1W14U

Urokinase type plasminogen activator
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of Urokinase Type Plasminogen Activator Complexes Reveal the Binding Mode of Peptidomimetic Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2004-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1w14U01
4ZROA 2HVXA 1RTFB 1Z1IA 3M5OA 3T26A 2ZDMA 1NO9H 1NS3A 1ELTA 4Y8YA 1XXFA 2F9OA 2H1UA 1O3JA 1KTSB 1EOJA 2R2WU 4ZKRU 4HZHA 1ABIH 1MTWA 2QN5T 2SNWA 2BY8X 1MBQA 3MNBA 4IC6A 5DGJA 3ZV8A 1AI8H 1TB6H 3SU6A 1W7XH 1KLTA 1GG6B 2UWOA 4K60A 5EXNA 3MMGA 4KTUA 4JK5A 2C8XB 3RXLA 4NFFA 2SGFE 4B2CA 4FUCA 3BIUH 1CA0B 1RIWC 2AGGX 3RXDA 4YOGA 3MU0A 4U2WA 1DWDH 4K3JA 1ZTKA 3U1JB 1HJ9A 1DLKB 2EI6A 4NIVA 3SUFA 3BTWE 1P12E 1LPGB 1TMUH 2W5EA 3GISB 1F7ZA 3S7KB 2JETB 4A7IB 1LMWB 1OSSA 3DFJA 1OWHA 1PPEE 1V2UT 1C2KA 1ELAA 3LGWA 4WXVA 3BTFE 3GCTG 2QXGA 5J4SA 1SFIA 3SV7A 4FU9A 4CRCA 1G3CA 4ABDA 4DIHH 1GBTA 2STBE 2ZZUH 4IMQA 5HXFA 1P2IA 2VNTA 4UE7H 4XDEA 2BY5X 1SLVB 4Y7BA 5E0HA 2PKAB 2OC7A 3GYLB 5PTPA 3VB7A 1MKWH 1V2TT 1TE0A 3GCHB 5C5NA 4IN1A 1ANBA 1TA2A 1WQVH 2ZCHP 3LU9B 2HPPH 2HNTE 3GOVB 5DP5A 3UQVA 1NRSH 3LGVA 4NZLA 1S81A 3QZQA 3MWIU 1XUJA 4R0IA 4K69A 1FY8E 3BEIB 2P3UB 1C9PA 1F0RA 2GD4B 3LGYA 3RLWH 3E91A 1NRQH 2A7HA 2GMTC 1ARBA 2QF0A 3SI4H 1UVOA 1O2WA 2TGDA 4ZKNU 1BIOA 1V2QT 2QXJA 4OS6A 1HIAA 4Y8ZA 1OP0A 3R0FA 2XNIA 4DIIH 1C5NH 1FZZA 4CRFA 5L30H 4B73A 3SU2A 2WV4A 5DKMA 1DOJA 4NCYA 2KAIA 1C4Y2 1QA0A 1D6RA 3Q77A 2O8LA 4GPGA 1SGTA 4CRGA 2FESH 1FN8A 4I8GA 3M5LA 4X2VA 3LPRA 1V2PT 2OQUA 2A7JA 1V2MT 2QXIA 3ELAH 1ZLRA 1BTXA 5GPIB 1O5BB 2FOCA 1CBWC 4KTCA 5TCAA 2ODPA 3ZYDA 1DX5M 4VGCB 4CR5A 5JYIA 4MDSA 1DSUA 2HNTC 1AFQC 3QN7A 4LK4A 5EU8A 2BD5A 1PPFE 1PQ8A 1SC8U 1KDQA 1O3BA 1D3TB 2Y7XA 3V13A 1ELFA 3NPSA 5JBCS 4HI3A 1M9UA 4UDWH 1V2ST 1AGJA 1EPTA 1L1NA 4BTUB 4X6PA 1V2NT 2XYAA 2BD9A 2IN2A 1ETSH 4Q7XA 4BXSA 4E7RG 3S9BA 1TMBH 1MD8A 4ISIH 3LOXA 1YPHE 3ZZBA 3F9HA 1ZR0A 5T6GA 2C90B 1S0QA 3NK8A 4OS5A 4D8NA 4ZHLU 2Z9IA 5JB8S 1OWEA 2SGDE 4FXGH 4A1XA 4OS4A 5FCRA 1O3IA 5FHTA 3RXRA 4MNYA 5EQRA 1QBNA 3I77A 1TGBA 1RS0A 3PO1C 3FVFB 3RP2A 3F9FA 2FXRA 1AZZA 4WH8A 4Y6DA 1HIAB 4AG2A 3PMHB 1IQEA 5JDUB 8ESTE 1HAIH 1FY3A 1SQAA 3O8BA 3ATIA 1S5SA 1PPCE 2XC4A 4A92A 4U01A 1W2KH 4X8TH 2KAIB 4YOIA 1AN1E 1ELEE 1AE5A 4DG4A 1ZMNA 2OD3B 4DVAU 1O2ZA 1SGCA 2P95A 1PPBH 3E0NB 3PLKA 1P09A 1EQ9A 3RXHA 5K0HA 1XMNB 3UWJH 3ZVCA 2FI3E 4MPUA 4AB8A 1LKBA 4E06H 1LVBA 1T7CA 3O8CA 3Q76A 2BDAA 3BN9A 1GDUA 5DP3A 5FPSA 4JZIA 4U32A 2THFB 5EODA 1O5EH 1RXPA 1Z7KA 3TK9A 4YLQH 3SJ9A 2BY9X 4ESTE 4ISOA 4KELA 1XUIA 1FY4A 2BMGB 2ZU5A 3BTEE 1LHEH 2ILNA 2VINA 3SNAA 2AMDA 1KDQB 1GHAF 1VJAU 2OQ5A 5FPYA 3ZZ6A 2ZF0H 5CE1A 2FOFA 1UCYK 2ZFSA 1EPTB 1BHXB 3KEEA 1B7XB 1C5SA 4JCNA 2UWPA 1GJ4H 1JMOH 5T6DA 2GKVE 1IAUA 2VWNA 4NIYA 4ZHAA 1T8LA 1EAWA 1JOUB 2BLVA 1AVGH 2RA0A 3ZVEA 2FIRH 1V2RT 3SUGA 1TALA 2ZDLA 2ZGCA 1GMCF 3EE0B 4XBDA 4ABJA 4Y11E 3UR9A 1DSTA 1THPB 4MVNA 2QYIA 1O2OA 2VU8E 1TBZH 1DWBH 4BTIB 5C20A 1BA8B 1TGTA 1Y3UA 2ODQA 1HRTH 3SU5A 5JBAS 3M5MA 1BJVA 1J9CH 1F5KU 1T4VH 5IYTA 1GBAA 1TYNA 2ULLA 2R3YA 2GCTB 3SHCH 4ASHA 1G3DA 2I6SA 4YLUA 2J2UA 3OX7U 1IQLA 2QA9E 4O03A 1G36A 4UFFH 3LDXH 4OS2A 6CHAB 1S0RA 3RM0H 4DURA 5DPAA 3E6PH 4IW4E 1ZGIA 1ZSJA 4I8JA 1W10U 2BQ7B 1V2LT 1O3LA 1CU1A 2UUFB 4CREA 2VIWA 1MD7A 3A7WA 1HAGE 3S9AA 1MUEB 1N8OB 1YF4A 1FAXA 1FLEE 2VB0A 2CXVA 1SGIB 2R2MB 5K7RA 1P10A 3KIDU 1DUAA 2BVRH 3GDVA 3Q3YA 2PKSB 5A8ZA 1TGNA 8KME2 1Y5AT 3B8JA 1GJ7B 1F5LA 6ESTA 1GHVH 2F9UA 1IHTH 1A4WH 1MAYA 4CHAB 2H2ZA 1OWJA 1BMNH 1XVOA 1ZSKA 4I8LA 3TJNA 3TJUA 1O2SA 2H9HA 3O8RA 1WBGB 2CMYA 2J4IA 2BOHB 5IDKA 5G4BA 1NZQH 1DY8A 3SGBE 3ZZ9A 1ZHMA 3BIVH 1SGFG 3URCA 3RXSA 1V2VT 1AKSA 4X1SU 3SU3A 1E37B 2OBQA 2BQ6B 2VIVA 5LPEA 1YBWA 4ABHA 1QB6A 1MCVA 1UVTH 4INHA 1L1JA 3I29A 5ESTE 1T4UH 2FS8A 5L6NH 1GBKA 4H6TA 3P6ZB 1Q3XA 2R3UA 4WMEA 1XX9A 1ZPCA 4K2YA 1P9UA 1Q31A 1HJAB 5JBBS 3Q3XA 3BG4B 1O5CB 1H4WA 2VH6A 1GHYH 4Q7YA 5FCKA 5GIBA 3VB3A 1CT4E 1MKWK 1ZPZA 4X1PU 1YPLH 1L2EA 1EOLA 1O5FH 1GCTC 4X8SH 2RDLA 1ZRBA 1F5RA 5FPTA 1L4ZA 3P17H 2CGAA 4ZHMU 2VIPA 1GMCG 4IGDA 4I33A 1AE8H 1PPZA 3BSQA 1UTMA 4MNXA 1NRRH 4YTAA 3SJKA 3SV9A 1AFEH 2HOBA 3ZZDA 4XFQA 3A84A 3OY5U 2Z9LA 1J15A 5TCCA 3UY9A 1TFXA 3QUMP 3ZVFA 1GGDB 2A5KA 3ZZAA 4JZ1A 3I78A 1O2JA 3FANA 1NFXA 1H9HE 7KMEH 1P01A 1IQHA 1EKBB 2FP7B 1UMAH 2QXHA 2ZWLH 2ANYA 2QCYA 2AERH 3P8FA 1YCPM 4FVBA 3HK6B 2J9NA 2CHAC 1O2UA 1BUIA 5EOKA 4UEHH 2UWLA 1TRNA 3UNRA 3ZZ7A 1NM6A 3UOPA 5GCHF 1A2CH 1GBFA 2P59A 2J95A 1ESAA 4TYDA 4H42U 2A32A 2GZ9A 2XW9A 2YOLA 3U1IB 1QY6A 1AKSB 1YPGH 2G4UA 3KN2A 1K1NA 2ZTZA 3OU0A 3PM3A 2H9TH 2F9VA 4RKOB 3RXQA 1IQIA 1FPHH 1YC0A 5EQQA 2SNVA 3ATKA 1BB0B 5FBIA 1F0UA 1GMDG 2FMJA 1F92A 5EPNA 2GTBA 1JXPA 2PSXA 2A4GA 2AH4X 4X2YA 5A09A 1D3DB 3BTKE 1O2IA 4JZFH 3A8DA 4BAMB 2GV6A 2A7CA 2BXUH 4Y0YE 3BEFB 1BTHH 1GL0E 2PUQH 4LZ4B 2NU4E 3PYHA 1HJ8A 5C5OA 2YNBA 1SSXA 2O8WA 4NZQA 2GGVB 3PTNA 1GBMA 2FYRA 3GY6A 1B0FA 1UK3A 1C2GA 1LCYA 2B8OH 1HAHH 5HMAA 2R9PA 4IMZA 1EX3A 1YKTA 2V3OH 2V3HH 5L2ZH 1FIZA 