1W15A

Rat synaptotagmin 4 c2b domain in the presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
132
Chain Sequence
RGELLVSLCYQSTTNTLTVVVLKARHLPLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Evolutionary Inactivation of Ca2+ Binding to Synaptotagmin 4
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords SYNAPTOTAGMIN IV
total genus 30
structure length 132
sequence length 138
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1w15A00
3RPBA 4JPSA 4KITB 4TUUA 4TV3A 4L1BA 4FA6A 3F00A 1QATA 4FHJA 2WXFA 3FBKA 1RSYA 4F1SA 2CHXA 1UGKA 2KI6A 3JZYA 3GPEA 4WWNA 1E8YA 3APFA 4QJ5B 2YOAA 1V27A 3MJWA 3TWYA 4AOFA 3HHMA 1DQVA 4OVUA 4WWPA 4XX5A 5KJ7E 2NSQA 4J6IA 3M7FB 3ENEA 2YRBA 3L9BA 1RLWA 2WXOA 4IHBA 5CCGE 2CHDA 3W56A 3DBSA 2WXKA 2Z0UA 4ANXA 4L1LA 1HE8A 3OHMB 4TS6A 3SD5A 3TJPA 3OAWA 2WXGA 2K3HA 2ZKMX 3L13A 3N5AA 3S2AA 3ZW3A 3IM1A 3L08A 4MJJA 3IBEA 3LJ3A 2A5UA 2WXRA 4G11A 3TL5A 3PREA 2NQ3A 3L16A 3L17A 4FJYA 4LCVA 1W16A 2WXIA 2WXLA 2X38A 5CCHE 1QASA 2DMGA 3F04A 2CHWA 1DJIA 4URKA 4EZJA 1E8WA 1WFMA 4FADA 4WWOA 2ENPA 5H4YA 4BFRA 3QR0A 4HLEA 4LDCA 4PS3A 2CJSA 2CM6A 1W15A 3QARA 4GB9A 1TJXA 4BGDA 4NPKA 4GNKB 4F93B 3PS6A 4WAFA 2WXJA 3CSTA 4V11A 2EP6A 3NZSA 5T8IA 3PYCA 3HIZA 1BYNA 4ANWA 3W57A 2DMHA 4LT7A 4Y1TA 3P2BA 5JHAA 2CM5A 4KZCA 4AJWA 3APCA 3NZUA 3PRZA 2UZPA 3APDA 1DJHA 2K8MA 3ML8A 3QJZA 2ENJA 2QZQA 2WXHA 2FJUB 3B7YA 4KZ0A 4XE0A 3RDJA 2JQZA 2N1TE 2RD0A 3QK0A 4A55A 4EZKA 3L54A 1YRKA 3F01A 3HN8A 1E8ZA 3PFQA 3R7QA 4ANUA 3ZVVA 4HVBA 2QZ5A 3CSFA 1DJYA 1DJWA 3T8MA 4FLHA 1CJYA 4FHKA 4F91B 2K4AA 2NCEA 3NSJA 4NP9A 4PS8A 3F05A 1UOVA 3QR1A 4PS7A 1UOWA 2CJTA 4F92B 1RH8A 4IQHA 5G55A 1DJXA 4QJ4B 5G2NA 3QAQA 4QAMB 2WXQA 4ICWA 4WEEA 