2AYWA 1GWAA 1AE8H 1UTLM 2R0KA 1NFYA 4YZUA 4BAMB 1SGRE 1DANH 1FNIA 3W95A 1PPCE 1O37A 1OOKB 2ZTYA 1TPOA 3A83A 4ISOA 1Y8TA 1O3JA 1HAYB 2ZDKA 1SGEE 3W94A 3PWCA 1ZPZA 1GJDB 1GI1A 3C27B 1ELAA 4D9QA 1P9SA 4IS5A 1NFXA 4IBLH 4LK4A 2PSYA 1HIAB 3TJVA 1KDQA 3B9FH 2F9BH 1AWHB 4CREA 1ZMJA 1IHSH 2ANYA 2WYJA 2B7DH 2AGGX 5L30H 1BB0B 1P11E 1IQFA 5TCAA 5FAHA 3GY7A 4O3UA 3V0XA 2FS8A 3OTJE 4BXSA 1GCTB 1Z7KA 8KME2 1BHXF 1GBLA 2B8OH 2IN2A 3VXEH 1H4WA 2W5EA 2K1QA 3RU4E 2FIRH 2AERH 4KTSA 2Q6DA 1O3HA 1GHBG 2B0FA 4DIHH 1BOQA 4U30A 1EOJA 3AW1A 3TH4H 1C2JA 3HPTB 3SI3H 4E7RG 1TPPA 3TJOA 2OINA 1QBVH 1NESE 3ODDA 1QURH 2HRVA 2UUJB 3E0PB 2G52A 3IWMA 1EB2A 3EYDA 1PYTC 2GVFA 1DWCH 2V0BA 1GI3A 2KAIB 3RDZA 2QF0A 2KAIA 4MG3A 6GCHF 5FPTA 1V2LT 3A7XA 1TALA 2NU0E 1W7XH 1DXPA 1V2PT 4OGYA 1KXDA 4X8SH 4AYVB 1CVWH 1BBRE 1QCPA 3SUGA 4MPXA 4Q80A 4B74A 2FOFA 4E7NA 1SI5H 4GAWA 2JETC 1KLIH 1WCZA 2ZCKP 1K21H 2VIWA 2Z9LA 1EUFA 1SHHB 2J95A 5E8EH 3HKIB 2VVVA 1H9LB 1GBBA 1CGHA 5H4IB 1TIOA 3HK6B 1C1NA 4Y6DA 2HALA 3UREA 2FOGA 1Y5BT 3RXHA 2UUYA 1TMBH 1O2VA 2WPJS 3QGNB 1P2OA 3GOVB 4ZXXH 3A88A 1C1OA 4MNXA 2GGVB 4D7GA 4ZKOU 4ZMAH 1UVTH 1J15A 1CA0B 4AZ2B 1SQAA 2HNTE 3S69A 2R3YA 4CHAB 2FTMA 1BTPA 5DPAA 1ZSJA 5EXMA 1GBCA 1VITG 1Q3XA 1QA0A 4YTAA 5EODA 1WUNH 4FXGH 1BHXB 1C5UA 2VJ1A 2VWMA 1C5LH 5PTPA 1UHBB 4YM9A 2GDDA 1L2EA 5JBTA 2F9NA 2ANMH 1WBGB 2F3CE 3M3TA 2J9NA 1BTZA 1PYTD 3A7VA 3PTNA 5G4BA 1P0SH 1PPZA 1C2EA 2W3IA 7GCHF 5DP9A 3U8RH 3A89A 1SGFA 2W26A 1BZXE 1GG6B 1VZQH 2J2UA 1SC8U 4JZ1A 1GJCB 1GJBB 4OGXA 1S82A 1NRQH 1N6YA 1KXAA 2V3HH 3A7TA 1TAWA 4B76A 3E90B 4BAKB 2A7CA 4ESTE 5J4QA 3GCNA 7GCHG 2XC0A 4XE4A 3LOXA 1F0SA 4TPYA 2TPIZ 1AVXA 5DKMA 1O3LA 3OX7U 2CF9H 2QXHA 3Q76A 4IMZA 1DLKB 1B0FA 1VJAU 1UCYH 3SJ8A 1V2TT 1GJ4H 3RXEA 5FBIA 1L0ZA 4IW4E 1BMMH 1W0ZU 2WUBA 2FOEA 1WQSA 3A85A 2PKSC 4X1PU 1OPHB 2DUCA 5EW2H 2STAE 3ATKA 3GDUA 1A0HB 1FAKH 1FY5A 2VWOA 3ZVGA 5L2ZH 1CGIE 2BY8X 2JKHA 1V2MT 2OBOA 3LIWA 5C2ZA 3VB7A 1QGFA 1EJAA 2PKSB 2XRCA 3P6ZB 1JBUH 4XBDA 3SNEA 3VB3A 2J92A 2RCEA 2VVUA 1MQ6A 1GI5A 2BZAA 1OYQA 5C3NA 1BRAA 2A45B 2XBVA 2OQUA 2OC1A 3FFGA 1QTFA 1ESTA 4K8YA 1O2GH 4B2BA 4UDWH 1CHOF 5DG6A 2GCTC 3RXTA 1F0UA 1UCYE 2FESH 5EGMA 2P93A 1C2DA 2ZPSA 1S0RA 2TGAA 3D49H 3MU5A 2ASUB 4JZDH 2GMTB 3E1XB 1XUGA 1JIRA 2XCFA 1QQ4A 1CHOG 1ESAA 5C1YA 4XSKU 3PLBA 1H9IE 1NZQH 1GBHA 5K7RA 4BTTB 4FUHA 3GCHC 2H9EH 1EJNA 3K6ZA 2FO9A 3BEIB 3U8OH 3SQEE 1GJAB 1P2NA 2G4UA 3RXDA 1IHTH 1GMHF 5JPMH 1MKXH 1XUIA 4OS6A 1G37A 5FXLA 3RXAA 1TGCA 1C1MA 1D6RA 2TIOA 3G01A 2Y82A 3T5FH 2ANKH 3CP7A 2A5KA 1C2IA 2OTVA 3PMHB 4AFUA 1NC6A 3WY8A 1SGNE 1DUAA 2VU8E 2BXUH 3A8DA 5T6DA 1HAIH 3S9BA 3S7KB 1O2LA 2H1UA 1MKWK 3SJKA 1NT1A 2ZEBA 1YLCA 4A92A 1AUJA 1K2I1 1V2QT 5B6OA 1RFNA 1TPAE 1FLEE 1G36A 4ABGA 1O2NA 1LPKB 5GDSH 1C4V2 2V35A 2BQ6B 4X6PA 2IOTA 3LH1A 4ISLA 2FOMB 2BLQA 1KLTA 1PFXC 1QB1A 1GBJA 2BD7A 2IPHA 1SL3A 2CHAC 4IN2A 3UPEA 1F5KU 1K1OA 2F9UA 2W3KA 1TBZH 5DP4A 1SSXA 2CF8H 1MKWH 3QGJA 3KGPA 2J94A 1VCPA 1TRNA 4NFFA 1TPSA 3SHCH 1K1JA 3SNDA 3SJOA 1HJAB 4MLFB 4RN6A 3SNBA 2O8TA 4SGAE 3SHAH 1BRCE 2XWBI 4YT7H 2ZA5A 1JXPA 2THFB 3UR6A 2ZHDA 1QL7A 1OWIA 4GPGA 2J38A 2ZC9H 4BTUB 1GJ7B 2HWLB 1FN8A 1GI6A 4O3TA 1GJ6A 1AU8A 1GHVH 1DICA 1NRSH 4XFQA 1KTTB 3V12A 5EPNA 2ILNA 1P9UA 4ABEA 1BCUH 1BTUA 3VB4A 5CE1A 2PR3A 2Y5HA 3UQOA 3VFEA 2OC0A 4XBCA 4GUXA 3A8AA 1ELEE 4I8HA 1UK3A 3L3TA 1GMDF 3U9AH 1UMAH 3UOUA 1F5RA 1T31A 3TJUA 1GMCF 1RTLA 2VH0A 2J34A 1UTPA 5DP6A 3RMMH 1NS3A 3MU0A 1ELTA 3RMLH 4Y71A 1D6WA 2PHBA 2ULLA 4FUIA 5JDUB 5DO4H 1NY22 2VVCA 1A4WH 4DJZB 2QY0B 4LOYH 1XXDA 2LPRA 2ZGHA 4ZXYH 1EZXC 3EA7A 3UFAA 1E37B 1GBAA 1O2RA 2ZHQH 1S6FA 1VITF 3LJJA 3SQHE 3LGUA 3F9FA 4AN7A 3T29A 2ESTE 2FODA 3M7QA 3RC6A 2VNTA 1O36A 1CHGA 1ZSLA 3ESTA 1THSH 3A81A 2ZU2A 1ELDE 4A7IB 1F5LA 2OC8A 4IC5A 1GI7B 1V2ST 3RXPA 3M7TA 1HV7A 1YCPK 3GY5A 5DJ7A 2HNTF 5DP8A 2GZ8A 1AZ8A 4Y0YE 1E36B 2HLCA 3O8CA 4HTCH 2BDGA 5I25A 1QRZA 2BVXH 3M3VA 4A5TS 1GHAF 4KELA 4K3JA 1EXFA 1CT0E 5CMXH 1GPZA 1Y3XA 3BTHE 1HFDA 4MPWA 5ETXA 1HIAA 4K1SA 1TNGA 2B5TB 4ZH8A 4IC6A 2QGRA 5EXNA 1AD8H 1QHRB 