3TH3H 1C5ZB 3MU4A 4AFZA 1G9IE 2ZU4A 1AY6H 1HAZB 1EB1H 5ETXA 4OGXA 1ANCA 2F9NA 2ZU1A 1C9TA 2EEKA 2PGQB 5CHAB 1CA0C 2ZFTA 1P2NA 4I8HA 4ZMAH 1O3EA 2XCNA 3LH3A 4WF8A 4JK6A 1KYNA 3ZVBA 3A8BA 2G00A 4I8KA 4ZUHA 3S0NA 1TAWA 3PWBA 2WPHS 3RXAA 3V7TA 5C1XA 2JETC 1TONA 4B75A 4CH2B 3NWUA 2QY0B 2BZ6H 4MPWA 2O8UA 3GICB 3RMMH 2F9PA 2PKAA 1W3CA 5DP4A 1O34A 1YP9A 2NU0E 4JZEH 2W26A 2D8WA 4OS1A 1HAOH 1UVUH 4AB9A 1TNIA 1C1PA 1EZQA 4Y7AA 2IPHA 1C1MA 3D23A 3LGUA 3P8GA 3OTJE 2Z3DA 4THNH 2AEIH 1C5UA 1IQMA 2BLWA 2Y80A 4BAHB 3P8OA 4X2WA 1SR5C 3EQ0H 2F83A 1KXEA 1K1JA 1TMTH 2W7SA 1CQQA 3KQEA 3QGNB 1GBJA 1W8BH 3H7OA 3P92A 3GY7A 3A82A 3MO9A 3QGJA 5GCHG 4Y8XA 4XSKU 1ELDE 1AVWA 1GHZA 3SUDA 4ZKSU 1K22H 2NWNA 1VITH 2IOTA 3VXFH 2BD8A 3K65B 6GCHF 2WV5A 1TX6A 3RXFA 2WUCA 3RXOA 3SNBA 4ABFA 1MTNB 2H9EH 1EAIA 2OLGA 3LC5A 3CS7A 3LJJA 4NA7A 3ZZCA 2ZC9H 1MBMA 2Z9KA 3KHVA 3AW0A 4MTBA 1C1UH 1CVWH 1T8NA 1Z1JA 1DXWA 5FAHA 3QWCH 1C5OH 2FS9A 4JMYA 1HAYB 3UUZA 1A61H 1TOCB 1K21H 3TU7H 4YOJA 3BEUA 2B7DH 2B5TB 1QQUA 2BY7X 1XKBC 1Y8TA 2HWLB 1AB9B 2PSYA 2AMPA 1P2KA 8GCHF 4DJZB 1Y5UT 2AFQB 2GCHF 1BTUA 1GBLA 1AUTC 3RC6A 1LDTT 5GJ4B 3SU1A 1O0DH 2Y5HA 5F8ZA 1U6QA 4VGCC 4PROA 3NUMA 2W3IA 3LJOA 2FTLE 1C5VA 2F9BH 1LO6A 4OS7A 4DGJA 1SFQB 5B6OA 1Z6JH 4I31A 1D3PB 1O2YA 4IC5A 1FIWA 2ZO3H 1VCQA 1S85A 2CF9H 2FLRH 3E0PB 3NXPA 5EQSA 3ITIA 2D26C 5JPMH 4DOQA 1ZHPA 4AYYB 1G2LA 1LVMA 5AVDA 1TNLA 3E16B 4BAOB 2OCVB 1QB1A 1S84A 1P2JA 1XM1A 4GCHF 1O3DA 2GP9B 1DVAH 2A0QB 1C1SA 2ZQ1A 4ISNA 1P06A 4UFDH 4K1TA 1O3OA 4WH6A 5DP7A 1GI5A 3B9FH 1LVOA 4B76A 1OP2A 1GJ8B 3U69H 2P16A 3RXEA 3AASA 3SNDA 3TH4H 5A2MH 3GCOA 2HRVA 1RIWB 3QDZB 1O2LA 2XWAA 1MKXH 1BZXE 3RMLH 2JKHA 3E3TA 1EB2A 1F2SE 3Q00A 1UVSH 1GMHF 4Z6AH 3HKIB 1IQNA 1C2FA 1QBVH 3TNTA 1HXEH 3VPKA 1QRXA 4Y79A 1AU8A 4B74A 1SGRE 1ZTJA 2Z3CA 1AVXA 3LONA 1ZPBA 2BD3A 4LXBH 3RXKA 5DP8A 4SGAE 1Z8IB 2H6MA 4INLA 2BLQA 1KTTB 3L6PA 2GVFA 3NCLA 1WV7H 6GCHG 4XBBA 1AD8H 1GL1A 2XWBI 4GHTA 2SFAA 2UUKB 1FONA 1YM0A 2JH0D 3A7YA 3A81A 3RC4A 4BOHA 1E38B 1H9LB 4NGAH 1TNGA 1W0YH 1MQ5A 2ANWA 1MQ6A 2VWLA 2D1JA 2J92A 3M7TA 3TIUA 1C2DA 1VITF 1E0FD 3SJOA 1C5WB 3Q3KA 3S9CA 1SHYA 2ZTYA 3B23B 1N1LA 3RM2H 1Z71A 2BD7A 1P57B 2DE8A 3GYMA 1T32A 3VXEH 8GCHG 4FUDA 2OTVA 5TJXA 1WCZA 1EPTC 1XUGA 2GCHG 1UTKA 3D62A 4E7NA 4FUEA 4CH8B 4X6MA 4A5TS 2ESTE 1ZJDA 4HGCA 1MZDA 1T8MA 3RMOH 3M37A 1K1PA 1C1VH 2SGAA 5ESBA 1KXDA 2RA3A 1C1OA 1ANDA 1ACBE 1S6FA 3FP8E 5AF9H 3RDZA 1KXBA 3LGIA 1JWTA 4WMDA 1XKAC 3MNXA 5E2OA 5J4QA 1E35B 1QRZA 3SU4A 1LKAA 3MH4A 1DS2E 3T25A 1IQJA 2Y5FA 3JZ2B 4X8VH 1GBEA 2VVCA 4FUBA 2SGQE 3VB5A 1AUJA 1ZMLA 1UTNA 1P2QA 4GCHG 9ESTA 1H1BA 4XBCA 3DHKH 3P8NA 2O8MA 3RU4T 3EYDA 3MNCA 1W0ZU 1GBBA 1RGQA 1DANH 1EAXA 3MU1A 3K6YA 3CP7A 3GY5A 1CBWB 2GCTC 2ZP0H 4ZKOU 2EI7A 1O2QA 1UTQA 2JH5D 2BX3A 4JZDH 6CHAC 1AWHB 4FUJA 5AHGH 1AFQB 1UHBB 3PTBA 5GWZA 1NESE 3F9GA 1GMHG 4J2YB 1NRNH 1O2PA 4NSYA 3ODDA 5HM2A 2C8WB 3UTUH 4UFEH 1X7AC 1L4DA 5A0BA 3PMJA 1GI2A 2ZFQH 2C4FH 3TH2H 1TRYA 2PKSC 1K28D 4JYUH 1THRH 4DT7B 2ZPSA 2ZDAH 3IITA 3RC5A 1O2MA 1QR3E 4I7YH 1ZGVA 4KTSA 3HK3B 4AN7A 1Z8GA 2CV3A 3FFGA 1BRCE 2ZGHA 2FOMB 4CRAA 1FAKH 1TWXB 2YNAA 3IWMA 1P8VC 1VITG 3M61U 5HGGA 1QL9A 1TLDA 2BD2A 1VCPA 3M5NA 1C5MD 3A89A 1JIMA 4O97A 3UREA 2V0BA 1A0HB 1CT2E 4YM9A 1ZJKA 1FI8A 1QGFA 3MTYA 3TK6A 1PYTD 3A88A 3ZZ3A 1HDTH 1O2TA 3MH7A 2BTCE 1A7SA 1CGIE 3SV6A 3FZZA 1UK4A 1N6XA 1HJAC 2B0FA 4CRBA 3BG4C 1J8AA 1GI4A 1DICA 1O3NA 3K9XB 3MFJA 1ZHRA 1LQDB 4Q2KA 3ATLA 4A6LA 3EA9A 1O31A 2W3KA 3VEQB 5GDSH 1CT0E 1TABE 3SQHE 3RXJA 4TPIZ 1TPAE 1GVZA 3P70B 1VCWA 3SN8A 2XC0A 3QO6A 3BTGE 2GT7A 4HFPB 3RXBA 1C1RA 1FDPA 4TWWA 3T28A 4AGKA 2ANKH 1BHXF 2VWOA 2WPIS 2ZECA 2ZFPH 1YPJH 2BLOA 1D4PB 3JZ1B 2FDAA 4Y76A 4FUIA 5EW2H 1HLTH 2TGTA 1DDJA 4B2BA 1GI3A 4B1TA 1ETRH 1AZ8A 1EXFA 1PYTC 3SBKA 3EA7A 2Y7ZA 4ABAA 1NFWA 5E2PA 1PPHE 1P2MA 4YZUA 1GHAG 1GDNA 1SGYE 1WYKA 5EPYA 1FUJA 1V2KT 3VGCB 3GDSA 3F68H 2TIOA 1C4U2 2XXLA 2VGCC 1P2OA 1UTOA 1O2XA 1MU8B 4Y71A 1PPGE 5C2ZA 1WSSH 3TGKE 2BB4A 3WY8A 1YYY1 1VGCC 5L2YH 1MTVA 2ZCLP 1A3EH 4TPYA 1OOKB 4KP0A 1ELBA 1GHBF 1G3EA 2VIQA 1BTPA 1O3MA 1TQ0B 2WINI 4SGBE 1QL7A 1NFYA 2WPJS 3TGJE 1O5GH 2QAAA 1DXPA 1YPKH 1K9OE 2AS9A 4AORA 1GDQA 1QQ4A 1OWIA 1H8IH 3EDXB 1EATA 4NG9H 3MU5A 3L3TA 5F03A 3RXIA 4FUHA 2H5DA 1CO7E 3STJA 3W95A 2WYGA 1JBUH 1SGEE 1KXCA 4MQAA 3ENSB 1RTKA 1C4V2 3GY3A 1ABJH 1EP6A 2QF3A 2C3SA 1DUEA 3EA8A 3H5CB 1O5AB 1LPKB 3MNSA 3CS0A 1SI5H 1HAVA 3KL6A 3A83A 4XOJA 1C2EA 2XC5A 3RU4E 3FP7E 2EI8A 2V6NA 1BOQA 2LPRA 2OBOA 4GLYA 3CENA 4Y10E 5LPRA 5EXLA 3PMBB 4ZH8A 4H4FA 2GT8A 4QT8C 1SB1H 2OP9A 3MOCA 2Q6FA 2FEQH 1NU7B 3PLPA 1MKXK 4GUXA 2TGAA 3RU4D 3SV2H 3PLBA 1G37A 4AOQA 4BAKB 1F0TA 4R8TB 2ZPRA 4H6SB 4B2AA 3MH6A 1G32B 2FPZA 1UO6A 1IQKA 4D7FA 4TWYA 4ABEA 2C8YB 2BM2A 3HGNA 1A46H 2PV9B 2ZCKP 1GBIA 1O3HA 4BTTB 3ODFA 2UUYA 2PWXA 4CRDA 2F91A 3NKKA 5ABWA 4K1EA 1J14A 1EASA 4WMFA 2OINA 2PFEA 1CGJE 1P05A 2ALPA 1TNJA 3IG6B 2A45B 1TGSZ 2I6QA 1AO5A 1CE5A 1KXFA 5LPFA 4E05H 3O8DA 1MU6B 3QTVH 1XUFA 2ZHWH 2PUXB 3A8CA 4NSVA 2HLCA 3ZZ4A 