2ENQA 5H4ZA 4ANVA 5JHBA 2V4LA 1K5WA 1GMIA 2BWQA 1BDYA 5EDSA 4DK5A 2A4ZA 1BCIA 3R7RA 3ML9A 4DNLA 2D8KA 4XZ4A 2WXMA 4FULA 1DJZA 2FK9A 4QJ3B 1TJMA 2CHZA 4NPJA 1E7VA 2Q3XA 4L23A 1DJGA 1E8XA 4ICXA 4EZLA 4Y1SA 3FDWA 4OVVA 1DSYA 1E7UA 2Q0ZX 2R83A 2ISDA 3DPDA 2B3RA 4L2YA 2WXPA 1E90A 2K45A 3KWTA 4NS0A 1A25A 1WFJA 3L4CA 2LHAA 3KWUA 3ZIMA 5CCJA 4FJZA 2Y3AA 2WXNA
chains in the Genus database with same CATH superfamily
2EYRB 1NCJA 2IWFA 3T3ME 4DTGH 4OFYA 5F7LB 3DVGA 1U2CA 4HZLA 3PDGA 4TTDD 3BZ4B 4ZO6A 4NP4H 3N04A 5EIIA 1CFQA 3IDXL 4RBPK 4NO3B 2R4SH 3UPRB 3U9UA 3WN6A 4FL4B 4XC3L 5KBDA 3VXRD 3PP3K 2IOOA 2WXOA 4JANA 5AYTA 4KDTC 3VDCA 1REIA 4X6CE 2ADFH 3GHEH 3W56A 1F4HA 5CAYB 4YO0A 4OQ1A 1AANA 1EHXA 1YAIA 4AYFB 4JG0H 1PQZB 1QBLH 3DI2B 3S97C 4U1HB 3MRJA 1X5HA 3GI8L 3WFHA 2UUDK 5EN2B 2VM9A 4K5NA 2WZ0A 1BJ1J 3C60A 4ZW5A 5E9DA 4LDCA 4ECNA 5TQ2H 4OZIB 2ODIA 2J2ZB 3CXHJ 1EHAA 1IFGA 5L9DL 2J7LA 1JBJA 2F1AA 5DZ9A 4WF7A 4NO5A 4O2EA 5MP6L 1OTTD 4AW4A 4CADA 4KTYA 5GRUL 3ARFD 3AXLA 1BQHG 1H5BA 1MXGA 5D7JC 4NO3A 4A7QA 2NQDA 3FRUA 1NCDH 1D5IH 3LXBA 1WD8A 4JFDE 3W39A 2QZQA 3HG4A 3LQAC 5ILTL 1NCAL 1PJ9A 4M8UA 3U0TA 2DEYX 2ZG3A 1EAOA 1J9SA 4YPGB 5C6PB 3C87A 5C3LD 1EDYA 1AG0A 1MWAH 3FU3A 1UA6L 3FK3A 2LLNA 3IPFA 4GLRH 3RWEB 4EI0A 3TZVA 1KCVL 3BVNA 3UEZA 5A2IH 1YEJH 5GRJH 1WT5C 1AJ7L 3RWHB 1MHEB 1OLZA 5HGAB 4O9HH 4YSTA 3EH5B 4ZMXA 2Y23A 1KIQA 4LSQL 3BKCH 5AVYB 3QR1A 5A2KH 1S78C 5TTRA 4HJGA 2J5LB 3GLAA 3LPWA 5K59E 3FRPG 1E65A 3HEIB 4QEGA 4QLRA 4S1DC 3FQXB 5JIIA 5EV7A 4WFGD 5FFOA 2YAOA 5B7MA 3CDYA 1H5BC 2Y6TE 5FYJD 2YD8A 1UACH 1NC2B 4KK8D 4OUUB 2F7IA 2AJYH 3QJOA 1YNLH 1CE6A 3FOLB 4M7ZB 5D9SB 5SWSB 5IMOB 1CD1A 1BIIB 2FTAA 3P3RA 5IV2B 2DY2A 2CSPA 4A2HA 