4JYUH 1BTHH 2JETB 4AFSA 1SFQB 1QB9A 1U6QA 2XCNA 1TNJA 1SLVB 4DURA 5ESTE 4FUEA 2FM2A 2P8OC 1AVWA 3M5OA 4JK5A 1ZTLA 2BD4A 4O03A 2G81E 4AB9A 2NU4E 2OXSA 3GY4A 2P3TB 5AVDA 3SNAA 1O2PA 1C5OH 4CRBA 2AMQA 2W7SA 1O5DH 1CBWC 1O2QA 3Q3KA 4JK6A 4AG2A 2C8WB 1JMOH 2BZ6H 2RA3A 3TH2H 4CHAC 2Y7ZA 1MCVA 2VWLA 2FOCA 1WU1A 1YGCH 2QXGA 3TITA 4B2CA 2XTTB 3A87A 4Q7XA 1RIWC 1HAPH 1V2OT 4FUCA 2QCYA 1O34A 4YESB 1A5HA 2B9LA 4WY3A 1DY8A 1GI0A 2GCHF 1L1GA 3UWJH 1ZYOA 3EQ0H 3B23B 4GVUA 1VR1H 2SGQE 1AQ7A 2EA3A 2FOHA 3GCHB 3IITA 1MQ5A 1DITH 2ZGCA 1HDTH 2CV3A 3BIUH 1LKAA 1O3OA 4YO9A 3EA8A 1XMNB 2SGEE 1C5ZB 1P3EA 1CQQA 4GCHG 1UTQA 2Z6BD 2Y80A 2BQWB 2C8YB 4Y0ZE 1NM6A 1ZHRA 2GKVE 4H6SB 5FHTA 4K1EA 1YF4A 3QDZB 1RS0A 5JB9S 1ZJKA 1PPEE 4GLYA 3DHKH 1T8LA 1C5YB 1TGSZ 1EJMA 2Z3EA 2PSXA 1EZSC 3E8LA 1C1PA 4UFFH 4X8TH 3LT3A 1Y3YA 1T32A 1LQEA 1ZOMA 1K1IA 1K28D 1BJUA 1EOLA 3GDVA 1KIGH 1MTSA 1A0LA 4R8TB 2BDYA 1AN1E 2UUKB 1SHYA 3RMOH 2H9TH 7LPRA 5C1XA 1YPLH 3LC5A 1Q2WA 1UTOA 5JBAS 1P04A 3AASA 3U1IB 4GCHF 4YOGA 4HZHA 2WPHS 1TNLA 2BD5A 2ALPA 1D4PB 1DE7H 1E34B 3TLOA 3STIA 1O39A 2O8MA 2G51A 8ESTE 1A5IA 1HCGA 1Z71A 3SNCA 1W7GH 2FX4A 3RMNH 2ZECA 2G00A 3KCGH 1B5GH 5GJ4B 2BQ7B 1TMUH 1PQ5A 1S6HA 1SQTA 2HOBA 1H8IH 2CGAA 2FYRA 4X8UH 6LPRA 4AX9H 1THPB 1V2WT 1TX7A 3MNCA 1YPJH 3UY9A 5AF9H 1HYLA 5E0HA 1P02A 1A3EH 3PV4A 2A1DB 2OUAA 3BTQE 5EQRA 1DS2E 1YPHE 3SJIA 2SGAA 1ANBA 1GGDB 1QR3E 1DPOA 3R0FA 1OP8A 3PROA 1G3BA 4NZQA 1GVZA 3RXBA 4YLUA 2BD3A 4K60A 3RXVA 3MH6A 2P95A 3M36A 4ZAEA 1C9PA 1J14A 1L1JA 1B7XB 1MUEB 2C4FH 4ZKNU 3RXCA 3MH4A 1TABE 1SQOA 4LZ4B 2Q1JA 1INCA 1UJ1A 3GCTF 5A8YA 1C1RA 1HJAC 1H1BA 3A84A 1P8VC 1O5EH 2WPLS 2C8XB 3DA9B 1MU8B 5E2PA 4INLA 1GL0E 3TVJB 4AOQA 3BN9A 1XM1A 3TPIZ 2PKAB 1T8NA 1HGTH 2TGPZ 5C5NA 1FY1A 1LO6A 1SGYE 5GCHF 4BANB 9LPRA 3FVFB 1O3KA 3BIVH 4WWYA 3MI4A 2QXIA 2A31A 2ZGXH 3MNXA 4ABIA 4D9RA 2ZNKH 1S84A 1DWBH 1K1PA 3UIRA 3RXIA 1A1RA 2FTLE 1QRXA 2BY5X 2Y81A 1PPFE 4HGCA 1ELCA 3U8TH 1KDQB 1J9CH 3MYWA 4ABAA 4NA9H 2UWPA 1C2MA 4UFEH 3SU3A 4NFEA 1AFQB 3ATLA 2ZHFH 3SGBE 5LGOA 1DSUA 4NSVA 1BBRK 1RTKA 4WH6A 2ODPA 1FUJA 1GJ5H 3GDSA 4ABJA 3OY5U 3F9GA 4B71A 1W14U 4H42U 1PPHE 1X7AC 2NWNA 3FZZA 1AHTH 4GHTA 7ESTE 3ZV9A 1GL1A 4YT6H 1BBRH 1LTOA 1NTPA 5FBEA 1IQNA 2OQ5A 3LGYA 2O9QA 3AAUA 4DT7B 1O3FA 3RU4D 1T7CA 1LQDB 2RA0A 2VIDA 3TIUA 1W2KH 3BEUA 3NPSA 3GY8A 4X6OA 2ZFRH 3QTOH 2BXTH 3RXSA 1GVKB 1UTNA 4AB8A 3BTFE 1O0DH 4ABFA 3TGJE 2BOKA 1G3CA 1CT4E 2EI8A 1OKXA 3KNXA 6ESTA 2PUQH 4NZLA 2ZGBH 5GIBA 1UHBA 2FI4E 2Z9KA 1IQMA 4Y8ZA 3SU2A 3K2UA 1N6XA 1ZHMA 1C1SA 1TX8A 1CSOE 1L4ZA 4WXVA 5F8TA 2BDBA 3M5MA 1KXEA 2WUCA 3TGIE 2XYAA 1CGJE 5K0HA 2GCTB 3SW2B 1P10A 4FUDA 2BLWA 2OBQA 1NRNH 2WV4A 1MH0A 5F6MA 2ZI2H 2GMTC 1MZAA 1AB9C 3SOSA 1Z1IA 4IN1A 3MHWU 2CJIA 4KKDA 4TY7A 3BEFB 2XC5A 3E3TA 2FOBA 3HK3B 4TWYA 5JBBS 1AFQC 1G3EA 1P2QA 1SBWA 2HGTH 1GI9B 3B8JA 2G5NA 5HGGA 1C9TA 3O8BA 3AW0A 1LPGB 4INHA 1FPHH 6CHAB 2WYGA 1NROH 2JH6D 1WTHD 1LHCH 3IG6B 3UWIA 4D76A 2I6SA 1P3CA 5FX5A 4AG1A 4D8NA 2ZIQH 3KF2A 1O2WA 3F9EA 1AIXH 4ASHA 4I8GA 1SLWB 1GBMA 5ABWA 6CHAC 1L4DA 3ZZBA 1XXFA 1BIOA 4K5ZA 4UD9H 1C2LA 3RC5A 3F68H 1SGFG 4D7FA 2J4IA 1P06A 1IOEA 5A8ZA 1NRPH 2Y5FA 2XBYA 1NFUA 1PQ8A 1BMNH 1HXEH 1ZTJA 1JRSA 3RXLA 1VGCB 2A2QH 3VGCC 2NU2E 3BTKE 3KL6A 4B73A 1C5NH 1S81A 1RRKA 2RDLA 4OS7A 3BTWE 3SJ9A 3FP8E 1AE5A 4K2YA 1QBNA 5EOKA 3SV8A 3ZZ5A 1QNJA 2OLGA 5T6GA 4X1RU 1DLEA 3JZ1B 4OS2A 3RXJA 1SGQE 2PGBB 1PQ7A 4TPIZ 1T8OA 4XBBA 3PLPA 4WF8A 4X2WA 2R9PA 3LGIA 3URCA 1Y3WA 1ANEA 5DGJA 2SGFE 4A6LA 1YPEH 3N7OA 3MO3A 1FAXA 3DT0H 2G55A 4PROA 4ZKRU 1OX1A 2Q6GA 4UFDH 4BAHB 4YLQH 5C5OA 1SGPE 2A4GA 1L1NA 4X2YA 1HLTH 1K1LA 4FVBA 3BTEE 3ZV8A 4CRGA 2GV6A 4KGAA 4UE7H 3HKJB 5TJXA 5I46H 1MTNB 2SNVA 1G32B 3PO1B 3JZ2B 1Z6EA 1S5SA 2QN5T 3UNQA 2AGEX 4ABHA 1CA0C 1V3XA 4X2VA 1A2CH 3SGQE 5E2OA 2QC2A 1AUTC 3MNSA 2P3FH 1SB1H 1XKBC 2SNWA 3SV9A 3BSQA 5FPYA 4Y7AA 3F1SB 1E38B 4MNYA 1CBWB 2UUFB 2ZDVH 4M7GA 1C2HA 1O3EA 2Y7XA
chains in the Genus database with same CATH superfamily