3QX5H 1K2I1 1P04A 2BDIA 3QTOH 2OC1A 2P94A 1B0EA 1J16A 1FXYA 4XE4A 1HYLA 1C1NA 1G2MA 4FU8A 3UIRA 1DLEA 1A3BH 2B9LA 1UJ1A 1W14U 1O38A 4Q80A 1NC6A 1GG6C 2WPKS 1O37A 1G3BA 3D65E 2NU1E 5H4IB 2FX4A 1LHGH 4X1NU 4AFQA 1WAYB 2VIDA 1MTNC 3UQOA 1GHBG 1K1OA 1HAVB 4CBNA 1O2NA 1FNIA 2ZGJA 1YCPH 1PQAA 3LH1A 1N6YA 3E1XB 1SQTA 1Y3YA 1C5TA 1QHRB 3KQDA 1C5RA 4AG1A 2OC8A 2J38A 3MO3A 1MTUA 3R3GB 4CBOA 3BV9B 3V3MA 1WTHD 1CHOF 1BITA 2A4OA 2ZIQH 1GVLA 3SJ8A 3PMAB 1C5YB 3F9EA 3KQBA 4U30A 2GZ7A 2K1QA 1K1IA 1ZRKA 3KNXA 1O2HA 1TX8A 3ATWA 3GCHC 4M7GA 1WTGH 1SLWB 1QNJA 2PLXA 1HBTH 4OGYA 2WUBA 2OC0A 4MNVA 2A2XH 1PFXC 4YT7H 1GI1A 1P0SH 1WOFA 2ZNKH 1NPMA 3DUXH 4X2XA 4WWYA 2G8TA 1GJBB 1FY1A 3BTDE 2ZG0H 1A5HA 3SHAH 1SVPA 2BOKA 2CJIA 1SOTA 2Q6DA 1V2OT 2RCEA 1NRPH 2AIPA 1BRBE 2ZI2H 1BDAA 2LNCA 4YO9A 4ABIA 2AGIX 4D9QA 2XCFA 3SNEA 3F1SB 1Z8RA 1SLUB 2BVSH 3MU8A 3GY4A 1YGCH 1NFUA 4WXIA 4GSOA 1KSNA 4K8YA 1VZQH 2FI5E 3W94A 1V2WT 8LPRA 1Y3VA 1BBRE 1SBWA 2TGPZ 5EGMA 1ELCA 3SGAE 2P8OB 2IJOB 4NA8A 2ZHEH 4F4OC 1QURH 1HAPH 1GJAB 4FUGA 3E8LA 2ASUB 1CA8B 4CR9A 1O2GH 4A1TA 1CHGA 2FOHA 3N7OA 4BAQB 2VVVA 3SV8A 2C93B 4INKA 5SGAE 4X0WU 3M35A 1NN6A 1C2LA 4ISHH 1SG8B 1TOMH 4X6OA 2ZDKA 1QRWA 2DE9A 3GCNA 4GAWA 1RJXB 3URDA 4A1VA 4GVUA 2DUCA 4J1YA 1TPSA 2Q1JA 5BPEA 4WJG2 3M3SA 1B5GH 2EA3A 1SGFA 3RXPA 2ODYB 1TPOA 4BNRA 3SJIA 2FO9A 1GJ5H 1YPEH 2XBYA 3UFAA 1JIRA 4X1QU 2BX4A 4FVDA 1BJUA 1SMFE 2ZEBA 1AQ7A 1W7GH 3TGIE 1ZOMA 3HGPA 5FX6A 3FZDA 2QC2A 4O3TA 1L0ZA 1NTPA 1EJMA 3A80A 5DG6A 4Y0ZE 2G81E 3F6UH 3ATMA 5E0GA 2FOBA 3GDUA 4YESB 1CHOG 3K6ZA 4MG3A 3TK5A 1QTFA 4MLFB 1G30B 3PWCA 4NWKA 1V6DA 3NZIA 2FWWA 1DPOA 1LQEA 2CN0H 2GDDA 4F49A 1FN6A 1D3QB 1EJAA 5I25A 1BMAA 1SOZA 1BBRH 1O30A 2VWMA 1P11E 3A85A 3K2UA 1GJCB 1EP5A 2A4RA 2V35A 2SGPE 4YT6H 1V3XA 5JB9S 3HATH 1RFNA 2BVXH 4UONA 4ABBA 4D76A 5A8YA 1BT7A 4AYVB 3DT0H 1XUKA 4KGAA 1A5GH 1QIXB 1UHBA 1ZYOA 3SQEE 3PROA 2FZZA 4GHQA 1LPZB 1AHTH 2G55A 3LC3A 3M7UA 1UTPA 3A7XA 1P3EA 2M5TA 1GJ6A 2BDYA 2AMQA 3MYWA 4RSPA 2ZPQA 2VVUA 1BMMH 2XTTB 1P9SA 4K8BA 1A5IA 3U9AH 3MH5A 1GVKB 1MTSA 2ZDNA 3UNQA 1DITH 2RG3A 2ZKSA 3EGKH 2A4QA 1OYTH 1PQ7A 4BANB 1W11U 1BTYA 2AGEX 3RLYH 4IN2A 3A87A 1THSH 5C3NA 2ZFFH 2ZFRH 4MNWA 2GX4A 2BDCA 2ZQ2A 2GMTB 3G01A 2GV7A 4MPXA 1Z8JB 1WUNH 1Y59T 3A8AA 7LPRA 1JRSA 2R0KA 5DO4H 1P02A 2A5IA 1SLXB 2A31A 2Y5GA 1KY9A 5DK1A 1GI6A 5E8EH 5F8TA 2BY6X 3RXCA 5F8XA 3SZNA 3GY8A 2HALA 1O36A 1SQOA 1PJPA 3M3TA 3VB6A 2Y81A 2D2DA 4X8UH 2QGRA 3M3VA 1GHWH 3D49H 1BRAA 1A1RA 2ANMH 1C1TA 2BD4A 1BQYA 5AFZH 3HPTB 3UPEA 3T62A 2WPLS 3T2NA 4FUFA 2PW8H 1C5PA 1DE7H 1ANEA 4ZXYH 1LVYA 1NY22 1RRKA 3VB4A 3T27A 3OSYA 2Z3EA 3RXVA 1TRMA 1ELVA 2VH0A 1P3CA 1QJ1B 1QFKH 1VJ9U 3SGQE 2Z94A 2A1DB 2Z9JA 1ETTH 4I32A 3MO6A 1OX1A 5C67A 1F0SA 5DP9A 1QJ7B 1MZAA 2G5VA 2P93A 1IQFA 4WVPE 3SORA 7ESTE 1BTZA 1SL3A 2XBWA 3TPIZ 2BHGA 5A8XA 1OP8A 1N8OC 3SNCA 4UFGH 1LHDH 2FTMA 2ZHDA 2TBSA 2SGEE 2Y82A 2VIOA 3PB1E 1YLDA 1KLIH 3BTQE 3RXGA 1YPHC 3VFEA 3C27B 4LOYH 1GI8B 1S82A 1OWKA 1SGDE 3DD2H 4CHAC 1EZSC 3SU0A 4NWLA 3P95A 4LZ1H 2ZTXA 7GCHF 1ZTLA 3PO1B 5HM9A 2BXTH 1SGQE 2Y6TA 1SPJA 1UTJA 1K1MA 1W12U 3M36A 1YCPK 5FXLA 1E36B 3RUOA 5AFYH 1HAXB 4FU7A 1UK2A 4NA9H 3M7QA 3VGCC 3MHWU 3DA9B 3U8TH 1TIOA 1EJNA 1DT2A 4HTCH 1C5QA 1HB0B 1OKXA 1YLCA 1A0LA 2FOEA 1XVMA 1LHCH 5FX5A 2PGBB 2HGTH 2XBVA 1S83A 1GBDA 2QIQA 1TGCA 2WYJA 1HV7A 4O3UA 1DY9A 1MCTA 4TY6A 1ELGA 3KGPA 3SOSA 1FMGA 3FP6E 1FQ3A 2HNTF 2ZGXH 3AAUA 1IQGA 2BYAX 3RXUA 1FV9A 1GI0A 1O3KA 2Z9GA 2JH6D 4ZAEA 2VJ1A 2ZU2A 3QZRA 2PTNA 1BTWA 1HNEE 1IHSH 2BQWB 3S69A 3KQCA 4MPVA 4O9VA 3TJOA 1S6HA 1TPPA 1E34B 1ID5H 1VR1H 3STIA 1O5DH 2R0LA 2AIQA 2ZDVH 2OUAA 3LT3A 3UWIA 1DWEH 1QL8A 1Z6EA 3U98H 3UNSA 1GGDC 5C1UA 3TNSA 3ZVAA 5EW1H 3A86A 4KKDA 3RMNH 1UVPA 2Z6BD 1O3GA 3S7HB 2BDBA 1XXDA 3A7TA 1O33A 1C2HA 5A0CA 2STAE 1D9IA 1GHXH 3V0XA 3BF6H 1GMDF 4ZXXH 1IOEA 3ZVDA 4D7GA 1GI7B 1TBRH 2NU3E 2Z7FE 6LPRA 1OS8A 2TPIZ 3AAVA 2ALVA 1SGNE 1PQ5A 2CF8H 3C1KA 3BTTE 1EZUC 4NFEA 1T8OA 2W7UA 4Z0KA 1ESBA 1GWAA 2BDGA 1RTLA 1AIXH 1AMHA 1EAUA 1YPMH 1BRUP 1C2JA 1O39A 1SGPE 5A0AE 5HYOA 1Y3WA 1ARCA 2P3TB 3BG8A 5EG4A 4K5ZA 7GCHG 1UTLM 1K1LA 3L33A 2GDEH 2XRCA 4AX9H 3LGTA 1GPZA 1P03A 3TITA 4AZ2B 1QB9A 2G4TA 3LKWA 1C2IA 4IS5A 1C1QA 3UOUA 3GY2A 1H8DH 4AFSA 5DJ7A 3U8RH 1HUTH 1GBCA 4X1RU 4RN6A 3T5FH 1O3PB 1EUFA 1MMJN 1OWDA 2NU2E 1OPHB 5LH8A 1KXAA 3RXTA 3A7VA 1UCYE 2ZHFH 1ESTA 1DFPA 1JRTA 2A2QH 5LGOA 1HGTH 1O3CA 1CGHA 9LPRA 2G51A 3T29A 2C8ZB 5CHAC 3QLPH 2BZAA 2OXSA 3ZZ5A 3BTHE 3RXMA 1WU1A 1O2RA 2G52A 2FI4E 1C1WH 3UR6A 1FY5A 3SUEA 1BBRK 1EZXC 2GZ8A 3SI3H 1C5LH 1AWFH 2FOGA 4WY3A 4Q7ZA 1HPGA 1O32A 3SW2B 1WQSA 1GJDB 1W13U 4B71A 3KCGH 5EXMA 2PTCE 4DCDA 1TA6A 2FLBH 3E90B 1MH0A 1NT1A 2G5NA 1QA7A 1XUHA 3AVZA 2VGCB 1T31A 2ZU3A 1GI9B 2QV1A 1V2JT 1TX7A 1O2VA 1TNHA 4ABGA 4NIWA 5F6MA 4D9RA 3TVJB 5T6FA 1CSOE 1C2MA 1MAXA 4UD9H 1A0JA 1VGCB 5T3HA 2FYQA 5JBTA 1O3FA 4DW2U 5CMXH 3TJVA 2A5AA 1GCTB 2ZGBH 1BCUH 1L1GA 2FX6A 2Q6GA 3ZZ8A 2J94A 3TLOA 5GXPA 3HKJB 2TRMA 5BRRE 1Y5BT 5C1YA 3A7ZA 2FODA 3EAJA 3PV4A 2FOAA 2AYWA 2F3CE 3BTME 3ZYEA 1DWCH 1HFDA 3GCTF 1TNKA 1TQ7B 4IBLH 1UCYH 3V12A 1ZMJA 5E0JA 2XBXA 3U8OH 1LTOA 3LIWA 2ZHQH 1INCA 3KF2A 1LHFH 4AFUA 1SHHB 1NROH 5DP6A 2O8TA 4BXWA 5FBEA 1D6WA 2J34A 1GJ9B 1KLJH 2PHBA 1OXGA 1BMLA 1FJSA 1O3AA 2UUJB 4ISLA 1OYQA 3H7TA 3FAOA 1O35A 2H5CA 1C5XB 2EC9H 3ESTA 3SO3A 1DM4B 1HXFH 2BDHA 2CHAB 1O2KA 2P8OC 3QK1A 4DY7B 4JYVH 1H9IE 1ZSLA 2FM2A 4TY7A 1RD3B 3MI4A 3DFLA 4K1SA 2O9QA 4NIXA 1ORFA 1FPCH 1AB9C 2WPMS 4AGJA 4JYTA 3AW1A 1NU9A 4RKJB 1J17T 2P3FH 2PR3A 1Y3XA 3ZV9A 1QBOA 2HPQH 2ZA5A 3OY6U 1GCDA 1GBHA 4X6NA 1TBQH 1QCPA 1HCGA 1Q2WA 1KIGH 5I46H 1QJ6B 3OYPA 1ZZZA 3ZVGA