5EEYA 3ZE2B 2F2HA 2OMWA 3MFFB 4GUPB 4JBSA 3BVDB 3ESNA 3RPBA 1CFSB 1QFHA 2H3KA 3KHQA 5IMKA 4F7MB 1HXKA 3L4WA 4LCWE 3GKWH 4Q9CA 3N06B 2CIIB 3MV01 5BRPA 4F7TB 1CFTB 4OM0H 1S7UB 2ADGB 3V6FA 3PJSA 4OAWB 4S11A 4R5XA 1L7IL 5CJOL 3WEOA 4BE6A 3S8GB 2NNAB 1AZNA 1SOQA 3C12A 1R3IH 2CHDA 4LBAA 5DJCA 2GFBA 2AEPL 3U9UB 2VXSH 5HGDA 4Q7DA 2VE6B 4J23A 4N3UA 3OLGA 3JV5A 5EU4B 3SJVD 2ZWZA 3UYRL 5E99L 3FOLA 5EWIH 5D1XC 3RGVB 2N01B 2G9HA 4TQ8A 1MQKL 1RD6A 4I0KA 2WIIA 5IHWA 2BHUA 2DMBA 4TOYL 2IG2L 4UAOB 3WG7B 1VGEL 2BM3A 3FSVA 3PIQA 3GSNH 3K1DA 2BW5A 4JQXC 3ETBJ 1GS6X 3ZDYE 1F4XH 4LBEA 1N68A 3O2DA 4HEME 1OTUC 4S1RL 1L0QA 5DA4A 1ONQB 4YHPA 2AVFA 1MJJB 1GC1L 4JRXE 1EGJA 3QJZA 2MQGA 4XP4H 4Y2OB 3T3MF 4YDKH 3UG3A 4AIOA 5GRZA 1BQLH 4L8CA 2A74A 2ROXA 3HBGA 3LX9A 4YLQT 5IFJB 1KTKE 4AGLA 3WSQH 2VDKL 1ZANH 3BQUC 3HPJA 4FNPA 2VAJA 2X2HA 5CSBA 5FYKH 1S7QB 2AEQL 2GJ6B 3EYQC 1CJYA 3LEVH 4Y5XA 5C07A 5I19H 1C7TA 1TLKA 1E43A 3ERXA 4MAZA 2XBTA 5IB5A 1F41A 1CQYA 1PU0A 5HHOE 4JS7A 4AEIL 2OJEB 1EZVX 4HOZA 3BKJL 3H42H 5D7IA 3WHE1 1KEML 4MA8H 5J6GB 2FYVA 1UB6B 3HNVH 4U1NA 5IQ9A 3VXNB 4Y4KB 8FABA 1MRFL 3WXVH 2IDUA 4H20H 4Y1AE 3L7FB 3VXQB 4Z78A 2JCCA 1OK8A 3L9YA 3VTAA 4NZTL 3FNKA 3MROA 4IOIA 4ZUSB 1EEZA 4FKKA 1VZHA 1IC4H 4G59C 3BH8B 3HLKA 3FT2A 1FFNB 4JM2F 3EDEA 5MEQA 3S4SB 1OTUD 5CGTA 3ME0A 3NGBB 4R4BB 4XO8A 3EG9B 4ATWA 2G30A 4PGBB 3OAUL 2BXZA 1BQRA 1NIAA 3MACL 3NDZE 4WO4B 2CDEA 3HC4L 2NY2D 3IN2A 4GKSB 1SXBA 4FMFA 2ESVD 4KI5F 2WXNA 4ZTOL 1LQBC 1JCKA 1P4LA 1QBAA 1DQKA 1HHJB 4OLUH 1GGTA 1ACYL 5D1QD 1T6VN 1WIUA 2BW4A 3CH1A 2VMDA 2AJXH 2NTFB 5K9KA 2XWXA 5CEZL 1MPAH 5L4JA 2RTTA 1N8ZA 1EO8H 1MHPL 2LU3A 5DCCA 3MUZ1 4ZG1A 2MPAL 5BMFH 4G80A 4XPFH 1OWRM 5CS7A 2WTRB 5IY5B 