4MTBA 1O2MA 1IQLA 3GY6A 4ZHMU 1MAXA 5C94A 2BLOA 2Z9GA 4LXBH 5C67A 3VG8A 3P92A 4H4FA 1GG6C 3VGCB 1ANDA 5EQQA 4U2WA 1TLDA 1BTYA 2XNDD 3FOAA 3GICB 2PFEA 2VGCC 1SGTA 4XDEA 2GTBA 2M5TA 3GYLB 1ORFA 5C0TA 1Z8GA 3OAAD 8GCHG 3DSPA 1O2ZA 1O2OA 1G2MA 1GJ8B 1QL8A 2I6QA 5EXLA 4KP0A 1J17T 3SV6A 4ABBA 1FDPA 4Y10E 4CBOA 1LVYA 1SR5C 3H7TA 3LU9B 3MO9A 3HATH 2F91A 2XNIA 3QUMP 5CHAC 1O2IA 2OCVB 4FUGA 2A7JA 5GWZA 4DIIH 2XW9A 2GDEH 3DFLA 1ZJDA 2HPPH 2ZFQH 1C5RA 2ZTXA 3A8BA 2BY9X 2GV7A 4GHQA 1ESBA 1GGDC 1IQEA 4AGKA 1EATA 3GCOA 3U69H 2ODQA 1FONA 1SGIB 2P16A 3QTVH 1MKXK 3M37A 3TNTA 2FPZA 3KEEA 4HI3A 2BMGB 2Y5GA 3RXGA 3MWIU 2Z9JA 1P2KA 1LKBA 1A5GH 4NWLA 3M61U 1BA8B 1FMGA 1J16A 1ZMLA 2A7HA 1IQKA 1SVPA 2XOKD 3RXMA 1TE0A 4K8BA 2VINA 3LONA 2W7UA 2OP9A 1NRRH 2V6NA 2FZZA 4JCNA 1O2HA 4CRDA 4CRFA 3FO8D 2P8OB 2H5CA 2BTCE 3LDXH 1EAXA 1F0TA 1QJ7B 2VIOA 2YNAA 5EQSA 5TCCA 3SV7A 1HAZB 1LVOA 1FIZA 2L74A 3K6YA 1HJ9A 1ZGIA 1UW7A 3ELAH 4Y8YA 1V2VT 2R0LA 2PWXA 3A7ZA 1UCYK 1LVBA 4B1TA 2HPQH 5DP5A 5C0UA 1UVPA 4K1TA 3TNSA 2IJOB 2Q6FA 2Z7FE 3FAOA 1TRYA 3WWBA 3MU8A 4B6FA 2A5IA 1RIWB 4A1XA 3H5CB 2ZHEH 4I33A 1YPMH 3NWUA 1C4Y2 4JYTA 3CS0A 1W8BH 3RXOA 4WMDA 4NCYA 1UVOA 4O97A 4O9VA 3ZVAA 2AMPA 3V13A 4F4OC 1GHZA 1NPMA 2WPKS 4ZKSU 2G4TA 4BAOB 1ZRBA 1N8OB 1IQIA 1SGCA 3DFJA 1O3BA 2WPDD 3EE7A 4NIYA 3VB6A 1GBKA 1Z1JA 1UTJA 4Q7YA 4NIXA 1BMAA 3KQEA 3ENSB 3O8DA 3F3BA 2ZO3H 3S9CA 3BF6H 1T4VH 2CN0H 3MU1A 1D3DB 4FU8A 1D9IA 1RJXB 1C1VH 1LCYA 1V2KT 2QYIA 5HXFA 4X8VH 1TGBA 2HNTC 2A2XH 5EJ1A 3T62A 1Y5AT 1TOMH 4TWWA 4MNVA 4ZUHA 3LGTA 4J1YA 5FPSA 4I86A 1O3PB 3OFND 1AI8H 1YM0A 2VGCB 4YOJA 1YKTA 1GDNA 2Z3CA 1EZUC 3RXRA 2QF3A 1EP5A 1QA7A 5EW1H 1O2KA 1TB6H 3V7TA 1C5WB 1FY8E 3OSYA 3RXQA 1CO7E 1EP6A 1OWDA 2GZ9A 2JIZD 4Y76A 1QL9A 2QAAA 1TNKA 1YP9A 3PWBA 1ABJH 1FY4A 1TWXB 1LMWB 1Y3UA 3BTTE 3K9XB 1O5GH 1GHBF 3KQCA 2GD4B 4NGAH 4U32A 4E06H 3LC3A 1GI8B 2O8WA 3SO3A 3V3MA 1BT7A 1HAXB 1IQGA 2TBSA 1MD7A 1DX5M 3P8GA 2F9PA 1SFIA 3ODFA 2WSSD 5L6NH 1G2LA 3NUMA 1C4U2 1S0QA 1AB9B 4FUJA 1H8ED 2VIPA 3MMGA 5GNDA 2VIVA 1Y3VA 3A86A 3EA9A 1ELVA 2TGDA 3BTME 5F8ZA 2CMYA 3QLPH 4Y8XA 3SU1A 3VPKA 2D8WA 4WJG2 3ZZ6A 5T6FA 3LGVA 1GBFA 1BMFD 5C17A 1PJPA 1MCTA 1P12E 2FP7B 4FU7A 3UB0A 3H7OA 3ITIA 3L33A 4NIVA 3A8CA 3FP6E 2RFKC 5DP3A 1G3DA 1SOZA 2P94A 3EDXB 1P2IA 2PW8H 3UTUH 1S85A 3S0NA 1ID5H 1CT2E 2RG3A 3MO6A 1E79D 1D3TB 1ETTH 1D3QB 4WMEA 2ZDMA 3ZZ8A 1A46H 4X2XA 4E05H 3H09A 2VB0A 3LH3A 3FP7E 1F92A 2AS9A 4NA7A 5E0JA 1FQ3A 2YNBA 3U1JB 3MH7A 1NU7B 1YBWA 1O3DA 1GHAG 1QRWA 3QZRA 2H5DA 1MD8A 1CA8B 1O2XA 2KM0A 6GCHG 2BOHB 1V6DA 3Q00A 1ACBE 4HFPB 3SV2H 4Z0KA 4FUBA 3RUOA 2TRMA 2WV5A 1ARCA 3BG4B 1XUJA 3SORA 1DWEH 2DE9A 2M2AA 5T1VA 3NZIA 4TYDA 4NWKA 3LGWA 3SGAE 5LPFA 1HAVA 4NIWA 3Q3XA 1GHXH 3ZZCA 1SLUB 1TA6A 2ZU1A 2NU3E 3RXKA 3BG4C 4JMYA 2R3UA 5A8XA 3QN7A 4K69A 3S9AA 1HAOH 2A4RA 5E0GA 1IQHA 4I8LA 1LVMA 2R2WU 3T26A 1P57B 1F2SE 3NXPA 3M7UA 3MFJA 1GMHG 3ZVCA 4ZROA 2BDHA 1LHDH 1G30B 1SGDE 2F4LA 2SFAA 3F2HA 1E35B 1K9OE 2BVSH 3KQDA 3ZVEA 3QO6A 3QX5H 3AAVA 1O35A 3RM0H 1J8AA 4X6NA 1BTXA 1G9IE 1OWEA 2ZU3A 2JJ1D 4AORA 5HIYA 1MTUA 2IJD1 1S83A 1QFKH 1LHFH 1C5MD 4P00A 2FEQH 4X1NU 2F83A 2XWAA 3M3SA 5JYIA 4BTIB 2AH4X 3UQVA 1O3CA 1JOUB 1C1QA 1AKSB 1JIMA 1A3BH 1TGNA 4NG9H 1M9UA 4THNH 1NBMD 3GY3A 1EPTB 1C5QA 3AVZA 5F8XA 5EPYA 1DY9A 4FUFA 5EIYA 2ZF0H 3F9HA 1ELGA 1P09A 3BTDE 2D1JA 5A2MH 1CU1A 3M35A 1UTKA 3KQBA 3SU0A 2J5UA 2LNCA 1DVAH 3E91A 2V3OH 2GT7A 1SG8B 1AGJA 1HUTH 1NFWA 3ZZAA 3STJA 1YPHC 1HAHH 1TQ0B 1O31A 2W6JD 3GYMA 1PPGE 1BRUP 1TMTH 5CHAB 1TOCB 1MTNC 2ZPQA 4A1VA 1E1RD 1ZHPA 2AEIH 2STBE 2H6MA 1ARBA 1ZPBA 2SGDE 1O30A 4H6TA 1FZZA 4DGJA 1DOJA 3VXFH 1YC0A 2QF5A 4DW2U 1W0KD 2A5AA 1EAWA 1ZPCA 3LPRA 2C3SA 1Z6JH 2C93B 1Z8IB 3NRLA 1VJ9U 3A7YA 3UUZA 2BVRH 3NCLA 1O5FH 1P01A 5DK1A 1P2JA 2NU1E 1OXGA 3M5NA 2ZPRA 1GDUA 5A09A 1GBDA 1IQJA 4CR5A 2D2DA 1FPCH 2Z9IA 3MH5A 3QZQA 3HGPA 5IK2D 1FJSA 2A4OA 2OC7A 2QV1A 2H9HA 1C1UH 2BDIA 2CHAB 2F9OA 1O2TA 1O3NA 5HM2A 3K65B 4M9FA 5J4SA 1O3MA 1ZTKA 2JJ2D 2ZDAH 4MQAA 3P8NA 4DOQA 1RD3B 1YCPM 3D23A 1BRBE 4AGJA 2ZDNA 1WYKA 3ZYDA 1EPTC 4ZHLU 4RKOB 3P8FA 1FIWA 3VEQB 1YLDA 2QIQA 2BDAA 