1W14U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U01
4JCNA 4KP0A 2VIOA 5E2PA 3UWIA 4O3TA 5C67A 1GBTA 4OS6A 6ESTA 4MPWA 5A0CA 1J17T 5A0BA 2LPRA 4BXSA 1Y3YA 3MFJA 1LHGH 1F5LA 3ZZAA 5LGOA 2BDCA 1OWEA 1SGTA 1TPAE 2H9EH 1YC0A 4WF8A 4BTUB 1AZ8A 1JIRA 3TNTA 1Y3UA 2FXRA 3URCA 4A5TS 5FCKA 3GCOA 4GUXA 2BY9X 3ODDA 1TGTA 3T2NA 4LOYH 1L4DA 1EP5A 1MU6B 1RD3B 3PB1E 4MNXA 1PQAA 3PWCA 1P09A 3SNBA 1O2NA 4O9VA 1NS3A 5JB9S 2FYQA 4U2WA 2BD5A 3AW1A 4CH2B 1L1NA 1MZDA 3U69H 4OGXA 3ZV9A 2QIQA 1MMJN 4YO9A 5L2YH 5EODA 2ZFFH 1A5IA 1SGNE 1SGFA 1O2OA 2YNBA 5CHAB 3FVFB 3I29A 3M61U 1QURH 1IQEA 4D9RA 3ZVAA 4FU9A 3RM0H 1S5SA 1OWIA 1Z8RA 5FAHA 1GGDC 2FOEA 1HJ9A 2PSXA 2BHGA 1FN8A 1DWCH 1P2OA 5E0JA 1G3BA 1D6RA 2ZWLH 3STIA 4JK6A 3PWBA 4Y11E 5FBIA 1LHDH 3RMNH 4TWYA 3M5OA 4OS2A 5EOKA 2V3OH 2WUCA 3L33A 1N8OB 3JZ2B 1C9TA 1EAIA 2BZ6H 3RLYH 4X2WA 1NRQH 3SGAE 1CU1A 1KXFA 5IDKA 1BMLA 4B76A 1NZQH 3F6UH 4ABGA 1B5GH 3UQVA 3UIRA 3GDSA 2JKHA 4JZIA 1MKWK 3TLOA 1H9LB 4WXIA 1BRBE 1JOUB 2BD7A 4JYUH 3P8OA 5C1UA 1DLKB 4B75A 2ZU2A 1CT0E 1ESBA 4Q7ZA 1ANCA 1EZXC 2PR3A 4Q7XA 3SI4H 2Z6BD 1BA8B 2DUCA 2XXLA 3C27B 4Y8YA 1WBGB 2AMQA 3HGNA 4D7GA 5HM9A 3E3TA 2OUAA 1MH0A 2C8WB 1YM0A 1QJ6B 1AY6H 1AO5A 1V3XA 4GHTA 1P9SA 5PTPA 3GCTG 1H4WA 2ZHQH 4YT6H 1OWDA 1HAVB 3P8GA 2GZ9A 3GCTF 1GJBB 3Q76A 4OGYA 2XTTB 1OP0A 1FMGA 3VB3A 1KXAA 4H6TA 3RLWH 1RGQA 4ZKRU 1GI7B 2EI8A 1EZSC 9LPRA 4HZHA 1Q31A 2WPIS 1BJUA 2RCEA 4JZFH 1O2SA 4AX9H 1A0JA 1TRYA 2GT7A 6CHAB 4TPYA 3RUOA 3G01A 4FU8A 2V35A 3ATWA 1NRNH 1IHTH 1SC8U 4F49A 1HJAB 2VH6A 3UNSA 1V2OT 4K60A 3UQOA 1UTMA 3BTHE 3BF6H 3EDXB 1GDNA 1O5EH 1ORFA 1TFXA 1O3AA 5GJ4B 1AB9B 4OS1A 4D8NA 2FLRH 1CO7E 1LPKB 3LC5A 2GV7A 2ZU1A 1JXPA 1GG6B 1HYLA 1THRH 2HNTF 3A82A 4CRAA 3BTGE 1HCGA 1DVAH 5AF9H 2YOLA 1TBRH 1HAVA 1MD8A 5FPYA 2AERH 2ZTZA 2A4GA 2RG3A 4D76A 2FI3E 4FUIA 3AW0A 3ODFA 1IQNA 4E06H 2A2QH 4ZMAH 4DVAU 1UK3A 4BOHA 5AVDA 2A0QB 1W7XH 2AS9A 4ZXYH 1O32A 5LPEA 1P9UA 2BXTH 3U9AH 4CRCA 2GTBA 4RKJB 3QX5H 1UMAH 4I8GA 1DE7H 3UFAA 1W3CA 1TOCB 1O38A 2ZHWH 1Z71A 1DSUA 1L2EA 3P70B 4IC6A 1P2JA 1A7SA 1O3HA 1O5AB 2FI5E 3GDUA 3ATIA 1HRTH 4NGAH 1HAOH 4AZ2B 4GPGA 1CHGA 3MU8A 4WXVA 1JMOH 1FY5A 1GDQA 3KN2A 3W95A 1A0LA 1TE0A 5DP4A 2VWMA 4I8LA 2FOBA 3RU4T 3AVZA 1TGSZ 2G4UA 2UUKB 2QXHA 3IG6B 1OXGA 4YM9A 1FN6A 1LCYA 3GY2A 3LKWA 4AGKA 3E8LA 2ODQA 3SNEA 3QGNB 1BDAA 1W14U 4B73A 2VIVA 2J2UA 1W7GH 4NZLA 5HXFA 4THNH 1O36A 2M5TA 2VJ1A 1ANDA 2PKAA 3VB4A 2GVFA 1FV9A 5EU8A 1A5HA 5SGAE 4J2YB 3E1XB 4X8TH 2GD4B 3I78A 1SHYA 2C4FH 1OX1A 1GHVH 1L1GA 3TGKE 1O35A 3DUXH 1SSXA 2IOTA 4ABDA 1CBWC 3V0XA 1QL9A 1RTFB 1ELBA 1YPGH 1SG8B 2WUBA 3A81A 1MCVA 1EJAA 5EQQA 3P6ZB 1ZZZA 3RXMA 1PQ5A 3Q00A 3GY7A 1GBFA 3LGYA 1UVUH 4UFGH 2ILNA 1TX6A 1J15A 1QQ4A 3U1JB 3A89A 2CF9H 1Q2WA 1AN1E 2Y5FA 2GZ8A 3UTUH 3ZYDA 3A84A 1O3OA 4BAHB 4I32A 7KMEH 1F5KU 3RM2H 3AAUA 3LIWA 1O3CA 3SU5A 3SHAH 1AFQC 3A8BA 3SJ9A 2ZDMA 4Y0YE 1A0HB 4B1TA 3BTQE 1ELTA 3PMAB 1K2I1 3ZVEA 2Z9IA 5F8XA 2ZTYA 2ZECA 3SJ8A 3RXIA 2R3YA 1DICA 3PV4A 3GY4A 2ALPA 1O3EA 5EXMA 1IHSH 1ZJDA 1C5VA 1TNIA 2ZFPH 1A61H 2XW9A 1B7XB 3M7QA 1QNJA 1HNEE 1CA0C 1D6WA 1HLTH 1F0UA 1C2LA 4YESB 1KLJH 1VCPA 5JPMH 1YKTA 2QCYA 2VINA 1A46H 1Y8TA 1JRTA 4R8TB 1EPTC 3AAVA 2A4RA 3M3SA 3P92A 1CGJE 1O2YA 1PQ8A 4UD9H 1KXEA 1V2WT 3O8DA 4IMZA 1GCTC 1GJ4H 4CRGA 5E0GA 1C1WH 1HXEH 4HFPB 4AFZA 1Z7KA 1ELVA 1EXFA 1XUFA 1LMWB 3ZZCA 2OC7A 1NRSH 3RXKA 1DWDH 2NU2E 1NFXA 2Z3EA 2ZCHP 1UTNA 4NSVA 1AUJA 4ZUHA 1GJCB 5ESBA 5T6DA 3RXAA 2B9LA 1O2JA 3RC6A 2C93B 2QF0A 1VGCC 2P93A 1C5WB 3OX7U 1HIAB 1HDTH 4OS7A 4I8HA 1MU8B 5GPIB 2J95A 2XWAA 3GY8A 1G3EA 3L3TA 4RKOB 3Q77A 1TRNA 1HAGE 3OYPA 4TYDA 1ETSH 3Q3XA 5DP3A 2F9NA 2Q1JA 1YYY1 3NZIA 1DWEH 1TQ0B 1C1RA 4FU7A 1C2IA 1T32A 2G00A 1P12E 6GCHG 1B0EA 1G2MA 1GPZA 1RIWC 6GCHF 1DY9A 3BN9A 2FOGA 3ZYEA 1MBQA 5C1XA 4ABHA 3E91A 4K1SA 1S6FA 4FUHA 5JBAS 1O3DA 2Y7ZA 3S9CA 1IQGA 4JYVH 1XUHA 3RU4E 1DPOA 1GBBA 1INCA 1GBCA 2QXGA 3ELAH 2W26A 1ZGVA 2Z9JA 4X8UH 2BOKA 1BBRE 4H42U 1GBMA 1DOJA 4MNWA 2P8OC 3VXFH 1KIGH 4B2CA 2PV9B 4WMDA 1GL1A 4LZ4B 1TX7A 1UTPA 3QN7A 2GP9B 2NU3E 1IQKA 1UTOA 2WYGA 4BAKB 5DP7A 1BTZA 1YPHC 3V12A 1HIAA 5CMXH 5C5OA 2PHBA 4BAQB 2BD4A 2ZFTA 1LQDB 2IN2A 1TABE 5A8YA 3RU4D 3T25A 2BX4A 2ZFSA 1TA6A 5FX6A 3RXLA 1ELFA 1GI4A 1Y3VA 2F9OA 2GCTB 2WYJA 1N1LA 1HPGA 2FPZA 3ZVFA 2EI6A 4DW2U 2ZF0H 2ZDVH 1ZPZA 3F1SB 2FOHA 1OS8A 2ZTXA 2BY6X 4JYTA 3TU7H 1AZZA 4BTIB 1BITA 1YCPM 1O2ZA 4U01A 1PPBH 1DDJA 2ANWA 4SGBE 1NTPA 2G8TA 1XUIA 5EW1H 3SGBE 1WUNH 4KGAA 3RMMH 3E6PH 2J34A 2J4IA 1GJAB 2ZG0H 1LVMA 3ITIA 5JDUB 2AEIH 5DGJA 1EZQA 2WPKS 3CP7A 1TMUH 3F68H 1CBWB 1WV7H 8LPRA 1AGJA 4FUFA 1OYQA 1DXPA 1BMMH 1F5RA 4Q7YA 1BZXE 2BY5X 3M3TA 5JB8S 2A4QA 1C5YB 1SR5C 4MNYA 2VIDA 2A45B 4ABIA 7LPRA 4NWLA 1LPGB 3TJVA 2BZAA 2FLBH 2O8TA 3H7OA 3U98H 3TJOA 1P8VC 1PFXC 4AORA 1EJMA 2PTCE 3SUDA 2QV1A 1V2JT 2Z3DA 3F9GA 4QT8C 1AFQB 1AUTC 2D26C 2G55A 2F9UA 3WY8A 2PKSC 3D62A 5JBCS 1C9PA 1O2TA 4Y8XA 4CRFA 1Z8GA 1FY4A 2OQ5A 3T26A 4CBOA 1G36A 3KHVA 2CV3A 3ZZ4A 1G2LA 2UUJB 5F8TA 