chains in the Genus database with same CATH superfamily
4ZROA 2HVXA 1RTFB 1Z1IA 3M5OA 3T26A 2ZDMA 1NO9H 1NS3A 1ELTA 4Y8YA 1XXFA 2F9OA 2H1UA 1O3JA 1KTSB 1EOJA 2R2WU 4ZKRU 4HZHA 1ABIH 1MTWA 2QN5T 2SNWA 2BY8X 1MBQA 3MNBA 4IC6A 5B6LA 5DGJA 3ZV8A 1AI8H 1TB6H 3SU6A 1W7XH 1KLTA 1GG6B 2UWOA 4K60A 3UAIC 5EXNA 3MMGA 4KTUA 4JK5A 2C8XB 3RXLA 4NFFA 2SGFE 4B2CA 4FUCA 3BIUH 1CA0B 1RIWC 2AGGX 3RXDA 4YOGA 3MU0A 4U2WA 1DWDH 4K3JA 1ZTKA 3U1JB 1HJ9A 1DLKB 2EI6A 4NIVA 3SUFA 3BTWE 3MQKC 1P12E 1LPGB 1TMUH 2W5EA 3GISB 1F7ZA 3S7KB 2JETB 4A7IB 1LMWB 1OSSA 3DFJA 1OWHA 1PPEE 1V2UT 1C2KA 1ELAA 3LGWA 4WXVA 3BTFE 3GCTG 4AC9A 1BMFD 2QXGA 1SFIA 5J4SA 3SV7A 1UW7A 4FU9A 4CRCA 1G3CA 4ABDA 4DIHH 1GBTA 2STBE 2ZZUH 4IMQA 5HXFA 1P2IA 2VNTA 4UE7H 4XDEA 2BY5X 1SLVB 4Y7BA 5E0HA 2PKAB 2OC7A 3GYLB 5PTPA 3VB7A 1MKWH 1V2TT 1TE0A 3DSPA 3GCHB 5C5NA 4IN1A 1ANBA 1TA2A 1WQVH 2ZCHP 3LU9B 2HPPH 2HNTE 3GOVB 5DP5A 3UQVA 1NRSH 3LGVA 4NZLA 1S81A 3QZQA 3MWIU 1XUJA 4R0IA 4K69A 1FY8E 3BEIB 2AHME 2P3UB 1C9PA 1F0RA 2GD4B 3LGYA 3RLWH 3E91A 1NRQH 2A7HA 2GMTC 1ARBA 2QF0A 3SI4H 1UVOA 1O2WA 2TGDA 4ZKNU 1BIOA 1V2QT 2QXJA 4OS6A 1HIAA 4Y8ZA 1OP0A 3R0FA 2XNIA 4DIIH 1C5NH 1FZZA 4CRFA 3ZIAD 5L30H 4B73A 3SU2A 2WV4A 5DKMA 1DOJA 4NCYA 2KAIA 2V7QD 1C4Y2 1QA0A 1D6RA 3Q77A 2O8LA 4GPGA 1SGTA 4CRGA 2FESH 1FN8A 4I8GA 3M5LA 4X2VA 3LPRA 1E1RD 1V2PT 2OQUA 3KYFA 2A7JA 1V2MT 2QXIA 3PV5A 3ELAH 1ZLRA 5EJ1A 1BTXA 5GPIB 1O5BB 2FOCA 1CBWC 4KTCA 5TCAA 2ODPA 3ZYDA 4RT1A 1DX5M 4VGCB 5C0TA 4CR5A 5JYIA 4MDSA 1DSUA 2HNTC 1AFQC 3QN7A 2KCAA 4LK4A 5EU8A 2BD5A 1PPFE 1PQ8A 1SC8U 1KDQA 1O3BA 1D3TB 2Y7XA 3V13A 1ELFA 3NPSA 5JBCS 4HI3A 1M9UA 4UDWH 1V2ST 1AGJA 1EPTA 1L1NA 4BTUB 4X6PA 1V2NT 2XYAA 2BD9A 2IN2A 1ETSH 4Q7XA 4BXSA 4E7RG 3S9BA 1TMBH 1MD8A 4ISIH 3LOXA 1YPHE 3ZZBA 1H8ED 3F9HA 1ZR0A 5T6GA 2C90B 1S0QA 3NK8A 4OS5A 4D8NA 4ZHLU 2Z9IA 5JB8S 1OWEA 2SGDE 4FXGH 4A1XA 4OS4A 5FCRA 1O3IA 5FHTA 3RXRA 3OTPA 4MNYA 5EQRA 1QBNA 3I77A 1TGBA 1RS0A 3PO1C 3FVFB 3RP2A 3F9FA 2FXRA 1AZZA 4WH8A 4Y6DA 1HIAB 4AG2A 3PMHB 1IQEA 5JDUB 8ESTE 1HAIH 4FOUC 1FY3A 2WV9A 1SQAA 3O8BA 3ATIA 1S5SA 1PPCE 2XC4A 4A92A 4U01A 1W2KH 4X8TH 2KAIB 4YOIA 1AN1E 1ELEE 1AE5A 4DG4A 1ZMNA 2OD3B 4DVAU 1O2ZA 1SGCA 1SQRA 2P95A 1PPBH 3E0NB 3PLKA 1P09A 1EQ9A 3RXHA 5K0HA 1XMNB 3UWJH 3ZVCA 2FI3E 4MPUA 1E79D 4AB8A 1LKBA 4E06H 1LVBA 1T7CA 3O8CA 3Q76A 2BDAA 3BN9A 1GDUA 5DP3A 5FPSA 4JZIA 4U32A 5F53A 2THFB 5EODA 1O5EH 1RXPA 1Z7KA 3TK9A 4YLQH 3SJ9A 2BY9X 4ESTE 4ISOA 4KELA 1XUIA 1FY4A 2BMGB 2ZU5A 3BTEE 1LHEH 2ILNA 2VINA 3SNAA 2AMDA 1KDQB 1GHAF 1VJAU 2OQ5A 5FPYA 4XRNA 3ZZ6A 2ZF0H 5CE1A 2FOFA 1UCYK 2ZFSA 1EPTB 1BHXB 3KEEA 1B7XB 1C5SA 4JCNA 2UWPA 1GJ4H 1JMOH 5T6DA 3PRDA 2GKVE 1IAUA 2VWNA 4NIYA 4ZHAA 1T8LA 1EAWA 1JOUB 4B6FA 2BLVA 1AVGH 2RA0A 3ZVEA 2FIRH 5C17A 1V2RT 3SUGA 1TALA 2ZDLA 2ZGCA 1GMCF 3EE0B 4XBDA 4ABJA 4Y11E 3UR9A 1DSTA 1THPB 4MVNA 2QYIA 1O2OA 2VU8E 1TBZH 1DWBH 4BTIB 5C20A 4FETA 4B6EA 1BA8B 1TGTA 1Y3UA 2QF5A 2ODQA 1HRTH 3SU5A 5JBAS 3M5MA 1BJVA 1J9CH 1F5KU 1T4VH 5IYTA 1GBAA 2J98A 1TYNA 2ULLA 2R3YA 2GCTB 3SHCH 4ASHA 1G3DA 2I6SA 4YLUA 2J2UA 3OX7U 1IQLA 2QA9E 2QF4A 4O03A 1G36A 4UFFH 3LDXH 4OS2A 6CHAB 1S0RA 3RM0H 4DURA 5DPAA 3E6PH 4IW4E 1ZGIA 1ZSJA 4I8JA 1W10U 2BQ7B 1V2LT 1O3LA 1CU1A 2UUFB 4CREA 2VIWA 1MD7A 3A7WA 1HAGE 3S9AA 1MUEB 1N8OB 1YF4A 1FAXA 1FLEE 2VB0A 2CXVA 1SGIB 2R2MB 5K7RA 1P10A 3KIDU 1DUAA 2BVRH 3GDVA 5HIYA 3Q3YA 2PKSB 5A8ZA 1TGNA 8KME2 1Y5AT 5CHBA 3B8JA 1GJ7B 1F5LA 6ESTA 1GHVH 2F9UA 1IHTH 1A4WH 1MAYA 4CHAB 2H2ZA 1OWJA 1BMNH 1XVOA 1ZSKA 4I8LA 3TJNA 3TJUA 1O2SA 2H9HA 3O8RA 1WBGB 2CMYA 2J4IA 2YMSD 2BOHB 3SYJA 5IDKA 5G4BA 1NZQH 1DY8A 3SGBE 3ZZ9A 1ZHMA 3BIVH 1SGFG 3URCA 3RXSA 1V2VT 1AKSA 4X1SU 3SU3A 1E37B 2OBQA 2BQ6B 2VIVA 5LPEA 1YBWA 4ABHA 1QB6A 1MCVA 1UVTH 4XD7D 4INHA 1L1JA 3I29A 5ESTE 1T4UH 2FS8A 5L6NH 1GBKA 4H6TA 3P6ZB 1Q3XA 2R3UA 4WMEA 1XX9A 1ZPCA 4K2YA 1P9UA 1Q31A 1HJAB 5JBBS 3Q3XA 3BG4B 1O5CB 1H4WA 2VH6A 3FN8A 1GHYH 4Q7YA 5FCKA 5GIBA 3VB3A 1CT4E 1MKWK 1ZPZA 4X1PU 1YPLH 1L2EA 5C94A 1EOLA 1O5FH 1GCTC 2J98B 4X8SH 1COWD 2RDLA 1ZRBA 1F5RA 5FPTA 1L4ZA 3P17H 5EJZA 2CGAA 4ZHMU 2VIPA 1GMCG 1EFRD 4IGDA 4I33A 1AE8H 1PPZA 3BSQA 3DSGA 1UTMA 2YMSC 4MNXA 1NRRH 4YTAA 3SJKA 3SV9A 1AFEH 2HOBA 3ZZDA 4XFQA 3A84A 3OY5U 2Z9LA 1J15A 5TCCA 3UY9A 1TFXA 3QUMP 3ZVFA 1GGDB 2A5KA 3ZZAA 4JZ1A 3I78A 1O2JA 3FANA 1NFXA 1H9HE 7KMEH 1P01A 1IQHA 1EKBB 2FP7B 1UMAH 2QXHA 2ZWLH 2ANYA 4P02A 2QCYA 2AERH 3SZEA 2KCOA 