2ZDLA 3SUDA 1UVUH 1EB1H 1WQVH 1GBEA 1BQYA 1ANCA 4AFQA 3A7WA 3SUFA 1WV7H 3ATMA 2ZGJA 1O38A 2DE8A 4XD7D 4A1TA 2BHGA 1DXWA 3GCTG 1O32A 1XX9A 3R3GB 1AZZA 2O8UA 1K1MA 5JBCS 1QY6A 1AY6H 1FI8A 1LHGH 4SGBE 2ZU4A 1RXPA 1HJ8A 1FY3A 1K22H 2ANWA 1C5VA 1H8HD 3UNSA 2FS9A 3TH3H 1MAYA 3RLYH 3URDA 2AIPA 4I31A 1UTMA 2EI7A 3PLKA 4F49A 1MTVA 1GMCG 3ZZ9A 1MZDA 5A0BA 4VGCC 1EX3A 1HNEE 1JRTA 4ASUD 1XUKA 2BLVA 3ZVDA 1O33A 1W0YH 1THRH 4Q2KA 3E6PH 4DVAU 1C5SA 1RTFB 3HGNA 5FCKA 1HB0B 3I78A 3W1EA 2ODYB 5SGAE 1ZZZA 1EQ9A 1OWKA 3MTYA 3DSGA 3KQ5A 4QT8C 5HYOA 3P8OA 1GJ9B 3TGKE 3SU6A 1W13U 1GBTA 4B75A 3CENA 1DSTA 3PM3A 2J97A 4MVNA 5HM9A 1C1TA 4CH2B 2BB4A 1B0EA 1EZQA 1HAVB 5EG4A 9ESTA 2HVXA 2BD8A 1ELBA 4WMFA 2QF4A 1C2GA 1F0RA 4LZ1H 1F7ZA 1OYTH 3BV9B 1C5XB 2R2MB 2FDAA 1GMDG 1C2KA 1OP0A 3E16B 4BNRA 1MBQA 2Y6TA 1BDAA 1LDTT 1QQUA 3BG8A 4Q63A 3I77A 3RP2A 3TK9A 1BJVA 3ZZ4A 2ZFSA 1AO5A 4ISNA 3PB1E 1KYNA 1O5CB 3RXFA 3GISB 2YMSC 1ZGVA 4Z6AH 3PO1C 2Z94A 8LPRA 1PPBH 3OY6U 2ZHWH 3ZZDA 5LH8A 3MOCA 2F9VA 3T2NA 1KXFA 1ZR0A 4VGCB 4DG4A 1TYNA 3SI4H 1O2YA 4INKA 4KTUA 2G8TA 1ZRKA 1P2MA 4I8KA 3RU4T 3L6PA 4CR9A 1SOTA 1FV9A 4I32A 1Z8JB 1GBIA 3PMAB 3U98H 1EKBB 3P17H 4AFZA 3SZNA 1NN6A 2GZ7A 1YYY1 1KXCA 3SU5A 2BY6X 5LPRA 3F6UH 1SPJA 2JH0D 1XUFA 2AFQB 4FVDA 1BITA 5HIZA 4Y7BA 1Y5UT 5BPEA 1VCWA 3M5LA 5GXPA 3A80A 3KIDU 3SU4A 1O3GA 3TK5A 2ALVA 1TQ7B 3RXUA 2A4QA 1AKSA 2A0QB 3FZDA 1YY3A 1DM4B 2AHME 3DCLA 2ZU5A 1KSNA 1GHYH 2XBXA 5CDFE 5AHGH 1D3PB 2FLRH 4BAQB 2BD2A 3PYHA 4X0WU 2P59A 1NO9H 3GS9A 1EPTA 1Q31A 2Z3DA 3WW7A 2BM2A 4R0IA 1WSSH 4Y79A 5L2YH 1UK4A 3PV5A 3CS7A 1TONA 5HMAA 3ZZ3A 3ZYEA 2GCHG 1O2SA 2XC4A 2ZCLP 4OS1A 3BTGE 4XOJA 5T3HA 1HXFH 3C1KA 3P70B 4MPVA 1HPGA 1A0JA 2WPMS 1VITH 5EU8A 3NK8A 1TNIA 1GDQA 2BDCA 3VB5A 5ESBA 4B2AA 4ABDA 3QK1A 3MNBA 2XBWA 3KN2A 1OP2A 1ZSKA 5IYTA 1V2JT 3QWCH 2ZP0H 2FYQA 4JYVH 4OS4A 5IDKA 2BY7X 1Y59T 2FI3E 1O5BB 1SMFE 4X1QU 4I8JA 4NSYA 1W12U 2WINI 4WXIA 5C1UA 5FCRA 2EC9H 2ZFPH 1HAGE 1UK2A 4U01A 1DWDH 3ATWA 3DD2H 2PUXB 3RM2H 2PLXA 2PTNA 1BUIA 2GP9B 1DFPA 5DP7A 2ZFFH 2AGIX 1QJ6B 1ZMNA 2WPIS 1TA2A 1AVGH 1OS8A 4JZIA 4NA8A 4WH8A 2KCAA 1COWD 2PKAA 1TGTA 1LPZB 5AFZH 2C90B 4JZEH 1LHEH 4RSPA 4ISIH 1JWTA 1XKAC 2A32A 3OU0A 1EAUA 1KXBA 3PTBA 3EE0B 4IMQA 2C8ZB 1DDJA 3NKKA 1NU9A 2ZQ1A 2CXVA 4IGDA 1IAUA 2BYAX 1N8OC 5A0CA 1V2UT 3F2FA 3E0NB 3ZZ7A 1QBOA 1YCPH 5F03A 2BX4A 3ZVBA 1T8MA 2J98A 3PRDA 1O3IA 2AMDA 2YOLA 2FI5E 1ZLRA 4MNWA 2FX6A 2P3UB 2V3MA 1WOFA 4ACAA 4FU9A 4DY7B 1A7SA 3F0OA 1HBTH 4J2YB 1XVMA 1OWHA 4YOIA 3T28A 1C1WH 1QJ1B 5LPEA 1DT2A 1N1LA 2YMSB 1AMHA 3ZVFA 4Q7ZA 2K8IA 1TFXA 1T4UH 1W3CA 3EGKH 5BRRE 1XUHA 3I29A 5FX6A 1WXRA 4BXWA 2ZTZA 2FOAA 2PV9B 3UOPA 1TX6A 1UO6A 2FLBH 2ZKSA 2EY4C 4CRAA 3LKWA 1ABIH 2G5VA 1CE5A 4ZHAA 1FXYA 3TJNA 4F48B 8GCHF 3T27A 3UNRA 4X1SU 1KTSB 4JZFH 5FL7D 1O2UA 5GCHG 1P05A 3SUEA 2UWLA 1HRTH 3MU4A 1GHWH 1ELFA 4OS5A 4TT3D 1P03A 2AIQA 4I7YH 2FMJA 1AFEH 1ETSH 2GT8A 4RKJB 2FXRA 1VGCC 2EQNA 4UONA 1VCQA 3CNRA 3UR9A 3PMJA 4CBNA 1O3AA 2QA9E 2VIQA 4BOHA 4UFGH 1MMJN 2ZFTA 1XVOA 1OSSA 1AWFH 2ZWLH 3O8RA 4TY6A 2ZCHP 1S6LA 1EAIA 1OWJA 1W11U 2SGPE 3RC4A 1EASA 4ISHH 1H8DH 2PTCE 1A61H 1GCDA 5JB8S 5GPIB 7KMEH 2GX4A 3Q77A 3A82A 1WAYB 1YPKH 2BD9A 1C5TA 2VH6A 1MTWA 1BMLA 1TRMA 1KLJH 1YWUA 2QXJA 3EAJA 1WTGH 2H2ZA 3SBKA 1RGQA 4GSOA 2KR7A 1QB6A 2FWWA 3OYPA 1E1QD 1YPGH 1GI2A 4CH8B 1H9HE 2VWNA 1ETRH 5C20A 1GI4A 1W10U 1MU6B 1K1NA 1KY9A 4CRCA 2KZ4A 1PQAA 2TGTA 1GCTC 3GY2A 4X6MA 1V2NT 3D65E 3DUXH 1QIXB 3SN8A 1SLXB 3FANA 1O2JA 2PGQB 2ZG0H 4AYYB 2BX3A 5AFYH 1TBRH 1Z8RA 2EI6A 4MDSA 4KTCA 3T25A 1DUEA 4Y11E 1MBMA 2O8LA 5A0AE 1TNHA 3LJOA 3PMBB 3ATIA 1UVSH 2OD3B 3TK6A 1FN6A 2UWOA 3KHVA 1TBQH 3P95A 2ZZUH 3S7HB 4MPUA 2YMSD 4WVPE 2XXLA 2D26C 4DCDA 3Q3YA 1E0FD 3TU7H 4UEHH 1C2FA 2EEKA 1V2RT 1O5AB 1GVLA 3D62A 1BTWA 1C5PA 4F55A 3RLWH 2JH5D 2ZQ2A 1VKYA 2AYWA 1GWAA 1AE8H 1UTLM 2R0KA 1NFYA 4YZUA 4BAMB 1SGRE 1DANH 1FNIA 3W95A 1PPCE 1O37A 1OOKB 2ZTYA 1TPOA 3A83A 4ISOA 1Y8TA 2KCPA 1O3JA 5F53A 1HAYB 2ZDKA 1SGEE 3W94A 3PWCA 1ZPZA 1GJDB 1GI1A 3C27B 1ELAA 4D9QA 1P9SA 4IS5A 1NFXA 4IBLH 