2OMXB 3LTVA 3A4FA 1OB1B 2ITCA 1LDPL 3ZTCC 3NFPB 3X3FH 5SWZD 1KB3A 3L9RB 3M07A 4XMPL 3IAPA 1TG8A 1DVSA 1WWAX 3TYFA 4V2BA 3UAEA 2VDMB 1Q8MA 1EEQA 3NN8B 4KDTA 2P45B 4FXLA 4JFQB 4E42B 1U3NA 1OCWH 3H53A 4UV7H 4BFRA 4YO0B 1MFUA 3T2NH 4IDJH 1AD9A 3GRGA 1J5OL 1I8MB 4A2DA 4PJIF 4U6HB 2O5NA 4M7LH 3VAEA 3VYOA 4DQAA 4FQXC 3KS0H 4EJ1C 5KEZA 1DN0B 3TJHC 1EJ8A 3BDBA 3BZEA 1MFEH 4JFWA 2CE6A 1UC6A 1SN2A 1T2XA 2R0LL 5HJBA 2EDJA 3V0AC 4JAMA 3DJRA 5EIIB 1FL5A 4U6VL 2Y5TA 1WGOA 5EZLB 5EHFA 2CKBL 2HJFA 5AVUB 1VPOH 3RWDA 3TFBA 5DTFA 2ESVB 1IAIL 3C2AL 4J3OH 1D5XA 5JPNB 4FI6A 4A6YB 4XXDA 4TNVF 2P8MB 1LP9E 4Z1PA 3KMDA 1VKXA 3CSFA 3BWSA 3ARQA 1JGUL 3VXSE 4Z7WB 2XUWA 3LQMA 1TF4A 3VI4A 1KV7A 1A7PH 1DVZA 1WBXA 4QRPB 3PAUA 3D33A 3AM8A 3GSXB 4HV8A 5E2VL 1TVDA 4XPGL 3MLTA 2V3FA 4G8EB 3SKUD 5I1HL 5H4ZA 4ZMVA 2D0HA 4JO1H 5EIVA 1NDTA 1G7LA 4KKAC 1S9WA 3EYOA 1G1CA 3I02A 5CGYC 1Z3RA 1KCUL 5DK2B 5C70A 3CSPA 5F9WB 2EDKA 1YEKH 2F74B 1XD0A 3ETBF 4G8GA 4H13C 4MD4B 4ODVL 2Q76B 2H2SC 3VVVA 4UQDA 3BIKB 3KE0A 3LZLA 3OR7A 1ZT4A 1QSEB 5EUOB 3P77A 3HUJF 5KYWA 5BV7B 3VFSB 3BP7A 1HHGB 5A6MA 5J9PB 1JPSH 5D4HA 2ZWKA 3O9WB 1WHPA 3FO9A 3ME0B 4HKBB 1BIHA 4PYHA 3HI1A 1U8KB 3VXOB 3MTRA 4F1SA 4RISL 2CNYA 2C7FA 1QLRB 4LSPH 2I32A 4N0FA 4M4PA 3KPMB 4C4BA 5IBLD 1NCBL 1BQUA 4HDIB 3DJTA 5CBEA 3DSFL 3VXUA 2OZ4A 1BQHB 3T65A 2FIKA 1XTMA 2IAND 3P73A 5CZVH 5BZZA 2DJMA 5AAMA 3MBEA 3LVTA 5I15H 1EXGA 1NMAH 3BISA 3GLZA 4XNMA 1Q94B 4R96A 2P48B 3X3GH 3RBSA 1BZ9A 4S1RH 4WLCA 2H8PB 3ILEA 4FYRA 5F8QC 5B1KA 3PGFL 3KPSB 5KSAA 1F3DJ 1OPOA 2G2PA 5AB9A 4XNXL 2GB2A 3MRIB 2IFFL 4LOVA 4IHOA 5IHUL 2DQUH 3LIZA 3PLYA 5CIPA 1IFHH 3KXFD 4KROB 4V11A 3NIGE 4C59B 3TWCL 4KZDH 4Z7OE 4KUCF 2NY5L 3LKPB 4UUJB 3STZB 