3P8FA 1YCPM 4FVBA 3HK6B 2J9NA 2J5UA 2CHAC 1O2UA 1BUIA 5EOKA 4UEHH 2UWLA 1TRNA 3UNRA 3ZZ7A 1NM6A 3UOPA 5GCHF 1A2CH 1GBFA 2P59A 2J95A 1ESAA 4TYDA 2IJD1 4H42U 2A32A 2GZ9A 2XW9A 2YOLA 3U1IB 1QY6A 1AKSB 1YPGH 2G4UA 3KN2A 1K1NA 2ZTZA 3OU0A 3PM3A 2H9TH 2F9VA 4RKOB 3RXQA 1W0JD 1IQIA 1FPHH 1YC0A 5EQQA 2SNVA 3ATKA 1BB0B 5FBIA 1F0UA 1GMDG 2FMJA 1F92A 5EPNA 2GTBA 1JXPA 2PSXA 2A4GA 2AH4X 4X2YA 5A09A 1D3DB 3BTKE 1O2IA 4JZFH 3A8DA 4BAMB 2GV6A 2A7CA 2BXUH 4Y0YE 3BEFB 1BTHH 1GL0E 2PUQH 4LZ4B 2NU4E 3PYHA 1HJ8A 5C5OA 2YNBA 1SSXA 2O8WA 4NZQA 2GGVB 3PTNA 1GBMA 2FYRA 3GY6A 1B0FA 1UK3A 1C2GA 1LCYA 2B8OH 1HAHH 5HMAA 2R9PA 4IMZA 1EX3A 1YKTA 2V3OH 2V3HH 5L2ZH 1FIZA 3TH3H 5KGOA 1C5ZB 3MU4A 4AFZA 1G9IE 2ZU4A 1AY6H 4Z1MD 1HAZB 3OFND 1EB1H 5ETXA 4OGXA 1ANCA 2F9NA 2ZU1A 1C9TA 2EEKA 2PGQB 5CHAB 1CA0C 2ZFTA 1P2NA 4I8HA 4ZMAH 1O3EA 2XCNA 3LH3A 4WF8A 4JK6A 1KYNA 3ZVBA 3A8BA 2G00A 4I8KA 4ZUHA 3S0NA 1TAWA 3PWBA 2WPHS 3RXAA 3V7TA 5C1XA 2JETC 1TONA 4B75A 4CH2B 3NWUA 2QY0B 2WPDD 2BZ6H 4MPWA 2O8UA 3GICB 3RMMH 2F9PA 2CK3D 2PKAA 1W3CA 5DP4A 1O34A 1YP9A 2NU0E 4JZEH 2W26A 2D8WA 4OS1A 1HAOH 1UVUH 4AB9A 1TNIA 1C1PA 1EZQA 4Y7AA 2IPHA 1C1MA 3D23A 3LGUA 3P8GA 3OTJE 2Z3DA 4THNH 2AEIH 1C5UA 1IQMA 2BLWA 2Y80A 4BAHB 3P8OA 4X2WA 1SR5C 3EQ0H 2F83A 1KXEA 1K1JA 1TMTH 2W7SA 1CQQA 3KQEA 3QGNB 1GBJA 1W8BH 3H7OA 3P92A 2OK5A 3GY7A 3A82A 3MO9A 3QGJA 5GCHG 4Y8XA 4XSKU 1ELDE 1AVWA 1GHZA 3SUDA 4ZKSU 1K22H 2NWNA 1VITH 2IOTA 3VXFH 2BD8A 3K65B 2K0QA 6GCHF 2WV5A 1TX6A 3RXFA 2WUCA 3RXOA 3SNBA 4ABFA 1MTNB 2H9EH 1EAIA 2OLGA 3LC5A 3CS7A 3LJJA 4NA7A 3ZZCA 2ZC9H 1MBMA 2Z9KA 3KHVA 3AW0A 4MTBA 2XNDD 1C1UH 1CVWH 1T8NA 1Z1JA 1DXWA 5FAHA 3QWCH 1C5OH 2FS9A 4JMYA 1HAYB 3UUZA 1A61H 1TOCB 3DCLA 2GJGA 1K21H 3TU7H 4YOJA 3BEUA 2B7DH 2JDID 2J97A 2B5TB 1QQUA 2BY7X 1XKBC 1Y8TA 2HWLB 1AB9B 2PSYA 2AMPA 1P2KA 8GCHF 4DJZB 1Y5UT 2AFQB 2GCHF 1BTUA 1GBLA 1AUTC 3RC6A 1LDTT 5GJ4B 2QE7D 3SU1A 1O0DH 2Y5HA 5F8ZA 1U6QA 4VGCC 5FL7D 4PROA 4RT0A 3NUMA 2W3IA 3LJOA 2FTLE 1C5VA 2F9BH 1LO6A 4OS7A 4DGJA 1SFQB 5B6OA 1Z6JH 4I31A 1D3PB 1O2YA 2L74A 4IC5A 1FIWA 2ZO3H 1VCQA 1S85A 2CF9H 2FLRH 3E0PB 3NXPA 5EQSA 3ITIA 2D26C 2V3MA 3F0PA 5JPMH 4DOQA 4Q4LA 1ZHPA 4AYYB 1G2LA 1LVMA 5KECA 5AVDA 1TNLA 3E16B 4BAOB 2OCVB 1QB1A 1S84A 1P2JA 1XM1A 4GCHF 1O3DA 2GP9B 1DVAH 2A0QB 1C1SA 2ZQ1A 4ISNA 1P06A 4UFDH 4K1TA 1O3OA 4WH6A 5DP7A 1GI5A 3B9FH 1LVOA 4B76A 1OP2A 1GJ8B 3U69H 2P16A 3RXEA 3AASA 3SNDA 3TH4H 5A2MH 3GCOA 2HRVA 1RIWB 3QDZB 1O2LA 2XWAA 1MKXH 1BZXE 3RMLH 2JKHA 3E3TA 1EB2A 1F2SE 3Q00A 1UVSH 1GMHF 4Z6AH 3HKIB 1IQNA 1C2FA 1QBVH 3TNTA 1HXEH 3VPKA 1QRXA 4Y79A 1AU8A 4B74A 1SGRE 2WZQA 1ZTJA 2Z3CA 1AVXA 3LONA 1ZPBA 2BD3A 4LXBH 3RXKA 5DP8A 4SGAE 1Z8IB 2H6MA 4INLA 2BLQA 1KTTB 3L6PA 4ACAA 2GVFA 3NCLA 1WV7H 6GCHG 4XBBA 1AD8H 1GL1A 2XWBI 4GHTA 2SFAA 2LP6A 2EQNA 2UUKB 1FONA 1YM0A 2JH0D 2RDEA 3A7YA 3A81A 3RC4A 4BOHA 1E38B 1H9LB 4NGAH 1TNGA 1W0YH 1MQ5A 2ANWA 1MQ6A 2VWLA 2D1JA 2J92A 3M7TA 3TIUA 1C2DA 1VITF 1E0FD 3SJOA 1C5WB 3Q3KA 3FO8D 3S9CA 1SHYA 2ZTYA 3B23B 1N1LA 3RM2H 1Z71A 2BD7A 1P57B 2DE8A 3GYMA 1T32A 3VXEH 8GCHG 4FUDA 2OTVA 5EJLA 5TJXA 1WCZA 1EPTC 1XUGA 2GCHG 1UTKA 3D62A 4E7NA 1WXRA 4FUEA 4CH8B 4X6MA 4A5TS 2ESTE 1ZJDA 4HGCA 1MZDA 1T8MA 3RMOH 3M37A 1K1PA 1C1VH 2SGAA 5ESBA 1KXDA 2WHXA 4RI0A 2RA3A 1C1OA 1ANDA 1ACBE 1S6FA 3FP8E 5AF9H 3RDZA 1KXBA 3LGIA 1JWTA 4WMDA 1H8HD 1XKAC 3MNXA 4HG6A 5E2OA 1E35B 1QRZA 3SU4A 5CDFE 5J4QA 1LKAA 3MH4A 1DS2E 3T25A 1IQJA 2Y5FA 3JZ2B 4X8VH 1GBEA 2VVCA 4FUBA 2SGQE 3VB5A 1AUJA 1ZMLA 1UTNA 1P2QA 4GCHG 9ESTA 1H1BA 4XBCA 3W1EA 3DHKH 3P8NA 2O8MA 3RU4T 3EYDA 3MNCA 1W0ZU 1GBBA 1RGQA 1DANH 1EAXA 1KMHB 3MU1A 3K6YA 3CP7A 3GY5A 1CBWB 2GCTC 2ZP0H 3N7DA 4ZKOU 2KCPA 2EI7A 1O2QA 1UTQA 2JH5D 2BX3A 4JZDH 6CHAC 1AWHB 4FUJA 5AHGH 1AFQB 1UHBB 3PTBA 5GWZA 4TT3D 4TSFD 1NESE 3F9GA 1GMHG 4J2YB 1NRNH 1O2PA 4NSYA 3ODDA 5HM2A 2C8WB 3UTUH 4UFEH 1X7AC 1L4DA 5A0BA 3PMJA 1GI2A 2ZFQH 2C4FH 3TH2H 1TRYA 2PKSC 1K28D 4JYUH 1THRH 4DT7B 2ZPSA 2W6ID 2ZDAH 3IITA 3RC5A 1O2MA 1QR3E 4I7YH 1ZGVA 4KTSA 3HK3B 4AN7A 1Z8GA 2CV3A 3FFGA 2VBCA 1BRCE 2ZGHA 2FOMB 4CRAA 1FAKH 1TWXB 2YNAA 3IWMA 1P8VC 1VITG 3FKSD 1E1QD 3M61U 5HGGA 1QL9A 4F48B 2F4LA 1TLDA 2BD2A 1VCPA 3M5NA 1C5MD 3A89A 1JIMA 4O97A 3UREA 2V0BA 1A0HB 1CT2E 4YM9A 1ZJKA 1FI8A 1QGFA 3MTYA 3TK6A 1PYTD 3A88A 3ZZ3A 1HDTH 1O2TA 3MH7A 2BTCE 1A7SA 1CGIE 3SV6A 3FZZA 1UK4A 5IK2D 1N6XA 1HJAC 2B0FA 4CRBA 3BG4C 1J8AA 1GI4A 1DICA 1O3NA 3K9XB 3MFJA 1ZHRA 1LQDB 4Q2KA 3ATLA 4A6LA 1QZ8A 3EA9A 1O31A 2JJ2D 2W3KA 3VEQB 5GDSH 1CT0E 1TABE 3SQHE 3RXJA 4TPIZ 1TPAE 1GVZA 3P70B 1VCWA 3SN8A 2XC0A 3QO6A 3BTGE 2GT7A 4HFPB 3RXBA 1C1RA 1FDPA 4TWWA 3T28A 4AGKA 2ANKH 1BHXF 2VWOA 2WPIS 4P00A 2ZECA 2ZFPH 1YPJH 4M9FA 2BLOA 1D4PB 3JZ1B 2FDAA 4Y76A 4FUIA 5GNDA 1HLTH 5EW2H 2TGTA 1DDJA 4B2BA 1GI3A 4B1TA 1ETRH 1AZ8A 1EXFA 1PYTC 3NRLA 3SBKA 3EA7A 2Y7ZA 4ABAA 1NFWA 5E2PA 1PPHE 1P2MA 4YZUA 1GHAG 1GDNA 2EY4C 1SGYE 3F2FA 1WYKA 5EPYA 1FUJA 1NBMD 1V2KT 3VGCB 3GDSA 3F68H 2TIOA 1C4U2 2XXLA 1OHHD 2VGCC 3AK5A 1P2OA 1UTOA 1O2XA 1MU8B 4Y71A 1PPGE 5C2ZA 1WSSH 3TGKE 