4LK4A 2PSYA 1HIAB 3TJVA 1KDQA 3B9FH 2F9BH 2KCYA 1AWHB 4CREA 1ZMJA 1IHSH 2ANYA 2WYJA 2B7DH 2AGGX 5L30H 1BB0B 1P11E 1IQFA 5TCAA 5FAHA 3GY7A 4O3UA 5KECA 3V0XA 2FS8A 3OTJE 4BXSA 1GCTB 1Z7KA 8KME2 1BHXF 1GBLA 2B8OH 4DT4A 2IN2A 3VXEH 1H4WA 2W5EA 2K1QA 3RU4E 2FIRH 2AERH 4KTSA 2Q6DA 1KMHB 1GHBG 1O3HA 2B0FA 4DIHH 1BOQA 4U30A 1EOJA 5DSFA 4FOUC 3AW1A 3TH4H 1C2JA 3HPTB 3SI3H 4E7RG 1TPPA 3TJOA 2OINA 1QBVH 1NESE 3ODDA 1QURH 2HRVA 2UUJB 3E0PB 2G52A 2HLDD 3IWMA 1EB2A 3EYDA 1PYTC 1W0JD 2GVFA 1DWCH 2V0BA 1GI3A 2KAIB 3RDZA 2QF0A 2KAIA 4MG3A 6GCHF 5FPTA 1V2LT 3A7XA 1TALA 3N7DA 2NU0E 1W7XH 1DXPA 1V2PT 4OGYA 1KXDA 4X8SH 4AYVB 4RI0A 1CVWH 1BBRE 1QCPA 3SUGA 4MPXA 4Q80A 4B74A 2FOFA 4E7NA 1SI5H 4GAWA 2JETC 1KLIH 1WCZA 2ZCKP 1K21H 2KX4A 2VIWA 2Z9LA 1EUFA 1SHHB 2J95A 5E8EH 3HKIB 1H9LB 2VVVA 1GBBA 1CGHA 5H4IB 1TIOA 3HK6B 1C1NA 4Y6DA 2HALA 3UREA 2FOGA 1Y5BT 3RXHA 2UUYA 1TMBH 1O2VA 2WPJS 3QGNB 1P2OA 3GOVB 4ZXXH 3A88A 1C1OA 4MNXA 2GGVB 4D7GA 4ZKOU 4ZMAH 1UVTH 2GJGA 4YXWD 2LP6A 1J15A 1CA0B 4AZ2B 1SQAA 2HNTE 3S69A 2R3YA 4CHAB 2FTMA 1BTPA 5DPAA 1ZSJA 5EXMA 1GBCA 1VITG 1Q3XA 1QA0A 4YTAA 5EODA 1WUNH 3KYFA 4FXGH 1BHXB 1C5UA 2VJ1A 2VWMA 1C5LH 5PTPA 2KCOA 1UHBB 4YM9A 2GDDA 1L2EA 5JBTA 2F9NA 2ANMH 1WBGB 2F3CE 3M3TA 2J9NA 1BTZA 1PYTD 3A7VA 3PTNA 5G4BA 1P0SH 1PPZA 1C2EA 2W3IA 7GCHF 5DP9A 3U8RH 3A89A 1SGFA 2W26A 1BZXE 1GG6B 1VZQH 2RDEA 2J2UA 1SC8U 4JZ1A 1GJCB 1GJBB 4OGXA 1S82A 1NRQH 1N6YA 1KXAA 2V3HH 3A7TA 1TAWA 4B76A 3E90B 4BAKB 2A7CA 4ESTE 5J4QA 3GCNA 7GCHG 3N7EA 2XC0A 4XE4A 3LOXA 1F0SA 4TPYA 2TPIZ 1AVXA 5DKMA 1O3LA 3OX7U 2CF9H 2QXHA 3Q76A 4IMZA 1DLKB 1B0FA 1VJAU 1UCYH 3SJ8A 1V2TT 1GJ4H 3RXEA 5FBIA 1L0ZA 4IW4E 1BMMH 1W0ZU 2WUBA 2FOEA 1WQSA 3A85A 2PKSC 4X1PU 1OPHB 2DUCA 5EW2H 2STAE 3ATKA 3GDUA 1A0HB 1FAKH 1FY5A 2VWOA 3ZVGA 5L2ZH 1CGIE 2BY8X 2JKHA 2VBCA 1V2MT 2OBOA 3LIWA 5C2ZA 3VB7A 1QGFA 1EJAA 2PKSB 2XRCA 3P6ZB 1JBUH 4XBDA 3SNEA 3VB3A 2J92A 2RCEA 2VVUA 1MQ6A 1GI5A 2BZAA 1OYQA 2W6ID 3DSOA 5C3NA 1BRAA 2A45B 2XBVA 2OQUA 2OC1A 3AK5A 3FFGA 1QTFA 1ESTA 3FKSD 4K8YA 1O2GH 4B2BA 4UDWH 1CHOF 5DG6A 2GCTC 3RXTA 3OE7D 1F0UA 1UCYE 2FESH 5EGMA 2P93A 1C2DA 2ZPSA 1S0RA 2TGAA 3D49H 3MU5A 2ASUB 4JZDH 2GMTB 3SYJA 3E1XB 1XUGA 1JIRA 2XCFA 1QQ4A 1CHOG 1ESAA 5C1YA 4XSKU 3PLBA 1H9IE 1NZQH 1GBHA 5K7RA 4BTTB 4FUHA 3GCHC 2H9EH 3F0PA 1EJNA 3K6ZA 2FO9A 3BEIB 3U8OH 3SQEE 1GJAB 1P2NA 2G4UA 3RXDA 1IHTH 1GMHF 5JPMH 1MKXH 1XUIA 4OS6A 1K0HA 1G37A 5FXLA 3RXAA 1TGCA 1C1MA 1D6RA 2TIOA 3G01A 2Y82A 3T5FH 2ANKH 3CP7A 2A5KA 1C2IA 3OEED 2OTVA 1EFRD 3PMHB 4AFUA 1NC6A 3WY8A 1SGNE 2L6OA 1DUAA 2VU8E 2BXUH 3A8DA 5T6DA 1HAIH 3S9BA 3S7KB 1O2LA 2H1UA 1MKWK 3SJKA 1NT1A 2ZEBA 1YLCA 4A92A 1AUJA 1K2I1 1V2QT 5B6OA 1RFNA 1TPAE 1FLEE 1G36A 4ABGA 1O2NA 1LPKB 5GDSH 1C4V2 2V35A 4RT1A 2BQ6B 4Q4LA 4X6PA 2IOTA 3LH1A 4ISLA 2FOMB 2BLQA 1KLTA 1PFXC 1QB1A 3ZIAD 1GBJA 2BD7A 2IPHA 1SL3A 2CHAC 4IN2A 3UPEA 1F5KU 1K1OA 2OK5A 2F9UA 2W3KA 1TBZH 5DP4A 1SSXA 2CF8H 1MKWH 3QGJA 3KGPA 2J94A 1VCPA 1TRNA 4NFFA 1QZ8A 1TPSA 1K1JA 3SHCH 3SJOA 3SNDA 1HJAB 2F43B 4MLFB 4RN6A 1SQRA 3SNBA 2O8TA 4SGAE 3SHAH 1BRCE 2XWBI 4OM9A 2IPQX 4YT7H 2ZA5A 1JXPA 2THFB 3UR6A 2ZHDA 1QL7A 1OHHD 1OWIA 4GPGA 1SKYE 2J38A 2ZC9H 4BTUB 1GJ7B 2HWLB 1FN8A 1GI6A 4O3TA 1GJ6A 1AU8A 1GHVH 1DICA 1NRSH 4XFQA 1KTTB 3V12A 5EPNA 2ILNA 1P9UA 4ABEA 1BCUH 1BTUA 3VB4A 5CE1A 2PR3A 2Y5HA 3UQOA 3VFEA 2OC0A 4XBCA 4GUXA 3A8AA 1ELEE 4I8HA 1UK3A 3L3TA 1GMDF 3U9AH 1UMAH 3UOUA 1F5RA 1T31A 3TJUA 1GMCF 1RTLA 2VH0A 2J34A 1UTPA 5DP6A 3RMMH 1NS3A 3MU0A 1ELTA 3RMLH 4Y71A 1D6WA 2PHBA 2ULLA 4FUIA 5JDUB 5DO4H 1NY22 2VVCA 1A4WH 1WDIA 4DJZB 2QY0B 4LOYH 1XXDA 2LPRA 2ZGHA 4ZXYH 1EZXC 3EA7A 3UFAA 1E37B 1GBAA 1O2RA 2ZHQH 1S6FA 1VITF 3LJJA 3SQHE 2WZQA 3LGUA 3F9FA 4AN7A 3T29A 2ESTE 2FODA 3M7QA 3RC6A 4FETA 2VNTA 1O36A 1CHGA 1ZSLA 3ESTA 1THSH 5CHBA 3A81A 2ZU2A 1ELDE 4A7IB 1F5LA 2OC8A 3N99A 4IC5A 1GI7B 1V2ST 3RXPA 3M7TA 1HV7A 1YCPK 3GY5A 5DJ7A 2HNTF 5DP8A 2GZ8A 1AZ8A 4Y0YE 1E36B 2HLCA 3O8CA 4HTCH 2BDGA 3SZEA 5I25A 1QRZA 2BVXH 3M3VA 4A5TS 1GHAF 1NBME 4KELA 4K3JA 1EXFA 1CT0E 5CMXH 1GPZA 1Y3XA 3BTHE 1HFDA 