4JDEB 4F9PC 5HHME 1ZA3B 3MOQA 3KBPA 1NEZA 4UTBH 2VDKB 4FMKA 3FCSA 1T3FA 4G8FA 1BGXH 2E6JA 5FKAB 3U4AA 5DFAA 4I2XA 3LNGA 3P3UA 2HPTA 3P11L 4EF3A 2EYTA 5B1CA 3G6JE 1RZFL 4RISH 1NBZB 1BVKB 1S7RA 3QNXB 4UOW1 3PF2A 2AJ3A 5FA4A 5KUKA 2GBTA 4XMLL 4FN0A 5F88A 2I5YL 3SKJH 4IBVA 4Y5YB 4EN3B 3TIDB 5DVNA 2ZKHL 2YK1L 1KTDB 3CLEL 1O6TA 1TTGA 2VO5A 2BMKB 2BFGA 3QEGL 5DHVA 2I9LA 1MF2L 3KL3A 3W2DL 5F70A 2D7MA 3MTXA 4X99A 1CTMA 3FQUA 2A6JA 1J11A 2DBLH 2HJLB 5E2UH 4UZUA 1JMXA 2H9GB 4FLQA 2WLIA 4XCEA 3OAYK 4ES9A 4DP5X 3BD4A 4L23A 2R29L 2XJKA 1IILE 3FO2A 3KCWA 3PAVA 4KO9A 3HR6A 3S8FB 3Q06A 4IRZH 3LKNA 3UDWA 4L8SC 2ISDA 5DZPA 4HS3B 1F13A 2B3RA 3AMKA 3IS1X 4OJFL 5ENWB 1FVCA 2P42B 3KW8A 1TQSA 3NPSB 4LKCA 5J11B 3D51A 5CSZB 4LDLB 4DHLA 5LWYL 2NYZA 5I1AA 3EGDB 5DLLA 2XKUA 3D06A 1DCLA 2MOGA 2VDPL 1FHNA 1ZT7B 4UTBL 4PTUA 5GS1B 1L9QA 3NVQA 1ET8A 1HOEA 3QUXA 4YHKH 3I6LE 4GRWE 4HQQL 3EJZD 2JJVA 4NP4L 5EG6C 4R4NC 1YEHH 3L8QA 2XKSA 1U8QA 2P43B 5SX4I 1P4LB 4GW1A 2DQDH 4UTAL 2IIJA 4FLRA 3GJFH 2KLTA 4NO2B 2LOEA 1OOWA 4PJAF 4R9HA 3T1FA 4CVUA 4IK7A 2WYIA 2R2EA 4WFHE 4F1ZA 4WTXA 4ANXA 5JW4N 3C8KA 1BOGB 1LHZA 3U4KA 2V5SA 2PMZA 4BGLA 4EDWH 5KYUA 1IQDA 3HS0A 4O02L 5FM8A 1HYSD 1QHQA 4FADA 3FL7A 4DGYL 3ATEA 5IBUB 5JZ7C 4PR5A 2QTVA 4MZ2A 2MEJB 2PYFA 1MRCH 3Q2LA 2Z4TA 3PDOA 2AJUL 4GKNB 1EXUB 2CR0A 3KPSA 1N0LB 1UH3A 2HTKD 4YPJA 1KBVA 1VHPA 1HC1A 3E8UL 3GQFA 5C9JB 4YGVA 4XN9A 1NFDF 3IVKA 3K74B 2AXFA 4F5CE 2PCXA 5FK9B 5JMRA 2IEPA 4OM1H 1J8RA 4OGXL 5IW1B 3CZFA 2W8CA 4LOEA 5AZUA 3V9FA 3D69A 2DWDA 1IL1B 3AWEA 4ONFL 3HFMH 2P44B 3FTZA 4WTZA 5PAZA 3UTQB 1JPSL 2G2RB 2J44A 2XN9A 1TQCC 2FUQA 4NENA 3DX2A 5I66B 3JQOB 3S2CA 1A9BB 3B2VL 3CBKB 3WKNA 4Y2DD 1QPPA 3P0VH 1LP9A 4CU8A 