2BB4A 3WY8A 1YYY1 1VGCC 5L2YH 1MTVA 2ZCLP 1A3EH 4TPYA 1OOKB 4KP0A 1ELBA 1GHBF 1G3EA 2VIQA 1BTPA 1O3MA 1TQ0B 2WINI 4SGBE 1QL7A 1NFYA 2WPJS 3TGJE 1O5GH 2QAAA 1DXPA 1YPKH 1K9OE 2AS9A 4AORA 1GDQA 1QQ4A 1OWIA 5DN6D 1H8IH 3EDXB 1EATA 4NG9H 3MU5A 3L3TA 5F03A 5HKKD 3RXIA 4FUHA 2H5DA 1CO7E 3STJA 3W95A 2WYGA 1JBUH 1SGEE 1KXCA 4MQAA 3ENSB 1RTKA 1C4V2 3GY3A 1ABJH 1EP6A 2QF3A 2C3SA 1DUEA 3EA8A 3H5CB 1O5AB 1LPKB 3MNSA 3CS0A 1SI5H 1HAVA 3KL6A 3A83A 4XOJA 1C2EA 2XC5A 3RU4E 3FP7E 2EI8A 2V6NA 1BOQA 2LPRA 2OBOA 4GLYA 3CENA 4Y10E 5LPRA 5EXLA 3PMBB 4ZH8A 4H4FA 2GT8A 2RFKC 4QT8C 1SB1H 2OP9A 3MOCA 2Q6FA 2FEQH 1NU7B 2M2AA 3PLPA 1MKXK 4GUXA 2TGAA 3RU4D 3SV2H 3PLBA 1G37A 4AOQA 4BAKB 1F0TA 4R8TB 2JIZD 2ZPRA 2JJ1D 4H6SB 4B2AA 3MH6A 1G32B 2FPZA 1UO6A 1IQKA 4D7FA 4TWYA 4ABEA 2C8YB 2BM2A 3HGNA 1A46H 2PV9B 2ZCKP 3FOAA 1GBIA 1O3HA 4BTTB 3ODFA 2UUYA 2PWXA 4CRDA 2F91A 2L6OA 3NKKA 5ABWA 4K1EA 1J14A 1EASA 4WMFA 2OINA 2PFEA 1CGJE 1P05A 2ALPA 1TNJA 3IG6B 2A45B 1TGSZ 2I6QA 1AO5A 1CE5A 1KXFA 5LPFA 4E05H 3O8DA 1MU6B 3QTVH 1XUFA 2ZHWH 2PUXB 3A8CA 4NSVA 2HLCA 3ZZ4A 3QX5H 1K2I1 1P04A 2BDIA 3QTOH 2OC1A 2P94A 1B0EA 1J16A 3UB0A 1FXYA 4XE4A 1HYLA 1C1NA 1G2MA 4FU8A 3UIRA 1DLEA 1A3BH 2B9LA 1UJ1A 1W14U 1O38A 4Q80A 1NC6A 1S6LA 1GG6C 2WPKS 1O37A 1G3BA 3D65E 2NU1E 5H4IB 2FX4A 1LHGH 4X1NU 4AFQA 1WAYB 4Q63A 5C0UA 2VIDA 1MTNC 3UQOA 1GHBG 1K1OA 1HAVB 4CBNA 1O2NA 1FNIA 2ZGJA 1YCPH 3F3BA 1PQAA 3LH1A 1N6YA 3E1XB 1SQTA 1Y3YA 1C5TA 1QHRB 3KQDA 1C5RA 4AG1A 2OC8A 2J38A 3MO3A 1MTUA 3R3GB 4CBOA 3BV9B 3V3MA 1WTHD 1CHOF 1BITA 2A4OA 2ZIQH 1GVLA 3SJ8A 3PMAB 1C5YB 3F9EA 3KQBA 4U30A 2GZ7A 2K1QA 1K1IA 1ZRKA 3KNXA 1O2HA 1TX8A 3ATWA 3GCHC 4ASUD 4M7GA 1WTGH 1SLWB 1QNJA 2PLXA 1HBTH 4OGYA 2WUBA 2OC0A 4MNVA 2A2XH 1PFXC 4YT7H 1GI1A 1P0SH 1WOFA 2ZNKH 1NPMA 3DUXH 4X2XA 4WWYA 2G8TA 1GJBB 1FY1A 3BTDE 3GS9A 2ZG0H 1A5HA 3SHAH 1SVPA 2BOKA 2CJIA 1SOTA 2Q6DA 1V2OT 2RCEA 1NRPH 2AIPA 1BRBE 2ZI2H 1BDAA 2LNCA 4YO9A 4ABIA 2AGIX 4D9QA 2XCFA 3SNEA 3F1SB 1Z8RA 1SLUB 2BVSH 3MU8A 3GY4A 1YGCH 1NFUA 4WXIA 4GSOA 1KSNA 4K8YA 1VZQH 2FI5E 3W94A 1V2WT 8LPRA 1Y3VA 1BBRE 1SBWA 2TGPZ 5EGMA 1ELCA 3SGAE 2P8OB 2IJOB 4NA8A 2ZHEH 4F4OC 1QURH 1HAPH 1GJAB 4FUGA 3E8LA 2ASUB 1CA8B 3N7EA 4CR9A 4YXWD 1O2GH 4A1TA 1CHGA 2FOHA 3N7OA 4BAQB 2VVVA 4ACBA 3SV8A 2C93B 4INKA 5SGAE 4X0WU 3M35A 1NN6A 1C2LA 2KX4A 4ISHH 1SG8B 1TOMH 4X6OA 2ZDKA 1QRWA 2DE9A 3GCNA 4GAWA 1RJXB 3URDA 4A1VA 4GVUA 2DUCA 4J1YA 1TPSA 2Q1JA 5BPEA 2KM0A 2W6JD 3M3SA 4WJG2 1B5GH 2EA3A 1SGFA 3RXPA 2ODYB 1TPOA 4BNRA 3SJIA 2FO9A 1GJ5H 1YPEH 2XBYA 3UFAA 1JIRA 4X1QU 2BX4A 4FVDA 1BJUA 1SMFE 2ZEBA 1AQ7A 1W7GH 3TGIE 1K0HA 1ZOMA 3HGPA 5FX6A 3FZDA 2QC2A 4O3TA 1L0ZA 1NTPA 1EJMA 3A80A 5DG6A 4Y0ZE 2G81E 3F6UH 3ATMA 5E0GA 2FOBA 3GDUA 4YESB 1CHOG 3K6ZA 4MG3A 3TK5A 1QTFA 4MLFB 1G30B 3PWCA 4NWKA 1V6DA 3NZIA 2FWWA 1DPOA 1LQEA 2CN0H 2GDDA 4F49A 1FN6A 1D3QB 1EJAA 5I25A 1BMAA 1SOZA 1BBRH 1O30A 2VWMA 1P11E 3A85A 3K2UA 3VG8A 1GJCB 1EP5A 2A4RA 2V35A 2SGPE 4YT6H 1V3XA 5JB9S 3HATH 1RFNA 2BVXH 4UONA 4ABBA 4D76A 5A8YA 1BT7A 4AYVB 3DT0H 1XUKA 4KGAA 3F2HA 2HVYB 1A5GH 1QIXB 1UHBA 1ZYOA 3SQEE 3PROA 2FZZA 4GHQA 1LPZB 1AHTH 2G55A 3LC3A 3M7UA 1UTPA 3A7XA 1P3EA 2M5TA 1GJ6A 2BDYA 2AMQA 3MYWA 4RSPA 2ZPQA 2VVUA 1BMMH 2XTTB 2F43B 1P9SA 4K8BA 1A5IA 3EE7A 3U9AH 3MH5A 1GVKB 1MTSA 2ZDNA 3UNQA 1DITH 2RG3A 2ZKSA 3EGKH 2A4QA 5DSFA 1OYTH 1PQ7A 4BANB 1W11U 1BTYA 2AGEX 3RLYH 4IN2A 3A87A 1THSH 5C3NA 2ZFFH 2ZFRH 4MNWA 2GX4A 2BDCA 2ZQ2A 2GMTB 3G01A 2GV7A 4MPXA 1Z8JB 1WUNH 1Y59T 3A8AA 4ZCNA 7LPRA 1JRSA 2R0KA 5DO4H 1P02A 2A5IA 1SLXB 2A31A 2Y5GA 1KY9A 5DK1A 1GI6A 5E8EH 3OE7D 2BY6X 5F8TA 3RXCA 5F8XA 3SZNA 3GY8A 2HALA 1O36A 1SQOA 3N99A 1PJPA 3M3TA 3VB6A 2Y81A 2D2DA 4X8UH 2QGRA 2PP6A 3M3VA 1GHWH 3D49H 1BRAA 1A1RA 2ANMH 1C1TA 2BD4A 1BQYA 5AFZH 3HPTB 3UPEA 3T62A 2WPLS 3T2NA 4FUFA 2PW8H 1C5PA 1DE7H 3OAAD 1ANEA 4ZXYH 1LVYA 3CNRA 1NY22 1RRKA 3VB4A 3T27A 3OSYA 2Z3EA 3RXVA 1TRMA 1ELVA 2VH0A 1P3CA 1QJ1B 1QFKH 1VJ9U 3SGQE 2Z94A 2A1DB 2Z9JA 1ETTH 4I32A 3MO6A 1OX1A 5C67A 1F0SA 5DP9A 1QJ7B 1MZAA 2G5VA 2P93A 1IQFA 4WVPE 3SORA 7ESTE 1BTZA 1SL3A 2XBWA 3TPIZ 2BHGA 5A8XA 1OP8A 1N8OC 3SNCA 4UFGH 1LHDH 2FTMA 2ZHDA 2TBSA 2SGEE 4DT4A 2Y82A 2VIOA 3PB1E 1YLDA 1KLIH 3BTQE 3RXGA 1YPHC 3VFEA 2KZ4A 3C27B 4LOYH 1GI8B 1S82A 1OWKA 3WWBA 1SGDE 3DD2H 4CHAC 5EIYA 1EZSC 3SU0A 3OEHD 4NWLA 3P95A 4LZ1H 2ZTXA 7GCHF 1ZTLA 3PO1B 5HM9A 2BXTH 1SGQE 2Y6TA 1SPJA 1UTJA 1K1MA 1W12U 3M36A 1YCPK 5FXLA 1E36B 3RUOA 5AFYH 1HAXB 4FU7A 1UK2A 4NA9H 3M7QA 3VGCC 1FX0B 3MHWU 3DA9B 3U8TH 1TIOA 1EJNA 1DT2A 4HTCH 2KFWA 1C5QA 1HB0B 1OKXA 1YLCA 3WW7A 1A0LA 2FOEA 1XVMA 1LHCH 5FX5A 2PGBB 2HGTH 2XBVA 1S83A 1GBDA 2QIQA 1TGCA 2WYJA 1HV7A 4O3UA 1DY9A 1MCTA 4TY6A 1ELGA 3KGPA 3SOSA 1FMGA 3FP6E 1FQ3A 2HNTF 2ZGXH 3AAUA 1IQGA 2BYAX 3RXUA 1FV9A 1GI0A 1O3KA 2Z9GA 2JH6D 4ZAEA 2VJ1A 2ZU2A 3QZRA 2PTNA 1BTWA 1HNEE 1IHSH 3U28C 2BQWB 3S69A 3KQCA 4MPVA 4O9VA 3TJOA 1S6HA 1TPPA 1E34B 1ID5H 1VR1H 3STIA 1O5DH 2R0LA 2AIQA 2ZDVH 2OUAA 3LT3A 3UWIA 1DWEH 1QL8A 1Z6EA 3U98H 3UNSA 1GGDC 5C1UA 1NBME 3TNSA 3ZVAA 