4MPWA 5ETXA 1HIAA 4K1SA 5EJZA 1TNGA 2B5TB 4ZH8A 4IC6A 2QGRA 5EXNA 1AD8H 1QHRB 4JYUH 1BTHH 2JETB 4AFSA 1SFQB 1QB9A 1U6QA 2XCNA 1TNJA 1SLVB 2J98B 4TSFD 5ESTE 4DURA 4FUEA 2FM2A 2P8OC 1AVWA 2JDID 3M5OA 1ZTLA 4JK5A 2BD4A 4O03A 2G81E 4AB9A 2NU4E 2OXSA 3GY4A 2P3TB 5AVDA 3SNAA 1O2PA 1C5OH 4CRBA 5DN6D 2AMQA 2W7SA 1O5DH 3F2GA 1CBWC 1O2QA 3Q3KA 4JK6A 4AG2A 2C8WB 1JMOH 2BZ6H 2RA3A 3TH2H 4CHAC 2Y7ZA 1MCVA 2VWLA 2FOCA 1WU1A 1YGCH 2QXGA 3TITA 4B2CA 2XTTB 3A87A 4Q7XA 1RIWC 1HAPH 1V2OT 4FUCA 2QCYA 1O34A 4P02A 4YESB 1A5HA 2B9LA 4WY3A 1DY8A 1GI0A 2GCHF 1L1GA 3UWJH 1ZYOA 3EQ0H 3B23B 4GVUA 3WWFA 1VR1H 2SGQE 1AQ7A 2EA3A 2FOHA 3GCHB 3IITA 1MQ5A 1DITH 2ZGCA 1HDTH 2CV3A 1MABB 4RT0A 3BIUH 1LKAA 1O3OA 4YO9A 3EA8A 4AC9A 1XMNB 2SGEE 1C5ZB 1P3EA 1CQQA 4GCHG 1UTQA 2Z6BD 2Y80A 2PP6A 2BQWB 2WV9A 2C8YB 2HVYB 4Y0ZE 1NM6A 1ZHRA 2GKVE 4H6SB 5FHTA 4K1EA 3U28C 1YF4A 3QDZB 1RS0A 5JB9S 1ZJKA 1PPEE 4GLYA 3DHKH 1T8LA 1C5YB 1TGSZ 1EJMA 2Z3EA 2PSXA 3OEHD 1EZSC 3E8LA 1C1PA 4ZCNA 4UFFH 4X8TH 3LT3A 1Y3YA 1T32A 1LQEA 1ZOMA 1K1IA 1K28D 1BJUA 1EOLA 3GDVA 1KIGH 1MTSA 1A0LA 4R8TB 2BDYA 1AN1E 2UUKB 1SHYA 3RMOH 2H9TH 7LPRA 5C1XA 1YPLH 3LC5A 1Q2WA 1UTOA 5JBAS 1FX0B 1P04A 3AASA 4GCHF 3U1IB 4YOGA 4HZHA 5KGOA 2WPHS 1TNLA 2BD5A 2ALPA 1D4PB 1DE7H 1E34B 3TLOA 3STIA 1O39A 2O8MA 2G51A 8ESTE 1A5IA 1HCGA 1Z71A 3SNCA 1W7GH 2FX4A 3RMNH 2ZECA 2G00A 3KCGH 1B5GH 5GJ4B 2BQ7B 1TMUH 1PQ5A 1S6HA 1SQTA 2HOBA 1H8IH 2CGAA 2FYRA 4X8UH 2KFWA 2QE7D 6LPRA 4AX9H 1THPB 1V2WT 1TX7A 3MNCA 1YPJH 3UY9A 5AF9H 1HYLA 5E0HA 1P02A 1A3EH 3PV4A 2A1DB 2OUAA 3BTQE 5EQRA 1DS2E 1YPHE 3SJIA 2SGAA 1ANBA 1GGDB 1QR3E 1DPOA 3R0FA 1OP8A 3PROA 1G3BA 4NZQA 1GVZA 3RXBA 4YLUA 2BD3A 4K60A 3RXVA 3MH6A 2P95A 3M36A 4ZAEA 1C9PA 1J14A 1L1JA 1B7XB 1MUEB 2C4FH 4ZKNU 3RXCA 3MH4A 1TABE 1SQOA 4LZ4B 2Q1JA 1INCA 1UJ1A 3GCTF 5A8YA 1C1RA 1HJAC 1H1BA 3A84A 1P8VC 1O5EH 2CK3D 2WPLS 2C8XB 3DA9B 1MU8B 5E2PA 4INLA 1GL0E 3TVJB 4AOQA 3BN9A 1XM1A 3TPIZ 2PKAB 1T8NA 1HGTH 5KEDA 2TGPZ 5C5NA 1FY1A 1LO6A 1SGYE 5GCHF 4BANB 5HKKD 2K0QA 9LPRA 3FVFB 1O3KA 3BIVH 4WWYA 3MI4A 2QXIA 2A31A 2ZGXH 3MNXA 4ABIA 4D9RA 2ZNKH 1S84A 1DWBH 1K1PA 3UIRA 3RXIA 1A1RA 2FTLE 1QRXA 2BY5X 2Y81A 1PPFE 4HGCA 1ELCA 3U8TH 1KDQB 1J9CH 3MYWA 4ABAA 4NA9H 2UWPA 1C2MA 4UFEH 3SU3A 4NFEA 1AFQB 3ATLA 2ZHFH 3SGBE 5LGOA 1DSUA 4NSVA 1BBRK 1RTKA 4WH6A 2ODPA 1FUJA 1GJ5H 3GDSA 4ABJA 3OY5U 3F9GA 4B71A 1W14U 4H42U 1PPHE 1X7AC 2NWNA 3FZZA 1AHTH 4GHTA 7ESTE 3ZV9A 1GL1A 4YT6H 1BBRH 1LTOA 1NTPA 5FBEA 1IQNA 2OQ5A 3LGYA 2O9QA 3AAUA 4DT7B 1O3FA 4XRNA 3RU4D 1T7CA 1LQDB 2RA0A 2VIDA 3TIUA 1W2KH 3BEUA 3NPSA 3GY8A 4X6OA 2ZFRH 3QTOH 2BXTH 3RXSA 1GVKB 1UTNA 4AB8A 3BTFE 1O0DH 4ABFA 3TGJE 2BOKA 1G3CA 1CT4E 2EI8A 1OKXA 3KNXA 6ESTA 3PV2A 2PUQH 4NZLA 2ZGBH 5GIBA 1UHBA 3UAIC 2FI4E 2Z9KA 1IQMA 2WHXA 4Y8ZA 3SU2A 3K2UA 1YLNA 1N6XA 1ZHMA 4Z1MD 1C1SA 1TX8A 1CSOE 1L4ZA 4WXVA 5F8TA 2BDBA 3M5MA 1KXEA 2WUCA 3TGIE 2XYAA 1CGJE 5K0HA 2GCTB 3SW2B 1P10A 4FUDA 2BLWA 2OBQA 1NRNH 2WV4A 1MH0A 5F6MA 2ZI2H 3MQKC 2GMTC 1MZAA 1AB9C 3SOSA 1Z1IA 4IN1A 3MHWU 2CJIA 4KKDA 4TY7A 3BEFB 2XC5A 3E3TA 2FOBA 3HK3B 4TWYA 5JBBS 1AFQC 1G3EA 1P2QA 1SBWA 2HGTH 1GI9B 3B8JA 2G5NA 5HGGA 4ACBA 1C9TA 3O8BA 3AW0A 1LPGB 4INHA 1FPHH 6CHAB 2WYGA 1NROH 2JH6D 1WTHD 5EJLA 1LHCH 3IG6B 4HG6A 3UWIA 4D76A 2I6SA 1P3CA 5FX5A 4AG1A 4D8NA 2ZIQH 3KF2A 1O2WA 3F9EA 1AIXH 4ASHA 4I8GA 1SLWB 1GBMA 5ABWA 6CHAC 1L4DA 3ZZBA 1XXFA 1BIOA 4K5ZA 4UD9H 1C2LA 3RC5A 3F68H 1SGFG 4D7FA 2J4IA 1P06A 1IOEA 5A8ZA 1NRPH 2Y5FA 3OTPA 2XBYA 1NFUA 1PQ8A 1BMNH 1HXEH 1ZTJA 5B6LA 1JRSA 3RXLA 1VGCB 2A2QH 3VGCC 2NU2E 3BTKE 3KL6A 3KYGA 4B73A 2V7QD 1C5NH 1S81A 1RRKA 2LELA 2RDLA 3BTWE 4OS7A 3SJ9A 3FP8E 1AE5A 4K2YA 1QBNA 5EOKA 3SV8A 3ZZ5A 1QNJA 2OLGA 5T6GA 4X1RU 1DLEA 3JZ1B 4OS2A 3RXJA 1SGQE 2PGBB 1PQ7A 4TPIZ 1T8OA 4XBBA 3PLPA 4WF8A 4X2WA 2R9PA 3LGIA 3URCA 1Y3WA 1ANEA 5DGJA 2SGFE 4A6LA 1YPEH 3N7OA 3MO3A 1FAXA 3DT0H 2G55A 4PROA 4ZKRU 1OX1A 2Q6GA 4UFDH 4BAHB 4YLQH 5C5OA 1SGPE 2A4GA 1L1NA 4X2YA 1HLTH 1K1LA 4FVBA 3BTEE 3ZV8A 4CRGA 2GV6A 4KGAA 4UE7H 3HKJB 5TJXA 5I46H 1MTNB 2SNVA 1G32B 3PO1B 3PRBA 3JZ2B 1Z6EA 2QN5T 1S5SA 3UNQA 2AGEX 4ABHA 1CA0C 1V3XA 4B6EA 4X2VA 1A2CH 3SGQE 5E2OA 2QC2A 1AUTC 3MNSA 2P3FH 1SB1H 1XKBC 2SNWA 3SV9A 3BSQA 5FPYA 4Y7AA 3FN8A 3F1SB 1E38B 4MNYA 1CBWB 2UUFB 2ZDVH 4M7GA 1C2HA 1O3EA 2Y7XA