1V2TT 1UJ1A 1HAZB 2VVUA 1GBIA 3IWMA 1C1NA 3VGCC 2HLCA 3GCHC 1PJPA 1XX9A 1QB9A 1F7ZA 2OD3B 3IITA 1XVMA 2C8ZB 1ETRH 2ANYA 1CGIE 1CA0B 1ZMJA 2I6SA 3MO9A 3SU0A 1RXPA 4NZQA 5DJ7A 2TGPZ 1X7AC 4DY7B 5B6OA 1C5XB 1KSNA 1A2CH 3K9XB 2WPJS 3LH1A 3EGKH 4MPXA 3TGJE 1EPTB 1LVOA 1YPHE 2RDLA 3B23B 3AASA 4IC5A 2GCHG 2TIOA 2HNTC 2TGDA 1PYTC 1QHRB 1E35B 1PPGE 3MMGA 2GCHF 5CE1A 1DUAA 4X1QU 3DHKH 1FNIA 2G81E 1MQ6A 1LHCH 1SL3A 1HV7A 1H9IE 2OP9A 1SI5H 1P57B 3SNCA 4K1EA 2WV5A 2AIQA 1ZRBA 1EZUC 2BDBA 1UTLM 2AIPA 3A7XA 1VGCB 2XC4A 1QGFA 1PQ7A 3Q3YA 1C5MD 2EEKA 1OP8A 1C2KA 1GI3A 2Y6TA 2XBWA 5T6GA 1BOQA 5E8EH 3VFEA 2XC5A 4B2BA 3MHWU 4GSOA 5EG4A 4KTUA 5GIBA 4NSYA 3UY9A 1XUGA 3D49H 2ZHEH 1AU8A 2HRVA 1ZHRA 1AI8H 1ABIH 1O3MA 3TVJB 3VXEH 3UNRA 1RIWB 2Z94A 2QC2A 2A5IA 1OKXA 1BCUH 1IAUA 1PPEE 4A1XA 1AHTH 3RXPA 2ALVA 1ZPBA 1YBWA 2FX6A 1DT2A 1O2RA 3TJUA 4TWWA 1FY8E 1K22H 3UOPA 4Y7AA 1FAKH 1CHOG 5GWZA 1EPTA 1CHOF 4DOQA 2ZPSA 2CN0H 4NCYA 2ZPQA 3T27A 1QCPA 1D3PB 1L0ZA 2FWWA 3C1KA 2Y82A 4XDEA 2BLWA 4CRDA 3RXEA 1BTWA 1LKBA 3MOCA 4ISIH 3UWJH 4IN2A 2H6MA 1KXBA 3SOSA 2P8OB 1HFDA 1UVSH 1NT1A 3SJOA 4NA9H 1MKXH 1C1PA 1O5GH 4K2YA 5A0AE 2ZFRH 4FUDA 5C3NA 3PTNA 4X1RU 4YOGA 4D7FA 1WTHD 1Z6JH 3LC3A 3FP7E 1MTWA 1MTUA 1XUJA 4XBDA 1C5ZB 2A1DB 2QXJA 1GBHA 1GHYH 3M5NA 2ZO3H 2F3CE 1RTLA 3BSQA 1KYNA 4UEHH 3RXVA 1O33A 3HK3B 3PMHB 1ZR0A 2W3KA 1HXFH 1YPEH 5EQSA 3STJA 1S85A 1ZPCA 1IOEA 1BHXF 4BANB 3U8OH 3NKKA 2HNTE 3E16B 3PM3A 1IQMA 4UONA 1CA8B 1C1MA 1UO6A 3TK6A 1SGCA 1GBKA 2H5CA 4NIWA 1SLUB 1TNGA 2SGFE 3PLBA 3ZVBA 1GMDG 5EXNA 1DS2E 1GMDF 2PSYA 3EYDA 3BTWE 3QTOH 4MQAA 1T8NA 2CMYA 1SGQE 2JH5D 2XYAA 4X6PA 2BD9A 3SQHE 2W5EA 3V13A 1YCPH 2J92A 4YLQH 3V3MA 3BTFE 1G3CA 4BNRA 2ZHDA 2SGEE 3M36A 1O37A 4X8VH 2Q6FA 2JH0D 3VB6A 1E38B 1BQYA 3NCLA 4Y8ZA 2A7JA 2BM2A 3A88A 1ZTJA 2GT8A 1F0TA 2O8UA 1MAYA 2B8OH 2ZNKH 1GJDB 1HBTH 2FIRH 1EAXA 2FODA 1P01A 1J16A 1C1VH 2F9VA 1TYNA 2XBYA 2FDAA 7ESTE 1P2IA 2PKAB 2PKSB 1F92A 1Y3WA 5DKMA 1ZJKA 3EE0B 3D23A 1OPHB 1O3PB 2TGTA 3FAOA 1GHZA 1ELAA 2ZGBH 1ZTLA 2HWLB 2I6QA 4LK4A 1W13U 1C5QA 3U1IB 1GMHG 1O2LA 1ZSLA 1GMHF 4AB9A 1BRCE 1E36B 1HB0B 1T8OA 2Y7XA 1QA0A 2VWLA 4WVPE 3GCHB 3T62A 4K8YA 3PMJA 1ZOMA 1CT2E 1EASA 1Z6EA 3SN8A 3QLPH 2BQWB 5L6NH 4XBBA 3S7KB 1GDUA 1NN6A 5EPYA 1FIZA 2GDDA 3KQBA 1O0DH 2O9QA 5C2ZA 1T8LA 1GCDA 2FX4A 4VGCC 4CR9A 1V2KT 4TPIZ 4AFQA 3RXDA 2SGPE 2OINA 1A3BH 4KELA 1SFQB 2P94A 1SHHB 1Z1JA 2A2XH 1GI8B 5AFYH 4ZKOU 2IPHA 1E37B 3UR6A 1K28D 5FCRA 3RXFA 1K21H 2DE8A 1NESE 2D2DA 1TNHA 3NWUA 4HI3A 2R0LA 1ZHMA 1OSSA 5HYOA 5A8XA 3M37A 1D3QB 5LPFA 2OBOA 3SNAA 3K6ZA 1D9IA 2P16A 1EUFA 3FZZA 4WH8A 3EA7A 1GI1A 1GGDB 1ZHPA 3EAJA 4E7NA 4AGJA 2B0FA 2FTLE 4YLUA 1P2MA 3MO3A 2VWOA 1K1IA 3MWIU 3KEEA 4ISNA 1GJ7B 4RN6A 4ABFA 1FPCH 1ELGA 1XM1A 1XKAC 4WMEA 1C2HA 3KQCA 3SQEE 1SQTA 1C4V2 2H9HA 1MTNC 4YT7H 5T3HA 2BD8A 1T7CA 1KLTA 3ZZ5A 1TB6H 4KKDA 1V2RT 2IJOB 2AMPA 1ZMNA 5BPEA 2RA0A 1OWHA 1S0RA 3A7VA 3SU3A 1C5LH 2OQUA 1NM6A 1IQLA 1ELCA 2CF8H 3DD2H 7GCHG 2BTCE 1FAXA 1Q3XA 7GCHF 1C2JA 3MI4A 1PPFE 3A8AA 4ABEA 3FP8E 2VVCA 1AVXA 4K1TA 3JZ1B 4NIVA 5LPRA 1ARBA 3LJJA 2ODPA 4MPUA 1V2ST 1CQQA 1UVTH 5EPNA 5FHTA 2BD3A 3BEIB 3LDXH 1ACBE 4DG4A 2PUQH 4YOJA 2PWXA 3KNXA 2A4OA 3TIUA 3HATH 3LGUA 1THSH 2W7SA 1DM4B 3RXBA 1O2KA 5A09A 1NPMA 1TNKA 1MTVA 1O2MA 3RP2A 1FUJA 2CXVA 4B2AA 4AYVB 3QZQA 3P17H 1O3LA 1QB1A 1SGPE 1BJVA 2KAIB 3TH4H 4UFFH 1SOTA 4U30A 6LPRA 3BTKE 5FX5A 4LXBH 1N6XA 2VB0A 3SV9A 4MNVA 1LVYA 1ANBA 4FUBA 4NA7A 2SGQE 3SUEA 2F9BH 3SZNA 3L6PA 4I8KA 5BRRE 5DP8A 1EQ9A 3P95A 3SJIA 4CHAC 2LNCA 3MH7A 2C3SA 2QY0B 3A86A 1THPB 4IS5A 3PO1C 1JBUH 2ZGJA 3RXCA 4A7IB 5TJXA 2WINI 1LHFH 1UVOA 1YGCH 1SLVB 2ZKSA 3P8NA 1DX5M 4NWKA 2OCVB 3MH5A 2G4TA 4K5ZA 1QL7A 4YTAA 1SLWB 1TNLA 2BY7X 3B9FH 4MPVA 3K6YA 2QAAA 2PLXA 4CBNA 4GVUA 2G51A 3ZZ3A 1TA2A 2BB4A 1JWTA 1DLEA 1TONA 1H9HE 1LKAA 2OTVA 5A8ZA 4AG1A 2ZFQH 2QF3A 2V3HH 2AH4X 1DANH 3ZZ9A 3W94A 2O8MA 2RA3A 4BXWA 2ZDLA 1VR1H 2D8WA 2KAIA 3TJNA 1NFUA 3RMOH 1EJNA 1QRZA 1P2QA 1EATA 1W10U 2SGDE 5DG6A 3V7TA 1V2LT 1CE5A 1V2PT 4I31A 1UVPA 4Y6DA 3MYWA 1P3CA 4X6NA 5G4BA 1OWKA 1XXFA 3BEFB 1P2KA 2FZZA 4UFEH 1MKXK 3KIDU 2SNWA 4KTSA 3FZDA 3SNDA 4M7GA 4ZHLU 2ZIQH 2ANMH 2FOAA 4X1NU 3VPKA 1BMAA 1EP6A 2A7CA 2ZEBA 3SUFA 3SV6A 1TOMH 2ZP0H 3GICB 2ESTE 1EKBB 1O5CB 1SLXB 2STAE 4E05H 1HAYB 1YPKH 3ATKA 2J94A 2GMTC 2FP7B 4PROA 1AKSB 4INLA 1ZSKA 4VGCB 1O3BA 3ESTA 1TMBH 1LO6A 1JRSA 2PGQB 3BTDE 4FUEA 2BVSH 2HPQH 5FPTA 2SNVA 3K65B 4X0WU 1WTGH 1S0QA 3A87A 5EW2H 1O3JA 1SB1H 4I7YH 1FLEE 1GJ9B 4AFUA 3MH6A 3A7YA 4JZEH 3A80A 3HK6B 1TWXB 4JK5A 1MTSA 4K69A 2P95A 3A7ZA 1J9CH 2XBXA 4A1VA 4FXGH 1TMTH 1SFIA 5EQRA 5HM2A 3M5MA 3QDZB 2GZ7A 1YCPK 4CRBA 2FS8A 1ZTKA 3ATLA 3MNXA 1DSTA 1GJ6A 4AYYB 2QXIA 1SMFE 1TIOA 1K9OE 4ZXXH 2AMDA 5ABWA 3HPTB 1MTNB 4HGCA 1BTXA 3KQEA 1C5UA 1O2UA 1QY6A 3FFGA 1O2XA 1RTKA 1NRPH 3M35A 1AE8H 4A92A 1TQ7B 1VITG 5TCCA 2PGBB 1VITF 1T8MA 1DWBH 3U8TH 1EB2A 3BG4C 3LU9B 1AKSA 1KXCA 3TGIE 2OC0A 1WOFA 1K1OA 1LTOA 1K1NA 3BIUH 1G9IE 1M9UA 2ZC9H 4ASHA 4ZHAA 