5EW1H 3A86A 4KKDA 3RMNH 1UVPA 2Z6BD 1O3GA 3S7HB 2BDBA 1XXDA 3A7TA 1O33A 1C2HA 5A0CA 2STAE 1SKYE 1D9IA 1GHXH 3V0XA 3BF6H 1GMDF 4ZXXH 1IOEA 3ZVDA 4D7GA 1GI7B 1TBRH 2NU3E 2Z7FE 6LPRA 1OS8A 2TPIZ 3AAVA 2ALVA 1SGNE 1PQ5A 2CF8H 3C1KA 3BTTE 1EZUC 4NFEA 1T8OA 2W7UA 4Z0KA 1ESBA 5HIZA 1GWAA 2BDGA 1RTLA 1AIXH 1AMHA 1EAUA 1YPMH 1BRUP 1C2JA 1O39A 1SGPE 5A0AE 5HYOA 2LELA 1Y3WA 1ARCA 2P3TB 3BG8A 5EG4A 4K5ZA 7GCHG 1UTLM 1K1LA 3L33A 2GDEH 2XRCA 4AX9H 3LGTA 1GPZA 1P03A 3TITA 4AZ2B 1QB9A 2G4TA 2KR7A 3KQ5A 1C2IA 3LKWA 4IS5A 1C1QA 3UOUA 3GY2A 1H8DH 4AFSA 5DJ7A 3U8RH 1HUTH 1GBCA 4X1RU 1MABB 4RN6A 3T5FH 1O3PB 1EUFA 1MMJN 1OWDA 2NU2E 1OPHB 5LH8A 1KXAA 3RXTA 3A7VA 1UCYE 2ZHFH 1ESTA 1DFPA 1JRTA 2A2QH 5LGOA 1HGTH 1O3CA 1CGHA 4F55A 9LPRA 2G51A 3T29A 2C8ZB 5CHAC 3QLPH 2BZAA 2OXSA 2XOKD 3BTHE 3ZZ5A 3RXMA 2IPQX 1WU1A 1O2RA 2G52A 2FI4E 5KEDA 1C1WH 3UR6A 1FY5A 3SUEA 1BBRK 1EZXC 2GZ8A 3SI3H 3H09A 1C5LH 1AWFH 2FOGA 4WY3A 3WWFA 4Q7ZA 1HPGA 1O32A 3SW2B 1WQSA 1GJDB 1W13U 4B71A 3KCGH 5EXMA 2PTCE 4DCDA 1TA6A 2FLBH 3E90B 1MH0A 1NT1A 2G5NA 1QA7A 1XUHA 3AVZA 2VGCB 3F0OA 1WDIA 1T31A 2ZU3A 1GI9B 2QV1A 1V2JT 1TX7A 1O2VA 1TNHA 4ABGA 4NIWA 5F6MA 4D9RA 3TVJB 5T6FA 1CSOE 1C2MA 1MAXA 4UD9H 2HLDD 1A0JA 1VGCB 5T3HA 2FYQA 5JBTA 1O3FA 2KCYA 4DW2U 5CMXH 3TJVA 2A5AA 1GCTB 2ZGBH 1BCUH 1L1GA 2FX6A 3PRBA 2Q6GA 3ZZ8A 2J94A 3TLOA 5GXPA 3HKJB 2TRMA 5BRRE 1Y5BT 5C1YA 3A7ZA 2FODA 1YLNA 3EAJA 2YMSB 3PV4A 2FOAA 2AYWA 2F3CE 3BTME 3ZYEA 1DWCH 1HFDA 3GCTF 1TNKA 1TQ7B 4IBLH 1UCYH 3KYGA 3V12A 1ZMJA 3PV2A 5E0JA 2XBXA 1YY3A 1LTOA 3U8OH 3LIWA 2ZHQH 1INCA 3KF2A 1LHFH 4AFUA 1SHHB 1NROH 5DP6A 2O8TA 4BXWA 5FBEA 1D6WA 2J34A 1GJ9B 1KLJH 2PHBA 1OXGA 1BMLA 1FJSA 1O3AA 2UUJB 4ISLA 1OYQA 3H7TA 3FAOA 1O35A 2H5CA 1C5XB 2EC9H 3ESTA 1VKYA 3SO3A 1DM4B 1HXFH 2BDHA 2CHAB 1O2KA 2P8OC 3QK1A 4DY7B 4JYVH 3OEED 1H9IE 1ZSLA 2FM2A 4TY7A 1RD3B 4OM9A 3MI4A 3DFLA 4K1SA 4I86A 2O9QA 4NIXA 1ORFA 1FPCH 1AB9C 2K8IA 2WPMS 4AGJA 4JYTA 3AW1A 1NU9A 4RKJB 3DSOA 1J17T 1W0KD 2P3FH 2PR3A 1Y3XA 3ZV9A 1QBOA 2HPQH 5T1VA 2ZA5A 3OY6U 1GCDA 3F2GA 1GBHA 4X6NA 2WSSD 1TBQH 1QCPA 1HCGA 1Q2WA 1YWUA 1KIGH 5I46H 1QJ6B 3OYPA 1ZZZA 3ZVGA
chains in the Genus database with same CATH topology
4ZROA 2HVXA 1RTFB 1Z1IA 3M5OA 3T26A 2ZDMA 1NO9H 1NS3A 1ELTA 4Y8YA 1XXFA 2F9OA 2H1UA 1O3JA 1KTSB 1EOJA 2R2WU 4ZKRU 4HZHA 1ABIH 1MTWA 2QN5T 2SNWA 2BY8X 1MBQA 3MNBA 4IC6A 5DGJA 3ZV8A 1AI8H 1TB6H 3SU6A 1W7XH 1KLTA 1GG6B 2UWOA 4K60A 5EXNA 3MMGA 4KTUA 4JK5A 2C8XB 3RXLA 4NFFA 2SGFE 4B2CA 4FUCA 3BIUH 1CA0B 1RIWC 2AGGX 3RXDA 4YOGA 3MU0A 4U2WA 1DWDH 4K3JA 1ZTKA 3U1JB 1HJ9A 1DLKB 2EI6A 4NIVA 3SUFA 3BTWE 1P12E 1LPGB 1TMUH 2W5EA 3GISB 1F7ZA 3S7KB 2JETB 4A7IB 1LMWB 1OSSA 3DFJA 1OWHA 1PPEE 1V2UT 1C2KA 1ELAA 3LGWA 4WXVA 3BTFE 3GCTG 2QXGA 5J4SA 1SFIA 3SV7A 4FU9A 4CRCA 1G3CA 4ABDA 4DIHH 1GBTA 2STBE 2ZZUH 4IMQA 5HXFA 1P2IA 2VNTA 4UE7H 4XDEA 2BY5X 1SLVB 4Y7BA 5E0HA 2PKAB 2OC7A 3GYLB 5PTPA 3VB7A 1MKWH 1V2TT 1TE0A 3GCHB 5C5NA 4IN1A 1ANBA 1TA2A 1WQVH 2ZCHP 3LU9B 2HPPH 2HNTE 3GOVB 5DP5A 3UQVA 1NRSH 3LGVA 4NZLA 1S81A 3QZQA 3MWIU 1XUJA 4R0IA 4K69A 1FY8E 3BEIB 2P3UB 1C9PA 1F0RA 2GD4B 3LGYA 3RLWH 3E91A 1NRQH 2A7HA 2GMTC 1ARBA 2QF0A 3SI4H 1UVOA 1O2WA 2TGDA 4ZKNU 1BIOA 1V2QT 2QXJA 4OS6A 1HIAA 4Y8ZA 1OP0A 3R0FA 2XNIA 4DIIH 1C5NH 1FZZA 4CRFA 5L30H 4B73A 3SU2A 2WV4A 5DKMA 1DOJA 4NCYA 2KAIA 1C4Y2 1QA0A 1D6RA 3Q77A 2O8LA 4GPGA 1SGTA 4CRGA 2FESH 1FN8A 4I8GA 3M5LA 4X2VA 3LPRA 1V2PT 2OQUA 2A7JA 1V2MT 2QXIA 3ELAH 1ZLRA 1BTXA 5GPIB 1O5BB 2FOCA 1CBWC 4KTCA 5TCAA 2ODPA 3ZYDA 1DX5M 4VGCB 4CR5A 5JYIA 4MDSA 1DSUA 2HNTC 1AFQC 3QN7A 4LK4A 5EU8A 2BD5A 1PPFE 1PQ8A 1SC8U 1KDQA 1O3BA 1D3TB 2Y7XA 3V13A 1ELFA 3NPSA 5JBCS 4HI3A 1M9UA 4UDWH 1V2ST 1AGJA 1EPTA 1L1NA 4BTUB 4X6PA 1V2NT 2XYAA 2BD9A 2IN2A 1ETSH 4Q7XA 4BXSA 4E7RG 3S9BA 1TMBH 1MD8A 4ISIH 3LOXA 1YPHE 3ZZBA 3F9HA 1ZR0A 5T6GA 2C90B 1S0QA 3NK8A 4OS5A 4D8NA 4ZHLU 2Z9IA 5JB8S 1OWEA 2SGDE 4FXGH 4A1XA 4OS4A 5FCRA 1O3IA 5FHTA 3RXRA 4MNYA 5EQRA 1QBNA 3I77A 1TGBA 1RS0A 3PO1C 3FVFB 3RP2A 3F9FA 2FXRA 1AZZA 4WH8A 4Y6DA 1HIAB 4AG2A 3PMHB 1IQEA 5JDUB 8ESTE 1HAIH 1FY3A 1SQAA 3O8BA 3ATIA 1S5SA 1PPCE 2XC4A 4A92A 4U01A 1W2KH 4X8TH 2KAIB 4YOIA 1AN1E 1ELEE 1AE5A 4DG4A 1ZMNA 2OD3B 4DVAU 1O2ZA 1SGCA 2P95A 1PPBH 3E0NB 3PLKA 1P09A 1EQ9A 3RXHA 5K0HA 1XMNB 3UWJH 3ZVCA 2FI3E 4MPUA 4AB8A 1LKBA 4E06H 1LVBA 1T7CA 3O8CA 3Q76A 2BDAA 3BN9A 1GDUA 5DP3A 5FPSA 4JZIA 4U32A 2THFB 5EODA 1O5EH 1RXPA 1Z7KA 3TK9A 4YLQH 3SJ9A 2BY9X 4ESTE 4ISOA 4KELA 1XUIA 1FY4A 2BMGB 2ZU5A 3BTEE 1LHEH 2ILNA 2VINA 3SNAA 2AMDA 1KDQB 1GHAF 1VJAU 2OQ5A 5FPYA 3ZZ6A 2ZF0H 5CE1A 2FOFA 1UCYK 2ZFSA 1EPTB 1BHXB 3KEEA 1B7XB 1C5SA 4JCNA 2UWPA 1GJ4H 1JMOH 5T6DA 2GKVE 1IAUA 2VWNA 4NIYA 4ZHAA 1T8LA 1EAWA 1JOUB 2BLVA 1AVGH 2RA0A 3ZVEA 2FIRH 1V2RT 3SUGA 1TALA 2ZDLA 2ZGCA 1GMCF 3EE0B 4XBDA 4ABJA 4Y11E 3UR9A 1DSTA 1THPB 4MVNA 2QYIA 1O2OA 2VU8E 1TBZH 1DWBH 4BTIB 5C20A 1BA8B 1TGTA 1Y3UA 2ODQA 1HRTH 3SU5A 5JBAS 3M5MA 1BJVA 1J9CH 1F5KU 1T4VH 5IYTA 1GBAA 1TYNA 2ULLA 2R3YA 2GCTB 3SHCH 4ASHA 1G3DA 2I6SA 4YLUA 2J2UA 3OX7U 1IQLA 