chains in the Genus database with same CATH topology
4MTBA 1O2MA 1IQLA 3GY6A 4ZHMU 1MAXA 2BLOA 2Z9GA 4LXBH 5C67A 3P92A 4H4FA 1GG6C 3VGCB 1ANDA 5EQQA 4U2WA 1TLDA 1BTYA 3GICB 2PFEA 2VGCC 1SGTA 4XDEA 2GTBA 2M5TA 3GYLB 1ORFA 1Z8GA 8GCHG 1O2ZA 1O2OA 1G2MA 1GJ8B 1QL8A 2I6QA 5EXLA 4KP0A 1J17T 3SV6A 4ABBA 1FDPA 4Y10E 4CBOA 1LVYA 1SR5C 3H7TA 3LU9B 3MO9A 3HATH 2F91A 2XNIA 3QUMP 5CHAC 1O2IA 2OCVB 4FUGA 2A7JA 5GWZA 4DIIH 2XW9A 2GDEH 3DFLA 1ZJDA 2HPPH 2ZFQH 1C5RA 2ZTXA 3A8BA 2BY9X 2GV7A 4GHQA 1ESBA 1GGDC 1IQEA 4AGKA 1EATA 3GCOA 3U69H 2ODQA 1FONA 1SGIB 2P16A 3QTVH 1MKXK 3M37A 3TNTA 2FPZA 3KEEA 4HI3A 2BMGB 2Y5GA 3RXGA 3MWIU 2Z9JA 1P2KA 1LKBA 1A5GH 4NWLA 3M61U 1BA8B 1FMGA 1J16A 1ZMLA 2A7HA 1IQKA 1SVPA 3RXMA 1TE0A 4K8BA 2VINA 3LONA 2W7UA 2OP9A 1NRRH 2V6NA 2FZZA 4JCNA 1O2HA 4CRDA 4CRFA 2P8OB 2H5CA 2BTCE 3LDXH 1EAXA 1F0TA 1QJ7B 2VIOA 2YNAA 5EQSA 5TCCA 3SV7A 1HAZB 1LVOA 1FIZA 3K6YA 1HJ9A 1ZGIA 3ELAH 4Y8YA 1V2VT 2R0LA 2PWXA 3A7ZA 1UCYK 1LVBA 4B1TA 2HPQH 5DP5A 1UVPA 4K1TA 3TNSA 2IJOB 2Q6FA 2Z7FE 3FAOA 1TRYA 3MU8A 2A5IA 1RIWB 4A1XA 3H5CB 2ZHEH 4I33A 1YPMH 3NWUA 1C4Y2 4JYTA 3CS0A 1W8BH 3RXOA 4WMDA 4NCYA 1UVOA 4O97A 4O9VA 3ZVAA 2AMPA 3V13A 4F4OC 1GHZA 1NPMA 2WPKS 4ZKSU 2G4TA 4BAOB 1ZRBA 1N8OB 1IQIA 1SGCA 3DFJA 1O3BA 4NIYA 3VB6A 1GBKA 1Z1JA 1UTJA 4Q7YA 4NIXA 1BMAA 3KQEA 3ENSB 3O8DA 2ZO3H 3S9CA 3BF6H 1T4VH 2CN0H 3MU1A 1D3DB 4FU8A 1D9IA 1RJXB 1C1VH 1LCYA 1V2KT 2QYIA 5HXFA 4X8VH 1TGBA 2HNTC 2A2XH 3T62A 1Y5AT 1TOMH 4TWWA 4MNVA 4ZUHA 3LGTA 4J1YA 5FPSA 1O3PB 1AI8H 1YM0A 2VGCB 4YOJA 1YKTA 1GDNA 2Z3CA 1EZUC 3RXRA 2QF3A 1EP5A 1QA7A 5EW1H 1O2KA 1TB6H 3V7TA 1C5WB 1FY8E 3OSYA 3RXQA 1CO7E 1EP6A 1OWDA 2GZ9A 4Y76A 1QL9A 2QAAA 1TNKA 1YP9A 3PWBA 1ABJH 1FY4A 1TWXB 1LMWB 1Y3UA 3BTTE 3K9XB 1O5GH 1GHBF 3KQCA 2GD4B 4NGAH 4U32A 4E06H 3LC3A 1GI8B 2O8WA 3SO3A 3V3MA 1BT7A 1HAXB 1IQGA 2TBSA 1MD7A 1DX5M 3P8GA 2F9PA 1SFIA 3ODFA 5L6NH 1G2LA 3NUMA 1C4U2 1S0QA 1AB9B 4FUJA 2VIPA 3MMGA 2VIVA 1Y3VA 3A86A 3EA9A 1ELVA 2TGDA 3BTME 5F8ZA 2CMYA 3QLPH 4Y8XA 3SU1A 3VPKA 2D8WA 4WJG2 3ZZ6A 5T6FA 3LGVA 1GBFA 1PJPA 1MCTA 1P12E 2FP7B 4FU7A 3H7OA 3ITIA 3L33A 4NIVA 3A8CA 3FP6E 5DP3A 1G3DA 1SOZA 2P94A 3EDXB 1P2IA 2PW8H 3UTUH 1S85A 3S0NA 1ID5H 1CT2E 2RG3A 3MO6A 1D3TB 1ETTH 1D3QB 4WMEA 2ZDMA 3ZZ8A 1A46H 4X2XA 4E05H 2VB0A 3LH3A 3FP7E 1F92A 2AS9A 4NA7A 5E0JA 1FQ3A 2YNBA 3U1JB 3MH7A 1NU7B 1YBWA 1O3DA 1GHAG 1QRWA 3QZRA 2H5DA 1MD8A 1CA8B 1O2XA 6GCHG 2BOHB 1V6DA 3Q00A 1ACBE 4HFPB 3SV2H 4Z0KA 4FUBA 3RUOA 2TRMA 2WV5A 1ARCA 3BG4B 1XUJA 3SORA 1DWEH 2DE9A 3NZIA 4TYDA 4NWKA 3LGWA 3SGAE 5LPFA 1HAVA 4NIWA 3Q3XA 1GHXH 3ZZCA 1SLUB 1TA6A 2ZU1A 2NU3E 3RXKA 3BG4C 4JMYA 2R3UA 5A8XA 3QN7A 4K69A 3S9AA 1HAOH 2A4RA 5E0GA 1IQHA 4I8LA 1LVMA 2R2WU 3T26A 1P57B 1F2SE 3NXPA 3M7UA 3MFJA 1GMHG 3ZVCA 4ZROA 2BDHA 1LHDH 1G30B 1SGDE 2SFAA 1E35B 1K9OE 2BVSH 3KQDA 3ZVEA 3QO6A 3QX5H 3AAVA 1O35A 3RM0H 1J8AA 4X6NA 1BTXA 1G9IE 1OWEA 2ZU3A 4AORA 1MTUA 1S83A 1QFKH 1LHFH 1C5MD 2FEQH 4X1NU 2F83A 2XWAA 3M3SA 5JYIA 4BTIB 2AH4X 3UQVA 1O3CA 1JOUB 1C1QA 1AKSB 1JIMA 1A3BH 1TGNA 4NG9H 1M9UA 4THNH 3GY3A 5F8XA 1EPTB 1C5QA 3AVZA 5EPYA 1DY9A 4FUFA 2ZF0H 3F9HA 1ELGA 1P09A 3BTDE 2D1JA 5A2MH 1CU1A 3M35A 1UTKA 3KQBA 3SU0A 2LNCA 1DVAH 3E91A 2V3OH 2GT7A 1SG8B 1AGJA 1HUTH 1NFWA 3ZZAA 3STJA 1YPHC 1HAHH 1TQ0B 1O31A 3GYMA 1PPGE 1BRUP 1TMTH 5CHAB 1TOCB 1MTNC 2ZPQA 4A1VA 1ZHPA 2STBE 2AEIH 2H6MA 1ARBA 1ZPBA 2SGDE 1O30A 4H6TA 1FZZA 4DGJA 1DOJA 3VXFH 1YC0A 4DW2U 2A5AA 1EAWA 1ZPCA 3LPRA 2C3SA 1Z6JH 2C93B 1Z8IB 1VJ9U 3A7YA 3UUZA 2BVRH 3NCLA 1O5FH 1P01A 5DK1A 1P2JA 2NU1E 1OXGA 3M5NA 2ZPRA 1GDUA 5A09A 1GBDA 1IQJA 4CR5A 2D2DA 1FPCH 2Z9IA 3MH5A 3QZQA 3HGPA 1FJSA 2A4OA 2OC7A 2QV1A 2H9HA 1C1UH 2BDIA 2CHAB 2F9OA 1O2TA 1O3NA 5HM2A 3K65B 5J4SA 1O3MA 1ZTKA 2ZDAH 4MQAA 4DOQA 3P8NA 1RD3B 1YCPM 3D23A 1BRBE 4AGJA 2ZDNA 1WYKA 3ZYDA 1EPTC 4ZHLU 4RKOB 3P8FA 1FIWA 