2AGEX 1O2PA 1DUEA 1NFYA 2WPMS 3PTBA 3RXRA 3GOVB 1GI6A 2R2MB 3ATMA 3R3GB 3TITA 3MNBA 4F4OC 3MU5A 1TRMA 1DXWA 3DFJA 3ENSB 3MU0A 3MU4A 2VVVA 3ZVDA 1K1LA 1O2GH 1C4U2 3SI3H 1BMNH 1BT7A 1QRXA 2FI4E 2ZDAH 4WY3A 1GI0A 1P05A 5HGGA 4O3UA 3CS7A 1W2KH 3M7TA 2NWNA 2VU8E 1UTQA 1P2NA 2FOCA 4AN7A 3K2UA 4IBLH 3A7TA 2P3FH 5GXPA 1GVZA 1ESAA 3S7HB 1LHEH 4X1SU 1XUKA 1XKBC 1O3KA 4K8BA 1QFKH 2FMJA 3OSYA 2PFEA 2G5NA 2HOBA 2DE9A 5L2ZH 1GL0E 4CHAB 3TPIZ 1GCTB 2VIQA 4A1TA 1L1JA 2HALA 1W8BH 3LGVA 3EA8A 2UUYA 2H1UA 3PO1B 2JETC 3SJKA 3QUMP 4GHQA 4B74A 2HVXA 1J8AA 1ZGIA 4FVBA 5F03A 1O2HA 2XCFA 5L30H 4A6LA 1NU9A 5AHGH 4Y7BA 2OC1A 2ASUB 4Z0KA 1V2NT 5DP9A 1TBZH 1RFNA 4K3JA 1WCZA 1YLDA 5K0HA 1C1UH 2A5AA 1AMHA 3SU4A 3U8RH 1G3DA 1KDQB 2O8LA 1O3FA 1NY22 2QYIA 1MZAA 2ULLA 1O3GA 3MTYA 3PLPA 4ISOA 4B71A 3B8JA 5E0HA 2NU4E 2BLQA 2VGCC 2ZU4A 3P8FA 4O03A 2ZZUH 1C4Y2 3BV9B 3LT3A 2R3UA 3S9AA 1OOKB 3T29A 4E7RG 1J14A 1QR3E 1SGYE 1WU1A 1QBVH 3GY6A 1KY9A 4IN1A 3ZZDA 1GHXH 1NROH 4HTCH 3GCNA 2VWNA 1GWAA 2SGAA 4JZDH 1OP2A 1V2MT 5GCHG 2A32A 1QRWA 3F9HA 5GCHF 1UCYH 2W7UA 3F9FA 1TPSA 1YPJH 1BBRH 2Y81A 1GI2A 3Q3KA 3TK5A 1O2VA 5E2OA 1TX8A 5AFZH 1ESTA 1K1JA 4OS4A 3HKIB 3ZZ8A 3BTEE 1VJAU 4X6MA 1C2EA 1S82A 4IMQA 4TY7A 4UFDH 1UK2A 1TALA 2HGTH 3SBKA 1VCWA 1GVLA 2A31A 1BUIA 3UPEA 2GMTB 2TRMA 3O8RA 1O39A 5C20A 1KTTB 3RXGA 4CR5A 2OXSA 1K1MA 4MVNA 1DY8A 1FXYA 3LGWA 3O8BA 3T28A 4DIIH 5DP5A 1CSOE 1MUEB 3T5FH 1FQ3A 1VITH 1O2QA 1V2VT 2BYAX 1H8DH 2BDGA 1UTKA 2J9NA 1KDQA 1GBJA 1XVOA 1W11U 4ZAEA 3A7WA 2ZGHA 3KGPA 4INHA 1F2SE 2XC0A 3KL6A 1G30B 1MCTA 2STBE 1UK4A 3D65E 3UREA 5I25A 1YPMH 3E0NB 4XE4A 3S9BA 1YP9A 2JH6D 2BVRH 1LVBA 4ABJA 1O2WA 4ZHMU 2NU1E 3R0FA 1ARCA 2FEQH 5HMAA 4GLYA 2HPPH 3SV2H 1Z8IB 2ZHFH 3MNCA 4FUGA 1YPLH 1SGRE 2ZCKP 1VJ9U 2R0KA 4SGAE 1BTPA 2XNIA 3S69A 3RXTA 1IQHA 1TNJA 1XMNB 1DFPA 1G37A 1C5TA 1LDTT 3GYMA 4ABAA 1HJ8A 3SW2B 1O2IA 3ZZ7A 4NFEA 2AYWA 4MDSA 1O30A 1C2MA 1UHBB 2F83A 4DCDA 4AOQA 2BDYA 4IGDA 4XBCA 1BTYA 3GDVA 5F8ZA 1O31A 2BOHB 1A4WH 2XCNA 5FXLA 3BG4B 1P3EA 1PYTD 3LGTA 3RXOA 3VEQB 2A7HA 4FUCA 2AGIX 4GAWA 4X2XA 1GBAA 2CHAC 1GHWH 3A85A 1HAXB 1G32B 1T4VH 4U32A 1BRAA 5GDSH 2H2ZA 1Y59T 4DT7B 4H4FA 1O5BB 1ZRKA 3I77A 1ANEA 4WMFA 2GKVE 1GJ5H 5EXLA 1VCQA 2Q6GA 1CVWH 2WV4A 1BHXB 1GJ8B 1FI8A 4Y76A 1QTFA 1MBMA 1VZQH 3RC4A 5JYIA 4OS5A 5EGMA 3TK9A 1S84A 1AQ7A 1FY1A 3E90B 3VGCB 3ZZBA 2GGVB 1H8IH 4LZ1H 1C5SA 3VB5A 3H7TA 3TH3H 2Y80A 2ANKH 1QJ1B 4Q2KA 3CENA 2EA3A 4AG2A 2A5KA 4D9QA 3S0NA 2OC8A 2PW8H 3VB7A 2EC9H 2BQ7B 4RSPA 1ZMLA 4FVDA 2XWBI 1WQVH 1JIMA 1AVGH 4Y79A 1P11E 1WQSA 2AGGX 1LQEA 2ZCLP 2FESH 3DA9B 4DURA 1F0SA 1C5NH 1UHBA 5J4SA 1OWJA 4I8JA 1BTHH 1T31A 2W3IA 1TPPA 1MD7A 1OYTH 4JZ1A 3RC5A 2CJIA 2JETB 2AFQB 1W12U 2R2WU 2ZPRA 1QB6A 3LPRA 3RXUA 1ELDE 1HUTH 1TAWA 1ELEE 2ZGCA 3LGIA 4BTTB 2GCTC 4UDWH 1UTJA 3PYHA 1O34A 2C90B 2V0BA 3KF2A 3NK8A 1GI9B 2UWPA 5ETXA 4O97A 4TY6A 1NC6A 1Y5AT 2B5TB 2P59A 1E0FD 2VGCB 4NFFA 3LH3A 3QGJA 1O5DH 3ZV8A 4YOIA 2F91A 4CH8B 3HGPA 3NUMA 3BTTE 3MNSA 1QBOA 1BIOA 2ZGXH 8KME2 3RDZA 1B0FA 3OY6U 1AFEH 1TLDA 1O5FH 2CGAA 1FDPA 1IQIA 2P3TB 1IQFA 8ESTE 1QL8A 2C8YB 4DJZB 1LPZB 4Q80A 1EB1H 3BTME 3UR9A 4R0IA 1A3EH 2XBVA 5TCAA 2FYRA 2ZQ2A 4MG3A 1QA7A 3SGQE 1V2QT 4KTCA 3HKJB 3LJOA 2VIPA 3GYLB 4MLFB 1C1QA 1Y3XA 4X2VA 3RXJA 2BLOA 1ZYOA 1WAYB 2C8XB 3ZVGA 4YZUA 5LH8A 1MKWH 1NFWA 5DO4H 1EX3A 1C2GA 2SFAA 2ODYB 2THFB 1HAIH 1TPOA 4XOJA 1QBNA 2UWOA 3SORA 1MAXA 3ZZ6A 2Z9KA 1Y5BT 1V2UT 2Y5HA 1BRUP 2FOFA 2V6NA 3RXQA 2FO9A 2G5VA 1W0YH 2BDAA 4Y0ZE 1EAWA 8GCHG 1C1SA 1QQUA 3TH2H 8GCHF 3FP6E 1GI5A 3QWCH 1ZSJA 3TNSA 2ZQ1A 1O3NA 2TPIZ 1SQAA 3QK1A 2ZDNA 5C1YA 2GDEH 1H1BA 5H4IB 1YF4A 1FIWA 4H6SB 1SQOA 3BIVH 2UWLA 2FS9A 3GY3A 3MO6A 4XFQA 4ZROA 1L4ZA 1T4UH 2O8WA 3SO3A 1TGNA 4ZKNU 1P04A 1P10A 4NG9H 1PPZA 2FOMB 2BY8X 2Z3CA 3KCGH 1IQJA 4WWYA 5CHAC 1WSSH 3PROA 4BAOB 1HAHH 2J38A 1FONA 2B7DH 4ISHH 5C5NA 1EAUA 2XRCA 1S83A 1BTUA 2BMGB 4UE7H 1C5OH 3QTVH 4FUJA 5I46H 1FZZA 1AIXH 4JMYA 2ZU3A 2ZU5A 1C2FA 2NU0E 4X8SH 2QGRA 1GBEA 1S81A 1UCYK 2CHAB 1WYKA 5ESTE 2BDHA 1KTSB 2BVXH 1BBRK 3EA9A 3OY5U 1D3DB 4J1YA 1N8OC 3MU1A 4NA8A 2BX3A 1SGIB 2Y5GA 3M5LA 1GMCG 1C1OA 3GISB 2GX4A 1FPHH 1SGEE 1AE5A 3H5CB 1GMCF 1ID5H 3UUZA 2BLVA 2G52A 1AWFH 1Z8JB 2R9PA 4XSKU 1RRKA 2WPLS 5FPSA 4BAMB 2QN5T 3BG8A 3F9EA 2BD2A 3RXSA 1EOJA 2D1JA 1PPCE 3GY5A 1GVKB 2VIWA 1GHAG 3A8CA 1W0ZU 3SU1A 1NO9H 1GHAF 3BEUA 1AVWA 1K1PA 4CREA 1ZLRA 2VH0A 1UCYE 3M3VA 1YLCA 1PPHE 1AD8H 1SOZA 1CT4E 3NPSA 2BQ6B 1AWHB 3CS0A 3DFLA 3SV8A 2Z9LA 3QZRA 1NRRH 5A2MH 1ABJH 1D4PB 3OU0A 2BXUH 3EQ0H 4WH6A 2Q6DA 1XXDA 1RS0A 3SV7A 4DIHH 1SGDE 1FY3A 4ISLA 1P0SH 3ZVCA 1NU7B 1SPJA 4ZH8A 4NIXA 3PLKA 2H9TH 3SUGA 1TGCA 1SGFG 4AB8A 5F6MA 3PMBB 1O3IA 3O8CA 1HAPH 1D3TB 3RMLH 4INKA 4ESTE 2ZDKA 2K1QA 1A5GH 3DT0H 1SVPA 2OBQA 3M7UA 5JBBS 2TGAA 2PTNA 4ABBA 1S6HA 2Z7FE 1P06A 4GCHG 1N6YA 2GV6A 3FANA 6CHAC 1F0RA 4GCHF 4WJG2 4Y71A 4AFSA 1V6DA 3UNQA 4IW4E 2P3UB 1CGHA 3A8DA 4X1PU 2TBSA 1Y5UT 2FTMA 1HGTH 1HJAC 1A1RA 2F9PA 3URDA 1RJXB 2UUFB 4NIYA 2YNAA 5IYTA 2ZA5A 3A83A 1GBDA 5FBEA 2FM2A 9ESTA 1U6QA 1C5RA 4X2YA 2Z9GA 4Y10E 3SU6A 1GHBG 1AB9C 2VNTA 1MQ5A 1GHBF 2EI7A 1QJ7B 1C1TA 3LOXA 1DITH 4Z6AH 3E0PB 1P03A 5DPAA 1KLIH 2ZI2H 1Z1IA 3OTJE 4I33A 3N7OA 1SBWA 3MH4A 1GG6C 3QO6A 2BDIA 5DP6A 4DGJA 1ETTH 2OLGA 1C2DA 2H5DA 1E34B 5K7RA 1GBLA 1P02A 3NXPA 3LONA 5J4QA 1QIXB 1C5PA 2WPHS 3KQDA 1BB0B 1EOLA 4ZKSU 3SHCH 4X6OA 3UOUA 3RXHA 1KXDA 1TGBA 5DK1A 4MTBA 3SU2A 2QA9E 5JBTA 2PUXB 1TBQH 1FJSA 5T6FA