2QA9E 4O03A 1G36A 4UFFH 3LDXH 4OS2A 6CHAB 1S0RA 3RM0H 4DURA 5DPAA 3E6PH 4IW4E 1ZGIA 1ZSJA 4I8JA 1W10U 2BQ7B 1V2LT 1O3LA 1CU1A 2UUFB 4CREA 2VIWA 1MD7A 3A7WA 1HAGE 3S9AA 1MUEB 1N8OB 1YF4A 1FAXA 1FLEE 2VB0A 2CXVA 1SGIB 2R2MB 5K7RA 1P10A 3KIDU 1DUAA 2BVRH 3GDVA 3Q3YA 2PKSB 5A8ZA 1TGNA 8KME2 1Y5AT 3B8JA 1GJ7B 1F5LA 6ESTA 1GHVH 2F9UA 1IHTH 1A4WH 1MAYA 4CHAB 2H2ZA 1OWJA 1BMNH 1XVOA 1ZSKA 4I8LA 3TJNA 3TJUA 1O2SA 2H9HA 3O8RA 1WBGB 2CMYA 2J4IA 2BOHB 5IDKA 5G4BA 1NZQH 1DY8A 3SGBE 3ZZ9A 1ZHMA 3BIVH 1SGFG 3URCA 3RXSA 1V2VT 1AKSA 4X1SU 3SU3A 1E37B 2OBQA 2BQ6B 2VIVA 5LPEA 1YBWA 4ABHA 1QB6A 1MCVA 1UVTH 4INHA 1L1JA 3I29A 5ESTE 1T4UH 2FS8A 5L6NH 1GBKA 4H6TA 3P6ZB 1Q3XA 2R3UA 4WMEA 1XX9A 1ZPCA 4K2YA 1P9UA 1Q31A 1HJAB 5JBBS 3Q3XA 3BG4B 1O5CB 1H4WA 2VH6A 1GHYH 4Q7YA 5FCKA 5GIBA 3VB3A 1CT4E 1MKWK 1ZPZA 4X1PU 1YPLH 1L2EA 1EOLA 1O5FH 1GCTC 4X8SH 2RDLA 1ZRBA 1F5RA 5FPTA 1L4ZA 3P17H 2CGAA 4ZHMU 2VIPA 1GMCG 4IGDA 4I33A 1AE8H 1PPZA 3BSQA 1UTMA 4MNXA 1NRRH 4YTAA 3SJKA 3SV9A 1AFEH 2HOBA 3ZZDA 4XFQA 3A84A 3OY5U 2Z9LA 1J15A 5TCCA 3UY9A 1TFXA 3QUMP 3ZVFA 1GGDB 2A5KA 3ZZAA 4JZ1A 3I78A 1O2JA 3FANA 1NFXA 1H9HE 7KMEH 1P01A 1IQHA 1EKBB 2FP7B 1UMAH 2QXHA 2ZWLH 2ANYA 2QCYA 2AERH 3P8FA 1YCPM 4FVBA 3HK6B 2J9NA 2CHAC 1O2UA 1BUIA 5EOKA 4UEHH 2UWLA 1TRNA 3UNRA 3ZZ7A 1NM6A 3UOPA 5GCHF 1A2CH 1GBFA 2P59A 2J95A 1ESAA 4TYDA 4H42U 2A32A 2GZ9A 2XW9A 2YOLA 3U1IB 1QY6A 1AKSB 1YPGH 2G4UA 3KN2A 1K1NA 2ZTZA 3OU0A 3PM3A 2H9TH 2F9VA 4RKOB 3RXQA 1IQIA 1FPHH 1YC0A 5EQQA 2SNVA 3ATKA 1BB0B 5FBIA 1F0UA 1GMDG 2FMJA 1F92A 5EPNA 2GTBA 1JXPA 2PSXA 2A4GA 2AH4X 4X2YA 5A09A 1D3DB 3BTKE 1O2IA 4JZFH 3A8DA 4BAMB 2GV6A 2A7CA 2BXUH 4Y0YE 3BEFB 1BTHH 1GL0E 2PUQH 4LZ4B 2NU4E 3PYHA 1HJ8A 5C5OA 2YNBA 1SSXA 2O8WA 4NZQA 2GGVB 3PTNA 1GBMA 2FYRA 3GY6A 1B0FA 1UK3A 1C2GA 1LCYA 2B8OH 1HAHH 5HMAA 2R9PA 4IMZA 1EX3A 1YKTA 2V3OH 2V3HH 5L2ZH 1FIZA 3TH3H 1C5ZB 3MU4A 4AFZA 1G9IE 2ZU4A 1AY6H 1HAZB 1EB1H 5ETXA 4OGXA 1ANCA 2F9NA 2ZU1A 1C9TA 2EEKA 2PGQB 5CHAB 1CA0C 2ZFTA 1P2NA 4I8HA 4ZMAH 1O3EA 2XCNA 3LH3A 4WF8A 4JK6A 1KYNA 3ZVBA 3A8BA 2G00A 4I8KA 4ZUHA 3S0NA 1TAWA 3PWBA 2WPHS 3RXAA 3V7TA 5C1XA 2JETC 1TONA 4B75A 4CH2B 3NWUA 2QY0B 2BZ6H 4MPWA 2O8UA 3GICB 3RMMH 2F9PA 2PKAA 1W3CA 5DP4A 1O34A 1YP9A 2NU0E 4JZEH 2W26A 2D8WA 4OS1A 1HAOH 1UVUH 4AB9A 1TNIA 1C1PA 1EZQA 4Y7AA 2IPHA 1C1MA 3D23A 3LGUA 3P8GA 3OTJE 2Z3DA 4THNH 2AEIH 1C5UA 1IQMA 2BLWA 2Y80A 4BAHB 3P8OA 4X2WA 1SR5C 3EQ0H 2F83A 1KXEA 1K1JA 1TMTH 2W7SA 1CQQA 3KQEA 3QGNB 1GBJA 1W8BH 3H7OA 3P92A 3GY7A 3A82A 3MO9A 3QGJA 5GCHG 4Y8XA 4XSKU 1ELDE 1AVWA 1GHZA 3SUDA 4ZKSU 1K22H 2NWNA 1VITH 2IOTA 3VXFH 2BD8A 3K65B 6GCHF 2WV5A 1TX6A 3RXFA 2WUCA 3RXOA 3SNBA 4ABFA 1MTNB 2H9EH 1EAIA 2OLGA 3LC5A 3CS7A 3LJJA 4NA7A 3ZZCA 2ZC9H 1MBMA 2Z9KA 3KHVA 3AW0A 4MTBA 1C1UH 1CVWH 1T8NA 1Z1JA 1DXWA 5FAHA 3QWCH 1C5OH 2FS9A 4JMYA 1HAYB 3UUZA 1A61H 1TOCB 1K21H 3TU7H 4YOJA 3BEUA 2B7DH 2B5TB 1QQUA 2BY7X 1XKBC 1Y8TA 2HWLB 1AB9B 2PSYA 2AMPA 1P2KA 8GCHF 4DJZB 1Y5UT 2AFQB 2GCHF 1BTUA 1GBLA 1AUTC 3RC6A 1LDTT 5GJ4B 3SU1A 1O0DH 2Y5HA 5F8ZA 1U6QA 4VGCC 4PROA 3NUMA 2W3IA 3LJOA 2FTLE 1C5VA 2F9BH 1LO6A 4OS7A 4DGJA 1SFQB 5B6OA 1Z6JH 4I31A 1D3PB 1O2YA 4IC5A 1FIWA 2ZO3H 1VCQA 1S85A 2CF9H 2FLRH 3E0PB 3NXPA 5EQSA 3ITIA 2D26C 5JPMH 4DOQA 1ZHPA 4AYYB 1G2LA 1LVMA 5AVDA 1TNLA 3E16B 4BAOB 2OCVB 1QB1A 1S84A 1P2JA 1XM1A 4GCHF 1O3DA 2GP9B 1DVAH 2A0QB 1C1SA 2ZQ1A 4ISNA 1P06A 4UFDH 4K1TA 1O3OA 4WH6A 5DP7A 1GI5A 3B9FH 1LVOA 4B76A 1OP2A 1GJ8B 3U69H 2P16A 3RXEA 3AASA 3SNDA 3TH4H 5A2MH 3GCOA 2HRVA 1RIWB 3QDZB 1O2LA 2XWAA 1MKXH 1BZXE 3RMLH 2JKHA 3E3TA 1EB2A 1F2SE 3Q00A 1UVSH 1GMHF 4Z6AH 3HKIB 1IQNA 1C2FA 1QBVH 3TNTA 1HXEH 3VPKA 1QRXA 4Y79A 1AU8A 4B74A 1SGRE 1ZTJA 2Z3CA 1AVXA 3LONA 1ZPBA 2BD3A 4LXBH 3RXKA 5DP8A 4SGAE 1Z8IB 2H6MA 4INLA 2BLQA 1KTTB 3L6PA 2GVFA 3NCLA 1WV7H 6GCHG 4XBBA 1AD8H 1GL1A 2XWBI 4GHTA 2SFAA 2UUKB 1FONA 1YM0A 2JH0D 3A7YA 3A81A 3RC4A 4BOHA 1E38B 1H9LB 4NGAH 1TNGA 1W0YH 1MQ5A 2ANWA 1MQ6A 2VWLA 2D1JA 2J92A 3M7TA 3TIUA 1C2DA 1VITF 1E0FD 3SJOA 1C5WB 3Q3KA 3S9CA 1SHYA 2ZTYA 3B23B 1N1LA 3RM2H 1Z71A 2BD7A 1P57B 2DE8A 3GYMA 1T32A 3VXEH 8GCHG 4FUDA 2OTVA 5TJXA 1WCZA 1EPTC 1XUGA 2GCHG 1UTKA 3D62A 4E7NA 4FUEA 4CH8B 4X6MA 4A5TS 2ESTE 1ZJDA 4HGCA 1MZDA 1T8MA 3RMOH 3M37A 1K1PA 1C1VH 2SGAA 5ESBA 1KXDA 2RA3A 1C1OA 1ANDA 1ACBE 1S6FA 3FP8E 5AF9H 3RDZA 1KXBA 3LGIA 1JWTA 4WMDA 1XKAC 3MNXA 5E2OA 5J4QA 1E35B 1QRZA 3SU4A 1LKAA 3MH4A 1DS2E 3T25A 1IQJA 2Y5FA 3JZ2B 4X8VH 1GBEA 2VVCA 4FUBA 2SGQE 3VB5A 1AUJA 1ZMLA 1UTNA 1P2QA 4GCHG 9ESTA 1H1BA 4XBCA 3DHKH 3P8NA 2O8MA 3RU4T 3EYDA 3MNCA 1W0ZU 1GBBA 1RGQA 1DANH 1EAXA 3MU1A 3K6YA 3CP7A 3GY5A 1CBWB 2GCTC 2ZP0H 4ZKOU 2EI7A 1O2QA 1UTQA 2JH5D 2BX3A 4JZDH 6CHAC 1AWHB 4FUJA 5AHGH 1AFQB 1UHBB 3PTBA 5GWZA 1NESE 3F9GA 1GMHG 4J2YB 1NRNH 1O2PA 4NSYA 3ODDA 5HM2A 2C8WB 3UTUH 4UFEH 1X7AC 1L4DA 5A0BA 3PMJA 1GI2A 2ZFQH 2C4FH 3TH2H 1TRYA 2PKSC 1K28D 4JYUH 1THRH 4DT7B 2ZPSA 2ZDAH 3IITA 3RC5A 1O2MA 1QR3E 4I7YH 1ZGVA 4KTSA 3HK3B 4AN7A 1Z8GA 2CV3A 3FFGA 1BRCE 2ZGHA 2FOMB 4CRAA 1FAKH 1TWXB 2YNAA 3IWMA