3VEQB 1YLDA 2QIQA 2BDAA 2ZDLA 3SUDA 1UVUH 1EB1H 1WQVH 1GBEA 1BQYA 1ANCA 4AFQA 3A7WA 3SUFA 1WV7H 3ATMA 2ZGJA 1O38A 2DE8A 4A1TA 2BHGA 1DXWA 3GCTG 1O32A 1XX9A 3R3GB 1AZZA 2O8UA 1K1MA 5JBCS 1QY6A 1AY6H 1FI8A 1LHGH 4SGBE 2ZU4A 1RXPA 1HJ8A 1FY3A 1K22H 2ANWA 1C5VA 3UNSA 2FS9A 3TH3H 1MAYA 3RLYH 3URDA 2AIPA 4I31A 1UTMA 2EI7A 3PLKA 4F49A 1MTVA 1GMCG 3ZZ9A 1MZDA 5A0BA 4VGCC 1EX3A 1HNEE 1JRTA 1XUKA 2BLVA 3ZVDA 1O33A 1W0YH 1THRH 4Q2KA 3E6PH 4DVAU 1C5SA 1RTFB 3HGNA 5FCKA 1HB0B 3I78A 2ODYB 5SGAE 1ZZZA 1EQ9A 1OWKA 3MTYA 4QT8C 5HYOA 3P8OA 1GJ9B 3TGKE 3SU6A 1W13U 1GBTA 4B75A 3CENA 1DSTA 3PM3A 4MVNA 5HM9A 1C1TA 4CH2B 2BB4A 1B0EA 1EZQA 1HAVB 5EG4A 9ESTA 2HVXA 2BD8A 1ELBA 4WMFA 1C2GA 1F0RA 4LZ1H 1F7ZA 1OYTH 3BV9B 1C5XB 2R2MB 2FDAA 1GMDG 1C2KA 1OP0A 3E16B 4BNRA 1MBQA 2Y6TA 1BDAA 1LDTT 1QQUA 3BG8A 3I77A 3RP2A 3TK9A 1BJVA 3ZZ4A 2ZFSA 1AO5A 4ISNA 3PB1E 1KYNA 1O5CB 3RXFA 3GISB 1ZGVA 4Z6AH 3PO1C 2Z94A 8LPRA 1PPBH 3OY6U 2ZHWH 3ZZDA 5LH8A 3MOCA 2F9VA 3T2NA 1KXFA 1ZR0A 4VGCB 4DG4A 1TYNA 3SI4H 1O2YA 4INKA 4KTUA 2G8TA 1ZRKA 1P2MA 4I8KA 3RU4T 3L6PA 4CR9A 1SOTA 1FV9A 4I32A 1Z8JB 1GBIA 3PMAB 3U98H 1EKBB 3P17H 4AFZA 3SZNA 1NN6A 2GZ7A 1YYY1 1KXCA 3SU5A 2BY6X 5LPRA 3F6UH 1SPJA 2JH0D 1XUFA 2AFQB 4FVDA 1BITA 4Y7BA 1Y5UT 5BPEA 1VCWA 3M5LA 5GXPA 3A80A 3KIDU 3SU4A 1O3GA 3TK5A 2ALVA 1TQ7B 3RXUA 2A4QA 1AKSA 2A0QB 3FZDA 1DM4B 2ZU5A 1KSNA 1GHYH 2XBXA 5AHGH 1D3PB 2FLRH 4BAQB 2BD2A 3PYHA 4X0WU 2P59A 1NO9H 1EPTA 1Q31A 2Z3DA 2BM2A 4R0IA 1WSSH 4Y79A 5L2YH 1UK4A 3CS7A 1TONA 5HMAA 3ZZ3A 3ZYEA 2GCHG 1O2SA 2XC4A 2ZCLP 4OS1A 3BTGE 4XOJA 5T3HA 1HXFH 3C1KA 3P70B 4MPVA 1HPGA 1A0JA 2WPMS 1VITH 5EU8A 3NK8A 1TNIA 1GDQA 2BDCA 3VB5A 5ESBA 4B2AA 4ABDA 3QK1A 3MNBA 2XBWA 3KN2A 1OP2A 1ZSKA 5IYTA 1V2JT 3QWCH 2ZP0H 2FYQA 4JYVH 4OS4A 5IDKA 2BY7X 1Y59T 2FI3E 1O5BB 1SMFE 4X1QU 4I8JA 4NSYA 1W12U 2WINI 4WXIA 5C1UA 5FCRA 2EC9H 2ZFPH 1HAGE 1UK2A 4U01A 1DWDH 3ATWA 3DD2H 2PUXB 3RM2H 2PLXA 2PTNA 1BUIA 2GP9B 1DFPA 5DP7A 2ZFFH 2AGIX 1QJ6B 1ZMNA 2WPIS 1TA2A 1AVGH 1OS8A 4JZIA 4NA8A 4WH8A 2PKAA 1TGTA 1LPZB 5AFZH 2C90B 4JZEH 1LHEH 4RSPA 4ISIH 1JWTA 1XKAC 2A32A 3OU0A 1EAUA 1KXBA 3PTBA 3EE0B 4IMQA 2C8ZB 1DDJA 3NKKA 1NU9A 2ZQ1A 2CXVA 4IGDA 1IAUA 2BYAX 1N8OC 5A0CA 1V2UT 3E0NB 3ZZ7A 1QBOA 1YCPH 5F03A 2BX4A 3ZVBA 1T8MA 1O3IA 2AMDA 2YOLA 2FI5E 1ZLRA 4MNWA 2FX6A 2P3UB 4DY7B 1WOFA 4FU9A 1A7SA 1HBTH 4J2YB 1XVMA 1OWHA 4YOIA 3T28A 1C1WH 1QJ1B 5LPEA 1DT2A 1N1LA 1AMHA 3ZVFA 4Q7ZA 1TFXA 1T4UH 1W3CA 3EGKH 5BRRE 1XUHA 3I29A 5FX6A 4BXWA 2ZTZA 2FOAA 2PV9B 3UOPA 1TX6A 1UO6A 2FLBH 2ZKSA 4CRAA 3LKWA 1ABIH 2G5VA 1CE5A 4ZHAA 1FXYA 3TJNA 8GCHF 3T27A 3UNRA 4X1SU 1KTSB 4JZFH 1O2UA 5GCHG 1P05A 3SUEA 1HRTH 2UWLA 3MU4A 1GHWH 1ELFA 4OS5A 1P03A 2AIQA 4I7YH 2FMJA 1AFEH 1ETSH 2GT8A 4RKJB 2FXRA 1VGCC 4UONA 1VCQA 3UR9A 3PMJA 4CBNA 1O3AA 2QA9E 2VIQA 4BOHA 4UFGH 1MMJN 2ZFTA 1XVOA 1OSSA 1AWFH 2ZWLH 3O8RA 4TY6A 2ZCHP 1EAIA 1OWJA 1W11U 2SGPE 3RC4A 1EASA 4ISHH 1H8DH 2PTCE 1A61H 1GCDA 5JB8S 5GPIB 7KMEH 2GX4A 3Q77A 3A82A 1WAYB 1YPKH 2BD9A 1C5TA 2VH6A 1MTWA 1BMLA 1TRMA 1KLJH 2QXJA 3EAJA 1WTGH 2H2ZA 3SBKA 1RGQA 4GSOA 1QB6A 2FWWA 3OYPA 1YPGH 1GI2A 4CH8B 1H9HE 2VWNA 1ETRH 5C20A 1GI4A 1W10U 1MU6B 1K1NA 1KY9A 4CRCA 1PQAA 2TGTA 1GCTC 3GY2A 4X6MA 1V2NT 3D65E 3DUXH 1QIXB 3SN8A 1SLXB 3FANA 1O2JA 2PGQB 2ZG0H 4AYYB 2BX3A 5AFYH 1TBRH 1Z8RA 2EI6A 4MDSA 4KTCA 3T25A 1DUEA 4Y11E 1MBMA 2O8LA 5A0AE 1TNHA 3LJOA 3PMBB 3ATIA 1UVSH 2OD3B 3TK6A 1FN6A 2UWOA 3KHVA 1TBQH 3P95A 2ZZUH 3S7HB 4MPUA 4WVPE 2XXLA 2D26C 4DCDA 3Q3YA 1E0FD 3TU7H 4UEHH 1C2FA 2EEKA 1V2RT 1O5AB 1GVLA 3D62A 1BTWA 1C5PA 3RLWH 2JH5D 2ZQ2A 2AYWA 1GWAA 1AE8H 1UTLM 2R0KA 1NFYA 4YZUA 4BAMB 1SGRE 1DANH 1FNIA 3W95A 1PPCE 1O37A 1OOKB 2ZTYA 1TPOA 3A83A 4ISOA 1Y8TA 1O3JA 1HAYB 2ZDKA 1SGEE 3W94A 3PWCA 1ZPZA 1GJDB 1GI1A 3C27B 1ELAA 4D9QA 1P9SA 4IS5A 1NFXA 4IBLH 4LK4A 2PSYA 1HIAB 3TJVA 1KDQA 3B9FH 2F9BH 1AWHB 4CREA 1ZMJA 1IHSH 2ANYA 2WYJA 2B7DH 2AGGX 5L30H 1BB0B 1P11E 1IQFA 5TCAA 5FAHA 3GY7A 4O3UA 3V0XA 2FS8A 3OTJE 4BXSA 1GCTB 1Z7KA 8KME2 1BHXF 1GBLA 2B8OH 2IN2A 3VXEH 1H4WA 2W5EA 2K1QA 3RU4E 2FIRH 2AERH </