chains in the Genus database with same CATH superfamily
4JCNA 4KP0A 2VIOA 5E2PA 3UWIA 4O3TA 5C67A 1GBTA 4OS6A 6ESTA 4MPWA 5A0CA 1J17T 5A0BA 2LPRA 4BXSA 1Y3YA 3MFJA 1LHGH 3PRBA 1F5LA 3ZZAA 5LGOA 2BDCA 1OWEA 1SGTA 1TPAE 2H9EH 1YC0A 4WF8A 4BTUB 1AZ8A 1JIRA 3TNTA 1Y3UA 2FXRA 3URCA 4A5TS 5FCKA 3GCOA 4GUXA 2BY9X 3ODDA 3OE7D 1TGTA 3T2NA 4LOYH 1K0HA 1L4DA 1EP5A 1MU6B 1RD3B 3DSPA 3PB1E 4MNXA 1PQAA 3PWCA 1P09A 3SNBA 1O2NA 4O9VA 1NS3A 5JB9S 2FYQA 4U2WA 2BD5A 3AW1A 4CH2B 1L1NA 1MZDA 3U69H 4OGXA 3ZV9A 4RI0A 2QIQA 1MMJN 4YO9A 5L2YH 5EODA 2ZFFH 1A5IA 1SGNE 1SGFA 1O2OA 2YNBA 5CHAB 3FVFB 3I29A 3M61U 1QURH 1IQEA 4D9RA 3ZVAA 4FU9A 3RM0H 1S5SA 1OWIA 1Z8RA 5FAHA 1GGDC 2FOEA 1HJ9A 2PSXA 2BHGA 1FN8A 1DWCH 1P2OA 5E0JA 1G3BA 1D6RA 2ZWLH 3GS9A 3STIA 4JK6A 3PWBA 4Y11E 5FBIA 1LHDH 3RMNH 4TWYA 3M5OA 4OS2A 5EOKA 2V3OH 2WUCA 3L33A 1N8OB 3JZ2B 2KCAA 1C9TA 1EAIA 2BZ6H 3RLYH 4X2WA 1NRQH 2YMSB 3SGAE 1CU1A 1KXFA 5IDKA 1BMLA 4B76A 1NZQH 3F6UH 4ABGA 1B5GH 3UQVA 3UIRA 3GDSA 2JKHA 4JZIA 1MKWK 3TLOA 1H9LB 4WXIA 1BRBE 1JOUB 2BD7A 4JYUH 3P8OA 5C1UA 1DLKB 4B75A 2ZU2A 1CT0E 1ESBA 4Q7ZA 1ANCA 1EZXC 2PR3A 4Q7XA 3SI4H 2Z6BD 1BA8B 2DUCA 2XXLA 3C27B 4Y8YA 1WBGB 2AMQA 3UB0A 3HGNA 4D7GA 5HM9A 3E3TA 2OUAA 1MH0A 2C8WB 3F2FA 1YM0A 1QJ6B 1AY6H 1AO5A 1V3XA 4GHTA 1P9SA 5PTPA 4TT3D 3GCTG 1H4WA 2ZHQH 4YT6H 1OWDA 1HAVB 3P8GA 2GZ9A 3GCTF 1GJBB 3Q76A 4OGYA 2XTTB 1OP0A 1FMGA 5EIYA 3VB3A 1KXAA 4H6TA 3RLWH 1RGQA 4ZKRU 1GI7B 2EI8A 1EZSC 9LPRA 2GJGA 4HZHA 1Q31A 2WPIS 1BJUA 2RCEA 4JZFH 1O2SA 4AX9H 1A0JA 1TRYA 2GT7A 6CHAB 4TPYA 3RUOA 3G01A 4FU8A 3SYJA 2V35A 3ATWA 1NRNH 1IHTH 1SC8U 4F49A 1HJAB 2VH6A 1W0KD 1V2OT 3UNSA 4K60A 3UQOA 1UTMA 3BTHE 3BF6H 3EDXB 1GDNA 1O5EH 1ORFA 1TFXA 1WXRA 1O3AA 5GJ4B 1AB9B 4OS1A 4D8NA 2FLRH 1CO7E 5B6LA 1LPKB 3LC5A 2GV7A 2ZU1A 1JXPA 1GG6B 1HYLA 5C0UA 1THRH 2HNTF 3A82A 4CRAA 3BTGE 1HCGA 1DVAH 5AF9H 3F2HA 2YOLA 1TBRH 1HAVA 1MD8A 5FPYA 2AERH 2ZTZA 3PV5A 2A4GA 2RG3A 4D76A 2FI3E 1S6LA 4FUIA 3AW0A 3ODFA 1IQNA 4E06H 2A2QH 4ZMAH 4DVAU 1UK3A 4BOHA 5AVDA 2K0QA 3KYFA 2A0QB 1W7XH 2AS9A 4ZXYH 1O32A 5LPEA 1P9UA 2BXTH 3OTPA 3U9AH 4CRCA 2GTBA 4RKJB 3QX5H 1UMAH 1YLNA 4I8GA 1DE7H 3UFAA 1W3CA 1TOCB 1O38A 2ZHWH 1Z71A 1DSUA 1L2EA 3P70B 4IC6A 1P2JA 1A7SA 1O3HA 1O5AB 2FI5E 3GDUA 2M2AA 3ATIA 1HRTH 4NGAH 1HAOH 4AZ2B 4GPGA 1CHGA 1E79D 3MU8A 4WXVA 1JMOH 1FY5A 1GDQA 3KN2A 3W95A 1A0LA 1TE0A 5DP4A 2VWMA 4I8LA 2FOBA 3RU4T 3AVZA 1TGSZ 2G4UA 2UUKB 1NBMD 2QXHA 3IG6B 1OXGA 4YM9A 1FN6A 2AHME 1LCYA 3GY2A 2KCOA 3LKWA 4AGKA 3E8LA 2ODQA 3SNEA 3QGNB 1BDAA 1W14U 4B73A 2VIVA 2J2UA 1W7GH 4NZLA 5HXFA 4THNH 1O36A 1SKYE 2M5TA 2VJ1A 1ANDA 2PKAA 3VB4A 2GVFA 1FV9A 5EU8A 1A5HA 5SGAE 4J2YB 3E1XB 4X8TH 2GD4B 3I78A 1SHYA 2C4FH 1OX1A 1GHVH 1L1GA 3TGKE 1O35A 2RDEA 3DUXH 1SSXA 2IOTA 4ABDA 1CBWC 3V0XA 1QL9A 1SQRA 1RTFB 1ELBA 4XRNA 1YPGH 1SG8B 2WUBA 3A81A 1MCVA 1EJAA 5EQQA 3P6ZB 1ZZZA 3RXMA 1PQ5A 3Q00A 3GY7A 1GBFA 3LGYA 1UVUH 4UFGH 2ILNA 1TX6A 1J15A 1QQ4A 2V3MA 3U1JB 3A89A 2CF9H 1Q2WA 1AN1E 2Y5FA 2GZ8A 3UTUH 3ZYDA 3A84A 1O3OA 4BAHB 4I32A 7KMEH 1F5KU 3RM2H 4ACBA 3AAUA 3LIWA 1O3CA 3SU5A 3SHAH 1AFQC 3A8BA 3SJ9A 2ZDMA 2HLDD 4Y0YE 1A0HB 4B1TA 3BTQE 1ELTA 3PMAB 1K2I1 3ZVEA 2Z9IA 5F8XA 2ZTYA 2ZECA 4OM9A 3SJ8A 3RXIA 2R3YA 1DICA 3PV4A 3GY4A 5KECA 2ALPA 5IK2D 1O3EA 5EXMA 1IHSH 1ZJDA 1C5VA 1TNIA 2ZFPH 1A61H 2XW9A 1B7XB 3M7QA 1QNJA 1HNEE 1CA0C 1D6WA 1HLTH 1F0UA 1C2LA 4YESB 1KLJH 1VCPA 5JPMH 1YKTA 2QCYA 2VINA 1A46H 1Y8TA 5HIZA 1JRTA 5GNDA 4R8TB 1EPTC 3AAVA 2A4RA 3M3SA 3P92A 5EJLA 1CGJE 1O2YA 1PQ8A 4UD9H 1KXEA 1V2WT 3O8DA 4IMZA 1GCTC 1GJ4H 4CRGA 5E0GA 1C1WH 1HXEH 4HFPB 4Q63A 4AFZA 1Z7KA 1ELVA 1EXFA 1XUFA 1LMWB 4ZCNA 1QZ8A 3ZZCA 2OC7A 1NRSH 3RXKA 1DWDH 2NU2E 1NFXA 2Z3EA 2ZCHP 1UTNA 4NSVA 1AUJA 4ZUHA 1GJCB 5ESBA 5T6DA 3RXAA 2B9LA 1O2JA 3RC6A 2C93B 2QF0A 1VGCC 2P93A 1C5WB 3OX7U 1HIAB 1HDTH 4OS7A 4I8HA 1MU8B 5GPIB 2J95A 2XWAA 3GY8A 1G3EA 3L3TA 4RKOB 3Q77A 1TRNA 1HAGE 3OYPA 3OEED 1ETSH 4TYDA 3Q3XA 5DP3A 2F9NA 2Q1JA 1YYY1 3NZIA 1DWEH 1TQ0B 1C1RA 4FU7A 1C2IA 1T32A 2G00A 1P12E 6GCHG 1B0EA 1G2MA 2JJ2D 1GPZA 1RIWC 6GCHF 1DY9A 3BN9A 2FOGA 3ZYEA 1MBQA 5C1XA 4ABHA 3E91A 4K1SA 1S6FA 4FUHA 5JBAS 1O3DA 2Y7ZA 3S9CA 1IQGA 3FKSD 4JYVH 1XUHA 3RU4E 1DPOA 1GBBA 1INCA 1GBCA 2QXGA 3ELAH 5C94A 2W26A 1ZGVA 2Z9JA 3SZEA 4X8UH 2BOKA 1BBRE 4H42U 1GBMA 1DOJA 4MNWA 2P8OC 3VXFH 1KIGH 4B2CA 2PV9B 4WMDA 1GL1A 4LZ4B 1TX7A 1UTPA 3QN7A 2GP9B 2NU3E 5DSFA 1IQKA 1UTOA 2WYGA 4BAKB 5DP7A 1BTZA 1YPHC 3V12A 1HIAA 5CMXH 5C5OA 2PHBA 4BAQB 2BD4A 2ZFTA 1LQDB 2IN2A 1TABE 5A8YA 3RU4D 3T25A 2BX4A 2ZFSA 1TA6A 5FX6A 3RXLA 1ELFA 1GI4A 4ASUD 1Y3VA 2F9OA 2GCTB 2WYJA 1N1LA 1HPGA 2FPZA 3ZVFA 2EI6A 4DW2U 2ZF0H 2ZDVH 1ZPZA 3FO8D 3F1SB 2FOHA 1OS8A 2ZTXA 2BY6X 4JYTA 3TU7H 1AZZA 4BTIB 1BITA 1YCPM 1O2ZA 4U01A 1PPBH 1DDJA 2ANWA 4SGBE 1NTPA 2G8TA 2W6ID 1XUIA 5EW1H 3SGBE 1WUNH 4KGAA 3RMMH 3E6PH 2J34A 4B6FA 2J4IA 1GJAB 2ZG0H 1LVMA 3ITIA 1E1RD 4FOUC 5JDUB 2AEIH 5DGJA 1EZQA 2VBCA 2WPKS 3CP7A 1TMUH 3F68H 1CBWB 1WV7H 8LPRA 1AGJA 4FUFA 1OYQA 1DXPA 1BMMH 1F5RA 4Q7YA 1BZXE 1E1QD 2BY5X 3M3TA 2A4QA 5JB8S 1C5YB 1SR5C 4MNYA 2VIDA 2A45B 4ABIA 7LPRA 4NWLA 1LPGB 3TJVA 2BZAA 2FLBH 2O8TA 3H7OA 3U98H 3TJOA 1P8VC 1PFXC 4AORA 1EJMA 2PTCE 3SUDA 2QV1A 1V2JT 2Z3DA 3F9GA 4QT8C 1AFQB 1AUTC 2D26C 2G55A 2F9UA 3WY8A 2PKSC 3D62A 5JBCS 1C9PA 1O2TA 4Y8XA 2J98B 4CRFA 1Z8GA 1FY4A 2OQ5A 3T26A 4CBOA 1G36A 3KHVA 2CV3A 3ZZ4A 1G2LA 2UUJB 5F8TA 1V2TT 1UJ1A 1HAZB 2VVUA 1GBIA 3IWMA 1C1NA 3VGCC 2HLCA 3GCHC 1PJPA 1XX9A 1QB9A 1F7ZA 2OD3B 3IITA 1XVMA 2C8ZB 1ETRH 2ANYA 1CGIE 1CA0B 1ZMJA 2I6SA 3MO9A 3SU0A 1RXPA 4NZQA 5DJ7A 2TGPZ 1X7AC 4DY7B 5B6OA 1C5XB 2YMSD 5HKKD 1KSNA 1A2CH 3K9XB 2WPJS 3LH1A 3EGKH 4MPXA 3TGJE 1EPTB 1LVOA 1YPHE 2RDLA 4AC9A 3B23B 3AASA 4IC5A 2GCHG 2TIOA 2HNTC 2TGDA 1PYTC 1QHRB 1E35B 1PPGE 3MMGA 2GCHF 5CE1A 1DUAA 4X1QU 3DHKH 5CHBA 1FNIA 2G81E 1MQ6A 1LHCH 1SL3A 1HV7A 1H9IE 2OP9A 1SI5H 1P57B 3SNCA 4K1EA 2WV5A 1H8HD 2AIQA 1ZRBA 1EZUC 2BDBA 4Q4LA 5C17A 1UTLM 2AIPA 3A7XA 1VGCB 2XC4A 1QGFA 1PQ7A 3Q3YA 1C5MD 2EEKA 1OP8A 1C2KA 1GI3A 2J5UA 2Y6TA 2XBWA 5T6GA 3NRLA 2J98A 1BOQA 5E8EH 5DN6D 2JDID 3VFEA 2XC5A 4B2BA 2WPDD 3MHWU 3F3BA 4GSOA 5EG4A 4KTUA 5GIBA 4NSYA 3UY9A 1XUGA 3D49H 2ZHEH 1AU8A 2HRVA 1ZHRA 1AI8H 1ABIH 1O3MA 3TVJB 3VXEH 3UNRA 1RIWB 2Z94A 2QC2A 2A5IA 1OKXA 1BCUH 1IAUA 1PPEE 4A1XA 1AHTH 3RXPA 2ALVA 1ZPBA 1YBWA 2FX6A 1DT2A 1O2RA 3TJUA 4TWWA 1FY8E 1K22H 3UOPA 4Y7AA 1FAKH 1CHOG 5GWZA 1EPTA 1CHOF 4DOQA 2ZPSA 2CN0H 4NCYA 2ZPQA 3T27A 1QCPA 1D3PB 1L0ZA 2FWWA 3C1KA 2Y82A 4XDEA 2BLWA 4CRDA 3RXEA 1BTWA 2EQNA 1LKBA 3MOCA 4ISIH 3UWJH 4IN2A 2H6MA 1KXBA 3SOSA 2P8OB 3N7DA 1HFDA 1UVSH 1NT1A 3SJOA 4NA9H 1MKXH 1C1PA 1O5GH 4K2YA 5A0AE 2V7QD 2ZFRH 4FUDA 5C3NA 3PTNA 4X1RU 4YOGA 4D7FA 3ZIAD 1WTHD 1Z6JH 3LC3A 3FP7E 1MTWA 1MTUA 1XUJA 4XBDA 1C5ZB 2A1DB 2QXJA 1GBHA 1GHYH 3M5NA 2ZO3H 3F0OA 3KYGA 2F3CE 2KX4A 2L6OA 1RTLA 3BSQA 1KYNA 4UEHH 3RXVA 1O33A 3HK3B 3PMHB 1W0JD 1ZR0A 1HXFH 2W3KA 1YPEH 5EQSA 3MQKC 3STJA 3VG8A 1S85A 1ZPCA 1IOEA 1BHXF 5EJ1A 4BANB 3U8OH 3NKKA 2HNTE 3E16B 3PM3A 1IQMA 4UONA 1CA8B 1C1MA 1UO6A 3TK6A 1SGCA 1GBKA 2H5CA 4NIWA 1SLUB 1TNGA 2SGFE 3PLBA 3ZVBA 1GMDG 5EXNA 1DS2E 1GMDF 2PSYA 3EYDA 3BTWE 3QTOH 4MQAA 1T8NA 2CMYA 1SGQE 2JH5D 2XYAA 4X6PA 2BD9A 2KCYA 3SQHE 2W5EA 3V13A 1YCPH 2J92A 3PV2A 4YLQH 3V3MA 3BTFE 4F48B 1G3CA 4BNRA 2ZHDA 2SGEE 3M36A 3U28C 1O37A 3DSGA 4X8VH 2Q6FA 2JH0D 3VB6A 1E38B 1BQYA 3NCLA 3EE7A 4Y8ZA 2LELA 2A7JA 2BM2A 3A88A 1ZTJA 2GT8A 1F0TA 2O8UA 1MAYA 2B8OH 2ZNKH 1GJDB 1HBTH 2FIRH 1EAXA 2FODA 1P01A 1J16A 1C1VH 2F9VA 1TYNA 2XBYA 2FDAA 7ESTE 1P2IA 2PKAB 2PKSB 1F92A 1Y3WA 5DKMA 1ZJKA 3EE0B 3D23A 1OPHB 1O3PB 2TGTA 3FAOA 1GHZA 1ELAA 2ZGBH 1ZTLA 2HWLB 2I6QA 4LK4A 1W13U 1C5QA 3U1IB 1GMHG 1O2LA 2IJD1 1ZSLA 1GMHF 4AB9A 1BRCE 1E36B 1HB0B 1T8OA 2Y7XA 1QA0A 2VWLA 4WVPE 3GCHB 3T62A 4K8YA 3PMJA 1ZOMA 1CT2E 1EASA 1Z6EA 3SN8A 3QLPH 2BQWB 5L6NH 4XBBA 3S7KB 1COWD 1GDUA 1NN6A 2RFKC 5EPYA 1FIZA 2GDDA 3KQBA 1O0DH 2O9QA 5C2ZA 1T8LA 1GCDA 2FX4A 4VGCC 3W1EA 4CR9A 1V2KT 4TPIZ 4AFQA 3RXDA 2SGPE 2OINA 1A3BH 4KELA 1SFQB 2P94A 1SHHB 1Z1JA 2A2XH 1GI8B 5AFYH 4ZKOU 2IPHA 1E37B 3UR6A 1K28D 5FCRA 3RXFA 1K21H 2DE8A 1NESE 2D2DA 1TNHA 3NWUA 4HI3A 2R0LA 1ZHMA 1OSSA 5HYOA 2F43B 5A8XA 3M37A 1D3QB 5LPFA 2OBOA 3SNAA 4HG6A 3K6ZA 1D9IA 2P16A 1EUFA 3OFND 3FZZA 4WH8A 3EA7A 1GI1A 1GGDB 1ZHPA 3EAJA 4E7NA 3F0PA 4AGJA 2B0FA 2FTLE 4YLUA 1P2MA 3MO3A 2VWOA 1K1IA 3MWIU 3KEEA 4ISNA 1GJ7B 4RN6A 4ABFA 1FPCH 1ELGA 1XM1A 1XKAC 4WMEA 1C2HA 3KQCA 3SQEE 1SQTA 1C4V2 2H9HA 1MTNC 4YT7H 5T3HA 2BD8A 1T7CA 1KLTA 3ZZ5A 1TB6H 4KKDA 1V2RT 2IJOB 2AMPA 1ZMNA 5BPEA 2RA0A 1OWHA 1S0RA 3A7VA 3SU3A 1C5LH 2OQUA 3H09A 1NM6A 1IQLA 1ELCA 2CF8H 4Z1MD 3DD2H 7GCHG 2BTCE 1FAXA 1Q3XA 7GCHF 1C2JA 2XNDD 3MI4A 1PPFE 3A8AA 4ABEA 3FP8E 2VVCA 1AVXA 4K1TA 3JZ1B 4NIVA 5LPRA 1ARBA 3LJJA 2ODPA 4MPUA 1V2ST 1CQQA 1UVTH 5EPNA 5FHTA 2BD3A 3BEIB 3LDXH 1ACBE 4DG4A 1H8ED 2PUQH 4YOJA 2PWXA 3KNXA 2A4OA 3TIUA 3HATH 3LGUA 1THSH 2W7SA 1DM4B 3RXBA 1O2KA 5A09A 4ACAA 1NPMA 1TNKA 1MTVA 1O2MA 3RP2A 1FUJA 2CXVA 4B2AA 4AYVB 3QZQA 3P17H 1O3LA 1QB1A 1SGPE 1BJVA 2KAIB 3TH4H 4UFFH 1SOTA 4U30A 6LPRA 3BTKE 5FX5A 4LXBH 1N6XA 2VB0A 3SV9A 3WW7A 4MNVA 1LVYA 1ANBA 4FUBA 4NA7A 5T1VA 2SGQE 3SUEA 2F9BH 3SZNA 3L6PA 4I8KA 5BRRE 5DP8A 1EQ9A 3P95A 3SJIA 4CHAC 2LNCA 3MH7A 2C3SA 2QY0B 3A86A 1THPB 4IS5A 3PO1C 5FL7D 1JBUH 2ZGJA 3RXCA 4A7IB 5TJXA 2WINI 1LHFH 1VKYA 1UVOA 1YGCH 1SLVB 2K8IA 2ZKSA 3P8NA 1DX5M 4NWKA 2OCVB 3MH5A 2G4TA 4K5ZA 1QL7A 4YTAA 1SLWB 5CDFE 1TNLA 2BY7X 3B9FH 4MPVA 3K6YA 2QAAA 2PLXA 4CBNA 4GVUA 2G51A 3ZZ3A 5KGOA 4RT0A 1TA2A 2BB4A 1JWTA 1DLEA 1TONA 1H9HE 1LKAA 2OTVA 5A8ZA 2JJ1D 4AG1A 2ZFQH 2QF3A 2V3HH 2AH4X 1DANH 3ZZ9A 3W94A 2O8MA 2RA3A 4BXWA 2ZDLA 1VR1H 2D8WA 2KAIA 3TJNA 1NFUA 3RMOH 1EJNA 1QRZA 1P2QA 1EATA 1W10U 2SGDE 5DG6A 3V7TA 1V2LT 1CE5A 1V2PT 4I31A 1UVPA 4Y6DA 5C0TA 3MYWA 1P3CA 4X6NA 5G4BA 1OWKA 1XXFA 3BEFB 1P2KA 2FZZA 4UFEH 1MKXK 3KIDU 2SNWA 4KTSA 3FZDA 5HIYA 3SNDA 4M7GA 4ZHLU 2ZIQH 2ANMH 2FOAA 4X1NU 3VPKA 1BMAA 1EP6A 2A7CA 2ZEBA 3SUFA 3SV6A 1TOMH 2ZP0H 3GICB 3CNRA 2ESTE 1EKBB 1O5CB 1SLXB 2STAE 4E05H 1HAYB 1YPKH 3ATKA 5EJZA 2J94A 2GMTC 2FP7B 4PROA 1AKSB 4INLA 1ZSKA 4VGCB 1O3BA 3ESTA 1TMBH 1LO6A 1JRSA 2PGQB 3BTDE 4FUEA 2BVSH 2HPQH 5FPTA 2SNVA 3K65B 4X0WU 1WTGH 1S0QA 3A87A 5EW2H 1O3JA 1SB1H 4I7YH 1FLEE 1GJ9B 4AFUA 3MH6A 3A7YA 4JZEH 3F2GA 3A80A 3HK6B 1TWXB 4JK5A 1MTSA 4K69A 2P95A 3A7ZA 1J9CH 2XBXA 4A1VA 4FXGH 1TMTH 1SFIA 5EQRA 5HM2A 3M5MA 3QDZB 2GZ7A 1YCPK 4CRBA 2FS8A 1ZTKA 3ATLA 3MNXA 1DSTA 1GJ6A 4AYYB 2QXIA 3KQ5A 1SMFE 1TIOA 1K9OE 4ZXXH 2AMDA 5ABWA 3HPTB 1MTNB 4HGCA 1BTXA 3KQEA 1C5UA 1O2UA 1QY6A 3FFGA 1O2XA 1RTKA 1NRPH 3M35A 1AE8H 4A92A 1TQ7B 1VITG 5TCCA 2CK3D 2PGBB 1VITF 1T8MA 1DWBH 3U8TH 1EB2A 3BG4C 3LU9B 1AKSA 1KXCA 3TGIE 2OC0A 1WOFA 1K1OA 1LTOA 1K1NA 3BIUH 1G9IE 1M9UA 2ZC9H 4ASHA 3DCLA 4ZHAA 2AGEX 1O2PA 1DUEA 1NFYA 2WPMS 3PTBA 3RXRA 3GOVB 1GI6A 2R2MB 4B6EA 3ATMA 3R3GB 3TITA 3MNBA 4F4OC 3MU5A 1TRMA 1DXWA 3DFJA 3ENSB 3MU0A 3MU4A 2VVVA 2WHXA 4DT4A 2WZQA 3ZVDA 1K1LA 1O2GH 1C4U2 3SI3H 1BMNH 1BT7A 1QRXA 2FI4E 2ZDAH 4WY3A 1GI0A 1P05A 5HGGA 4O3UA 3CS7A 1W2KH 3M7TA 2NWNA 2VU8E 1UTQA 2QE7D 1P2NA 2FOCA 4AN7A 3K2UA 4IBLH 3A7TA 2P3FH 5GXPA 1GVZA 1ESAA 3S7HB 1LHEH 4X1SU 1XUKA 1XKBC 1O3KA 4K8BA 1QFKH 2WSSD 2FMJA 2W6JD 3OSYA 2PFEA 2G5NA 2HOBA 2DE9A 5L2ZH 1GL0E 4CHAB 3TPIZ 1GCTB 2VIQA 4A1TA 1L1JA 2HALA 1W8BH 3LGVA 3EA8A 2UUYA 2H1UA 3PO1B 2JETC 3SJKA 3QUMP 4GHQA 4B74A 2HVXA 1J8AA 1ZGIA 4FVBA 5F03A 1O2HA 2XCFA 5L30H 3OAAD 4A6LA 1NU9A 5AHGH 4Y7BA 2OC1A 2ASUB 4Z0KA 1V2NT 5DP9A 5KEDA 1TBZH 1RFNA 4YXWD 4K3JA 1WCZA 1YLDA 5K0HA 1C1UH 2A5AA 1AMHA 3SU4A 3U8RH 1EFRD 1G3DA 1KDQB 2O8LA 1O3FA 1NY22 2QYIA 1MZAA 2ULLA 1O3GA 3MTYA 3PLPA 4ISOA 4B71A 3B8JA 5E0HA 2NU4E 2BLQA 2VGCC 2ZU4A 3P8FA 1WDIA 4O03A 2ZZUH 1C4Y2 3BV9B 2L74A 3LT3A 2R3UA 3S9AA 1OOKB 3T29A 4E7RG 1J14A 1QR3E 1SGYE 1WU1A 1QBVH 3GY6A 1KY9A 4IN1A 3ZZDA 1GHXH 1NROH 4HTCH 3GCNA 2VWNA 2XOKD 1GWAA 4P02A 2SGAA 4JZDH 1OP2A 1V2MT 5GCHG 2A32A 1QRWA 3F9HA 5GCHF 1UCYH 2W7UA 4F55A 3F9FA 3WWFA 1TPSA 1YPJH 1BBRH 2Y81A 1GI2A 3Q3KA 3TK5A 1O2VA 5E2OA 1TX8A 5AFZH 1ESTA 1K1JA 4OS4A 3HKIB 3ZZ8A 3BTEE 1VJAU 4X6MA 1C2EA 1S82A 4IMQA 4TY7A 4UFDH 1BMFD 1TALA 1UK2A 2HGTH 3SBKA 1VCWA 1GVLA 2A31A 1BUIA 3UPEA 2GMTB 2TRMA 3O8RA 1O39A 5C20A 1KTTB 3RXGA 4CR5A 2OXSA 1K1MA 4MVNA 1DY8A 1FXYA 3LGWA 3O8BA 3T28A 4DIIH 5DP5A 1CSOE 1MUEB 3T5FH 1FQ3A 1VITH 1O2QA 1V2VT 2BYAX 1H8DH 3DSOA 2BDGA 1UTKA 2J9NA 1KDQA 1GBJA 1XVOA 1W11U 4ZAEA 3A7WA 2ZGHA 3KGPA 4INHA 1F2SE 2XC0A 2KZ4A 1YY3A 3KL6A 1G30B 1MCTA 2STBE 1UK4A 3D65E 3UREA 5I25A 1YPMH 3E0NB 2J97A 4XE4A 3S9BA 1YP9A 2JH6D 2BVRH 1LVBA 4ABJA 1O2WA 4ZHMU 2NU1E 3R0FA 1ARCA 2FEQH 5HMAA 2PP6A 4GLYA 2HPPH 3SV2H 1Z8IB 2ZHFH 3MNCA 4FUGA 1YPLH 1SGRE 2ZCKP 1VJ9U 2R0KA 4SGAE 3FN8A 1BTPA 2XNIA 3S69A 3RXTA 1IQHA 1TNJA 1XMNB 1DFPA 1G37A 1C5TA 1LDTT 3GYMA 4ABAA 1HJ8A 3SW2B 1O2IA 3ZZ7A 4NFEA 2AYWA 4MDSA 1O30A 1C2MA 1UHBB 2EY4C 2F83A 4DCDA 4AOQA 2BDYA 4IGDA 4XBCA 1BTYA 3GDVA 5F8ZA 1O31A 2BOHB 1A4WH 2XCNA 5FXLA 3BG4B 1P3EA 1PYTD 3LGTA 3RXOA 3VEQB 2A7HA 4FUCA 2AGIX 4GAWA 4X2XA 1YWUA 1GBAA 2CHAC 1GHWH 3A85A 1HAXB 1G32B 1T4VH 4U32A 1BRAA 5GDSH 2H2ZA 3FOAA 1Y59T 4DT7B 4H4FA 1O5BB 1ZRKA 3I77A 1ANEA 4WMFA 2GKVE 1GJ5H 5EXLA 1VCQA 2Q6GA 1CVWH 2WV4A 1BHXB 1GJ8B 1FI8A 4Y76A 1QTFA 1UW7A 1MBMA 1VZQH 3RC4A 5JYIA 4OS5A 1OHHD 5EGMA 3TK9A 1S84A 1AQ7A 1FY1A 3E90B 3VGCB 3ZZBA 2GGVB 1H8IH 4LZ1H 1C5SA 1KMHB 3VB5A 3H7TA 3TH3H 2Y80A 2ANKH 1QJ1B 4Q2KA 3CENA 2EA3A 4AG2A 2A5KA 4D9QA 3S0NA 2OC8A 2PW8H 3VB7A 2EC9H 2BQ7B 1NBME 4RSPA 1ZMLA 4FVDA 2XWBI 1WQVH 1JIMA 1AVGH 4Y79A 3AK5A 1P11E 1WQSA 2AGGX 1LQEA 2ZCLP 2FESH 3DA9B 4DURA 1F0SA 1C5NH 1UHBA 5J4SA 1OWJA 3N7EA 1BTHH 4I8JA 1T31A 2W3IA 1TPPA 1MD7A 1OYTH 4JZ1A 3RC5A 2CJIA 2JETB 2AFQB 1W12U 2R2WU 2ZPRA 1QB6A 3LPRA 3RXUA 1ELDE 1HUTH 1TAWA 1ELEE 2ZGCA 3LGIA 4BTTB 2GCTC 4UDWH 1UTJA 3PYHA 1O34A 2C90B 2V0BA 3KF2A 3NK8A 1GI9B 2UWPA 5ETXA 4O97A 4TY6A 1NC6A 1Y5AT 2B5TB 2P59A 2WV9A 1E0FD 2VGCB 4FETA 4NFFA 3LH3A 3QGJA 1O5DH 3ZV8A 4YOIA 2F91A 4CH8B 3HGPA 3NUMA 3BTTE 3MNSA 1QBOA 1BIOA 2ZGXH 2QF5A 8KME2 3RDZA 2KR7A 1B0FA 2KCPA 3OY6U 1AFEH 1TLDA 1O5FH 2CGAA 1FDPA 1IQIA 2P3TB 1IQFA 8ESTE 1QL8A 2C8YB 4DJZB 1LPZB 4Q80A 1EB1H 3BTME 3UR9A 4R0IA 1A3EH 2XBVA 5TCAA 2FYRA 2ZQ2A 4MG3A 1QA7A 3SGQE 1V2QT 4KTCA 3HKJB 3LJOA 2VIPA 3GYLB 4MLFB 1C1QA 1Y3XA 4X2VA 3RXJA 2BLOA 1ZYOA 1WAYB 2C8XB 3ZVGA 4YZUA 5LH8A 1MKWH 1NFWA 5DO4H 1EX3A 1C2GA 2SFAA 2ODYB 2THFB 1HAIH 1TPOA 4XOJA 1QBNA 2UWOA 3SORA 2HVYB 1MAXA 3ZZ6A 1FX0B 1Y5BT 2Z9KA 1V2UT 2KM0A 2Y5HA 1BRUP 2FOFA 2V6NA 3RXQA 2FO9A 2G5VA 1W0YH 2BDAA 4Y0ZE 1EAWA 8GCHG 1C1SA 1QQUA 3TH2H 8GCHF 3FP6E 1GI5A 3QWCH 1ZSJA 3TNSA 2ZQ1A 1O3NA 2TPIZ 1SQAA 3QK1A 2ZDNA 5C1YA 2GDEH 1H1BA 5H4IB 1YF4A 1FIWA 2LP6A 4H6SB 1SQOA 3BIVH 2UWLA 2FS9A 3GY3A 3MO6A 4XFQA 4ZROA 1L4ZA 1T4UH 2O8WA 3SO3A 1TGNA 4ZKNU 1P04A 1P10A 4NG9H 1PPZA 2FOMB 2BY8X 2Z3CA 3KCGH 1IQJA 4WWYA 5CHAC 1WSSH 3PROA 4BAOB 4XD7D 1HAHH 2J38A 1FONA 2B7DH 4ISHH 5C5NA 1EAUA 2XRCA 1S83A 1BTUA 2BMGB 4UE7H 1C5OH 3QTVH 4FUJA 2QF4A 5I46H 1FZZA 1AIXH 4JMYA 2ZU3A 2F4LA 2IPQX 2ZU5A 1C2FA 2NU0E 4X8SH 2QGRA 1GBEA 1S81A 4M9FA 1UCYK 2CHAB 1WYKA 5ESTE 2BDHA 1KTSB 2KFWA 2BVXH 1BBRK 3EA9A 3OY5U 1D3DB 4J1YA 1N8OC 3MU1A 4NA8A 2BX3A 1SGIB 2Y5GA 3M5LA 1GMCG 1C1OA 3GISB 2GX4A 1FPHH 1SGEE 1AE5A 3H5CB 1GMCF 2YMSC 1ID5H 3UUZA 3N99A 2BLVA 2G52A 2JIZD 1AWFH 1Z8JB 2R9PA 4XSKU 1RRKA 2WPLS 3UAIC 5FPSA 4P00A 4BAMB 2QN5T 3BG8A 3F9EA 2BD2A 3RXSA 1EOJA 2D1JA 1PPCE 3GY5A 1GVKB 2VIWA 1GHAG 3A8CA 1W0ZU 3SU1A 1NO9H 1GHAF 3BEUA 1AVWA 1K1PA 4CREA 1ZLRA 2VH0A 1UCYE 5F53A 3M3VA 1YLCA 1PPHE 1AD8H 1SOZA 1CT4E 3NPSA 2BQ6B 1AWHB 3CS0A 3DFLA 3SV8A 2Z9LA 3QZRA 1NRRH 2OK5A 5A2MH 1ABJH 1D4PB 3OU0A 2BXUH 3EQ0H 4WH6A 2Q6DA 1XXDA 1RS0A 3SV7A 4DIHH 1SGDE 1FY3A 4TSFD 4ISLA 1P0SH 3ZVCA 1NU7B 1SPJA 4ZH8A 4NIXA 3PLKA 2H9TH 3SUGA 1TGCA 1SGFG 4AB8A 5F6MA 3PMBB 3PRDA 1O3IA 3O8CA 1HAPH 1D3TB 3RMLH 4INKA 4ESTE 2ZDKA 2K1QA 1A5GH 3DT0H 1SVPA 2OBQA 3M7UA 5JBBS 2TGAA 2PTNA 4ABBA 1S6HA 2Z7FE 1P06A 4GCHG 1N6YA 2GV6A 3FANA 6CHAC 1F0RA 4GCHF 4WJG2 4Y71A 4AFSA 1V6DA 3UNQA 4IW4E 2P3UB 1CGHA 3A8DA 4X1PU 2TBSA 1Y5UT 2FTMA 1HGTH 1HJAC 4I86A 1A1RA 2F9PA 3URDA 1RJXB 2UUFB 4NIYA 2YNAA 5IYTA 2ZA5A 3A83A 1GBDA 5FBEA 1MABB 2FM2A 9ESTA 1U6QA 1C5RA 4X2YA 2Z9GA 4Y10E 3SU6A 1GHBG 1AB9C 2VNTA 1MQ5A 1GHBF 2EI7A 1QJ7B 1C1TA 3LOXA 1DITH 4Z6AH 3E0PB 4RT1A 1P03A 5DPAA 1KLIH 2ZI2H 1Z1IA 3OTJE 4I33A 3N7OA 3WWBA 1SBWA 3MH4A 1GG6C 3QO6A 2BDIA 5DP6A 4DGJA 1ETTH 2OLGA 1C2DA 2H5DA 1E34B 5K7RA 1GBLA 1P02A 3NXPA 3LONA 5J4QA 1QIXB 1C5PA 2WPHS 3KQDA 1BB0B 1EOLA 4ZKSU 3SHCH 4X6OA 3UOUA 3RXHA 1KXDA 1TGBA 5DK1A 4MTBA 3SU2A 2QA9E 5JBTA 2PUXB 1TBQH 1FJSA 3OEHD 5T6FA
chains in the Genus database with same CATH topology
4JCNA 4KP0A 2VIOA 5E2PA 3UWIA 4O3TA 5C67A 1GBTA 4OS6A 6ESTA 4MPWA 5A0CA 1J17T 5A0BA 2LPRA 4BXSA 1Y3YA 3MFJA 1LHGH 1F5LA 3ZZAA 5LGOA 2BDCA 1OWEA 1SGTA 1TPAE 2H9EH 1YC0A 4WF8A 4BTUB 1AZ8A 1JIRA 3TNTA 1Y3UA 2FXRA 3URCA 4A5TS 5FCKA 3GCOA 4GUXA 2BY9X 3ODDA 1TGTA 3T2NA 4LOYH 1L4DA 1EP5A 1MU6B 1RD3B 3PB1E 4MNXA 1PQAA 3PWCA 1P09A 3SNBA 1O2NA 4O9VA 1NS3A 5JB9S 2FYQA 4U2WA 2BD5A 3AW1A 4CH2B 1L1NA 1MZDA 3U69H 4OGXA 3ZV9A 2QIQA 1MMJN 4YO9A 5L2YH 5EODA 2ZFFH 1A5IA 1SGNE 1SGFA 1O2OA 2YNBA 5CHAB 3FVFB 3I29A 3M61U 1QURH 1IQEA 4D9RA 3ZVAA 4FU9A 3RM0H 1S5SA 1OWIA 1Z8RA 5FAHA 1GGDC 2FOEA 1HJ9A 2PSXA 2BHGA 1FN8A 1DWCH 1P2OA 5E0JA 1G3BA 1D6RA 2ZWLH 3STIA 4JK6A 3PWBA 4Y11E 5FBIA 1LHDH 3RMNH 4TWYA 3M5OA 4OS2A 5EOKA 2V3OH 2WUCA 3L33A 1N8OB 3JZ2B 1C9TA 1EAIA 2BZ6H 3RLYH 4X2WA 1NRQH 3SGAE 1CU1A 1KXFA 5IDKA 1BMLA 4B76A 1NZQH 3F6UH 4ABGA 1B5GH 3UQVA 3UIRA 3GDSA 2JKHA 4JZIA 1MKWK 3TLOA 1H9LB 4WXIA 1BRBE 1JOUB 2BD7A 4JYUH 3P8OA 5C1UA 1DLKB 4B75A 2ZU2A 1CT0E 1ESBA 4Q7ZA 1ANCA 1EZXC 2PR3A 4Q7XA 3SI4H 2Z6BD 1BA8B 2DUCA 2XXLA 3C27B 4Y8YA 1WBGB 2AMQA 3HGNA 4D7GA 5HM9A 3E3TA 2OUAA 1MH0A 2C8WB 1YM0A 1QJ6B 1AY6H 1AO5A 1V3XA 4GHTA 1P9SA 5PTPA 3GCTG 1H4WA 2ZHQH 4YT6H 1OWDA 1HAVB 3P8GA 2GZ9A 3GCTF 1GJBB 3Q76A 4OGYA 2XTTB 1OP0A 1FMGA 3VB3A 1KXAA 4H6TA 3RLWH 1RGQA 4ZKRU 1GI7B 2EI8A 1EZSC 9LPRA 4HZHA 1Q31A 2WPIS 1BJUA 2RCEA 4JZFH 1O2SA 4AX9H 1A0JA 1TRYA 2GT7A 6CHAB 4TPYA 3RUOA 3G01A 4FU8A 2V35A 3ATWA 1NRNH 1IHTH 1SC8U 4F49A 1HJAB 2VH6A 3UNSA 1V2OT 4K60A 3UQOA 1UTMA 3BTHE 3BF6H 3EDXB 1GDNA 1O5EH 1ORFA 1TFXA 1O3AA 5GJ4B 1AB9B 4OS1A 4D8NA 2FLRH 1CO7E 1LPKB 3LC5A 2GV7A 2ZU1A 1JXPA 1GG6B 1HYLA 1THRH 2HNTF 3A82A 4CRAA 3BTGE 1HCGA 1DVAH 5AF9H 2YOLA 1TBRH 1HAVA 1MD8A 5FPYA 2AERH 2ZTZA 2A4GA 2RG3A 4D76A 2FI3E 4FUIA 3AW0A 3ODFA 1IQNA 4E06H 2A2QH 4ZMAH 4DVAU 1UK3A 4BOHA 5AVDA 2A0QB 1W7XH 2AS9A 4ZXYH 1O32A 5LPEA 1P9UA 2BXTH 3U9AH 4CRCA 2GTBA 4RKJB 3QX5H 1UMAH 4I8GA 1DE7H 3UFAA 1W3CA 1TOCB 1O38A 2ZHWH 1Z71A 1DSUA 1L2EA 3P70B 4IC6A 1P2JA 1A7SA 1O3HA 1O5AB 2FI5E 3GDUA 3ATIA 1HRTH 4NGAH 1HAOH 4AZ2B 4GPGA 1CHGA 3MU8A 4WXVA 1JMOH 1FY5A 1GDQA 3KN2A 3W95A 1A0LA 1TE0A 5DP4A 2VWMA 4I8LA 2FOBA 3RU4T 3AVZA 1TGSZ 2G4UA 2UUKB 2QXHA 3IG6B 1OXGA 4YM9A 1FN6A 1LCYA 3GY2A 3LKWA 4AGKA 3E8LA 2ODQA 3SNEA 3QGNB 1BDAA 1W14U 4B73A 2VIVA 2J2UA 1W7GH 4NZLA 5HXFA 4THNH 1O36A 2M5TA 2VJ1A 1ANDA 2PKAA 3VB4A 2GVFA 1FV9A 5EU8A 1A5HA 5SGAE 4J2YB 3E1XB 4X8TH 2GD4B 3I78A 1SHYA 2C4FH 1OX1A 1GHVH 1L1GA 3TGKE 1O35A 3DUXH 1SSXA 2IOTA 4ABDA 1CBWC 3V0XA 1QL9A 1RTFB 1ELBA 1YPGH 1SG8B 2WUBA 3A81A 1MCVA 1EJAA 5EQQA 3P6ZB 1ZZZA 3RXMA 1PQ5A 3Q00A 3GY7A 1GBFA 3LGYA 1UVUH 4UFGH 2ILNA 1TX6A 1J15A 1QQ4A 3U1JB 3A89A 2CF9H 1Q2WA 1AN1E 2Y5FA 2GZ8A 3UTUH 3ZYDA 3A84A 1O3OA 4BAHB 4I32A 7KMEH 1F5KU 3RM2H 3AAUA 3LIWA 1O3CA 3SU5A 3SHAH 1AFQC 3A8BA 3SJ9A 2ZDMA 4Y0YE 1A0HB 4B1TA 3BTQE 1ELTA 3PMAB 1K2I1 3ZVEA 2Z9IA 5F8XA 2ZTYA 2ZECA 3SJ8A 3RXIA 2R3YA 1DICA 3PV4A 3GY4A 2ALPA 1O3EA 5EXMA 1IHSH 1ZJDA 1C5VA 1TNIA 2ZFPH 1A61H 2XW9A 1B7XB 3M7QA 1QNJA 1HNEE 1CA0C 1D6WA 1HLTH 1F0UA 1C2LA 4YESB 1KLJH 1VCPA 5JPMH 1YKTA 2QCYA 2VINA 1A46H 1Y8TA 1JRTA 4R8TB 1EPTC 3AAVA 2A4RA 3M3SA 3P92A 1CGJE 1O2YA 1PQ8A 4UD9H 1KXEA 1V2WT 3O8DA 4IMZA 1GCTC 1GJ4H 4CRGA 5E0GA 1C1WH 1HXEH 4HFPB 4AFZA 1Z7KA 1ELVA 1EXFA 1XUFA 1LMWB 3ZZCA 2OC7A 1NRSH 3RXKA 1DWDH 2NU2E 1NFXA 2Z3EA 2ZCHP 1UTNA 4NSVA 1AUJA 4ZUHA 1GJCB 5ESBA 5T6DA 3RXAA 2B9LA 1O2JA 3RC6A 2C93B 2QF0A 1VGCC 2P93A 1C5WB 3OX7U 1HIAB 1HDTH 4OS7A 4I8HA 1MU8B 5GPIB 2J95A 2XWAA 3GY8A 1G3EA 3L3TA 4RKOB 3Q77A 1TRNA 1HAGE 3OYPA 4TYDA 1ETSH 3Q3XA 5DP3A 2F9NA 2Q1JA 1YYY1 3NZIA 1DWEH 1TQ0B 1C1RA 4FU7A 1C2IA 1T32A 2G00A 1P12E 6GCHG 1B0EA 1G2MA 1GPZA 1RIWC 6GCHF 1DY9A 3BN9A 2FOGA 3ZYEA 1MBQA 5C1XA 4ABHA 3E91A 4K1SA 1S6FA 4FUHA 5JBAS 1O3DA 2Y7ZA 3S9CA 1IQGA 4JYVH 1XUHA 3RU4E 1DPOA 1GBBA 1INCA 1GBCA 2QXGA 3ELAH 2W26A 1ZGVA 2Z9JA 4X8UH 2BOKA 1BBRE 4H42U 1GBMA 1DOJA 4MNWA 2P8OC 3VXFH 1KIGH 4B2CA 2PV9B 4WMDA 1GL1A 4LZ4B 1TX7A 1UTPA 3QN7A 2GP9B 2NU3E 1IQKA 1UTOA 2WYGA 4BAKB 5DP7A 1BTZA 1YPHC 3V12A 1HIAA 5CMXH 5C5OA 2PHBA 4BAQB 2BD4A 2ZFTA 1LQDB 2IN2A 1TABE 5A8YA 3RU4D 3T25A 2BX4A 2ZFSA 1TA6A 5FX6A 3RXLA 1ELFA 1GI4A 1Y3VA 2F9OA 2GCTB 2WYJA 1N1LA 1HPGA 2FPZA 3ZVFA 2EI6A 4DW2U 2ZF0H 2ZDVH 1ZPZA 3F1SB 2FOHA 1OS8A 2ZTXA 2BY6X 4JYTA 3TU7H 1AZZA 4BTIB 1BITA 1YCPM 1O2ZA 4U01A 1PPBH 1DDJA 2ANWA 4SGBE 1NTPA 2G8TA 1XUIA 5EW1H 3SGBE 1WUNH 4KGAA 3RMMH 3E6PH 2J34A 2J4IA 1GJAB 2ZG0H 1LVMA 3ITIA 5JDUB 2AEIH 5DGJA 1EZQA 2WPKS 3CP7A 1TMUH 3F68H 1CBWB 1WV7H 8LPRA 1AGJA 4FUFA 1OYQA 1DXPA 1BMMH 1F5RA 4Q7YA 1BZXE 2BY5X 3M3TA 5JB8S 2A4QA 1C5YB 1SR5C 4MNYA 2VIDA 2A45B 4ABIA 7LPRA 4NWLA 1LPGB 3TJVA 2BZAA 2FLBH 2O8TA 3H7OA 3U98H 3TJOA 1P8VC 1PFXC 4AORA 1EJMA 2PTCE 3SUDA 2QV1A 1V2JT 2Z3DA 3F9GA 4QT8C 1AFQB 1AUTC 2D26C 2G55A 2F9UA 3WY8A 2PKSC 3D62A 5JBCS 1C9PA 1O2TA 4Y8XA 4CRFA 1Z8GA 1FY4A 2OQ5A 3T26A 4CBOA 1G36A 3KHVA 2CV3A 3ZZ4A 1G2LA 2UUJB 5F8TA 1V2TT 1UJ1A 1HAZB 2VVUA 1GBIA 3IWMA 1C1NA 3VGCC 2HLCA 3GCHC 1PJPA 1XX9A 1QB9A 1F7ZA 2OD3B 3IITA 1XVMA 2C8ZB 1ETRH 2ANYA 1CGIE 1CA0B 1ZMJA 2I6SA 3MO9A 3SU0A 1RXPA 4NZQA 5DJ7A 2TGPZ 1X7AC 4DY7B 5B6OA 1C5XB 1KSNA 1A2CH 3K9XB 2WPJS 3LH1A 3EGKH 4MPXA 3TGJE 1EPTB 1LVOA 1YPHE 2RDLA 3B23B 3AASA 4IC5A 2GCHG 2TIOA 2HNTC 2TGDA 1PYTC 1QHRB 1E35B 1PPGE 3MMGA 2GCHF 5CE1A 1DUAA 4X1QU 3DHKH 1FNIA 2G81E 1MQ6A 1LHCH 1SL3A 1HV7A 1H9IE 2OP9A 1SI5H 1P57B 3SNCA 4K1EA 2WV5A 2AIQA 1ZRBA 1EZUC 2BDBA 1UTLM 2AIPA 3A7XA 1VGCB 2XC4A 1QGFA 1PQ7A 3Q3YA 1C5MD 2EEKA 1OP8A 1C2KA 1GI3A 2Y6TA 2XBWA 5T6GA 1BOQA 5E8EH 3VFEA 2XC5A 4B2BA 3MHWU 4GSOA 5EG4A 4KTUA 5GIBA 4NSYA 3UY9A 1XUGA 3D49H 2ZHEH 1AU8A 2HRVA 1ZHRA 1AI8H 1ABIH 1O3MA 3TVJB 3VXEH 3UNRA 1RIWB 2Z94A 2QC2A 2A5IA 1OKXA 1BCUH 1IAUA 1PPEE 4A1XA 1AHTH 3RXPA 2ALVA 1ZPBA 1YBWA 2FX6A 1DT2A 1O2RA 3TJUA 4TWWA 1FY8E 1K22H 3UOPA 4Y7AA 1FAKH 1CHOG 5GWZA 1EPTA 1CHOF 4DOQA 2ZPSA 2CN0H 4NCYA 2ZPQA 3T27A 1QCPA 1D3PB 1L0ZA 2FWWA 3C1KA 2Y82A 4XDEA 2BLWA 4CRDA 3RXEA 1BTWA 1LKBA 3MOCA 4ISIH 3UWJH 4IN2A 2H6MA 1KXBA 3SOSA 2P8OB 1HFDA 1UVSH 1NT1A 3SJOA 4NA9H 1MKXH 1C1PA 1O5GH 4K2YA 5A0AE 2ZFRH 4FUDA 5C3NA 3PTNA 4X1RU 4YOGA 4D7FA 1WTHD 1Z6JH 3LC3A 3FP7E 1MTWA 1MTUA 1XUJA 4XBDA 1C5ZB 2A1DB 2QXJA 1GBHA 1GHYH 3M5NA 2ZO3H 2F3CE 1RTLA 3BSQA 1KYNA 4UEHH 3RXVA 1O33A 3HK3B 3PMHB 1ZR0A 2W3KA 1HXFH 1YPEH 5EQSA 3STJA 1S85A 1ZPCA 1IOEA 1BHXF 4BANB 3U8OH 3NKKA 2HNTE 3E16B 3PM3A 1IQMA 4UONA 1CA8B 1C1MA 1UO6A 3TK6A 1SGCA 1GBKA 2H5CA 4NIWA 1SLUB 1TNGA 2SGFE 3PLBA 3ZVBA 1GMDG 5EXNA 1DS2E 1GMDF 2PSYA 3EYDA 3BTWE 3QTOH 4MQAA 1T8NA 2CMYA 1SGQE 2JH5D 2XYAA 4X6PA 2BD9A 3SQHE 2W5EA 3V13A 1YCPH 2J92A 4YLQH 3V3MA 3BTFE 1G3CA 4BNRA 2ZHDA 2SGEE 3M36A 1O37A 4X8VH 2Q6FA 2JH0D 3VB6A 1E38B 1BQYA 3NCLA 4Y8ZA 2A7JA 2BM2A 3A88A 1ZTJA 2GT8A 1F0TA 2O8UA 1MAYA 2B8OH 2ZNKH 1GJDB 1HBTH 2FIRH 1EAXA 2FODA 1P01A 1J16A 1C1VH 2F9VA 1TYNA 2XBYA 2FDAA 7ESTE 1P2IA 2PKAB 2PKSB 1F92A 1Y3WA 5DKMA 1ZJKA 3EE0B 3D23A 1OPHB 1O3PB 2TGTA 3FAOA 1GHZA 1ELAA 2ZGBH 1ZTLA 2HWLB 2I6QA 4LK4A 1W13U 1C5QA 3U1IB 1GMHG 1O2LA 1ZSLA 1GMHF 4AB9A 1BRCE 1E36B 1HB0B 1T8OA 2Y7XA 1QA0A 2VWLA 4WVPE 3GCHB 3T62A 4K8YA 3PMJA 1ZOMA 1CT2E 1EASA 1Z6EA 3SN8A 3QLPH 2BQWB 5L6NH 4XBBA 3S7KB 1GDUA 1NN6A 5EPYA 1FIZA 2GDDA 3KQBA 1O0DH 2O9QA 5C2ZA 1T8LA 1GCDA 2FX4A 4VGCC 4CR9A 1V2KT 4TPIZ 4AFQA 3RXDA 2SGPE 2OINA 1A3BH 4KELA 1SFQB 2P94A 1SHHB 1Z1JA 2A2XH 1GI8B 5AFYH 4ZKOU 2IPHA 1E37B 3UR6A 1K28D 5FCRA 3RXFA 1K21H 2DE8A 1NESE 2D2DA 1TNHA 3NWUA 4HI3A 2R0LA 1ZHMA 1OSSA 5HYOA 5A8XA 3M37A 1D3QB 5LPFA 2OBOA 3SNAA 3K6ZA 1D9IA 2P16A 1EUFA 3FZZA 4WH8A 3EA7A 1GI1A 1GGDB 1ZHPA 3EAJA 4E7NA 4AGJA 2B0FA 2FTLE 4YLUA 1P2MA 3MO3A 2VWOA 1K1IA 3MWIU 3KEEA 4ISNA 1GJ7B 4RN6A 4ABFA 1FPCH 1ELGA 1XM1A 1XKAC 4WMEA 1C2HA 3KQCA 3SQEE 1SQTA 1C4V2 2H9HA 1MTNC 4YT7H 5T3HA 2BD8A 1T7CA 1KLTA 3ZZ5A 1TB6H 4KKDA 1V2RT 2IJOB 2AMPA 1ZMNA 5BPEA 2RA0A 1OWHA 1S0RA 3A7VA