5JNYB 3I9PA 1G5AA 2XT1B 5EOTA 1KIPB 2VT0A 5HYJA 5G2NA 1MWOA 2IDCA 3B7UX 4ONFH 1KEMH 1CD0A 3SGDI 3TH4T 3VNZA 5J1TC 1LMKA 3EW3B 5EORL 4Z77A 4Y19B 3E8UH 3AB0C 4P2RB 4FNLH 4P2OA 3X13B 3KJ4B 1A21A 3B4NA 3ARZA 4JZJC 4LPWA 5D1XA 5C0JA 3NJLA 4PJ7F 3THML 3ILPA 4KXZH 4YGAB 3MRGA 1HT6A 3GLDA 3EYUH 2HT2C 3OLIA 4NCC1 3HUJE 3AQDA 4N0UA 3HNSL 1F4XL 3QZPA 3U79A 1RUAL 4P46D 1K6QH 4R4FH 1T7XA 1T83A 2ZOTA 2UWEB 4OIIH 1KXVA 1AQMA 4D7PA 3SCMC 1A1MA 4NWUL 2DYRB 1UWGL 5FOBB 1S7TA 2D03L 4HBQA 5T3ZE 1J5OH 4PJXA 5FECA 3LMJH 2R2CA 3D5OF 4KV5E 2Z7YA 1HE8A 5SWZA 1OP3K 1EO7A 4NQSA 4QHKJ 3SE3C 2PO6D 5I8OL 1EVTC 3HI6L 1ZV2A 4PJDB 2HSIA 4O2CA 5KBKA 3LSOB 1GGUA 2X3BA 1LK3H 4JO4L 4NO0B 1DQJA 3H3PH 2UWEE 3U0WH 2I60H 1AY1L 3KD4A 4MAYD 3DC0A 1OAUH 1KB9J 5CWSA 1MAJA 4UQEA 4XP5L 3CQQA 4WW2A 5EU5A 4HUVB 2DLFH 3HLAA 4E9SA 1WIPA 3LQZA 3MLUH 4JN1L 1EAPB 2HX8A 3EKCA 3F7QA 3U36B 2YPKB 3P4LA 1EV2E 2LU4A 3HFFA 4KI5E 8CGTA 2H32B 3RIFF 4HUWB 5ECJE 3L1GA 3C8DA 3KPSD 1AGDB 1ORQB 2DMHA 2EDNA 2X4SB 2NX5D 3ELQA 3M1CA 3O4LB 5F8RC 2VNCA 2HKFL 4EVNA 9PCYA 2F0CA 4KX7A 3QRGL 3TU6A 4PJBB 3MRCA 3AG4B 3LIUA 3T0VA 2Q7AA 4KI5D 1KFAL 1ZLWK 4Z7NF 2F54E 3FT9A 3O2WL 4HIIB 2OQJB 4GSUA 4ATTA 4ZMLA 4NQUA 4JPKH 5ESAB 5E4AA 3Q3GB 4F7KA 3SE3A 2MH4A 5KTEH 3CQPA 1BX2B 3BPNC 4JUTA 2WO4A 4GQPH 5C0CD 1C9SA 2X4RB 3D69B 3SBRA 4HUUB 3HB3B 2APBA 2CDGB 2FT8A 3ZTDC 4ISVB 4KUZL 2NTFA 4YGVB 1S2EA 2IBZY 4KKZA 2IDQA 2NY0D 4Y5VA 5IP4A 1U8PB 2DQDL 4R0LC 3EDDA 2WBJA 2XTLA 5TD4A 3FN0L 1D9KC 1WYJA 5FCUH 3WNPA 1YHPA 3ML9A 4PGJA 2GAZA 3BAWA 3VH8A 3WIHA 4N6QA 3RB7A 3O6FD 3MRLB 5DMYA 3HBQA 4HHAB 3QZWA 4HAFA 1IGFL 4P5RA 4XMVA 4UM9A 1H15A 4MD5B 3V5KA 3O6FA 5CZKA 3D85D 2C1PA 1HDMA 4KZEL 2HT3C 5CJXA 3N40F 3VWKD 3FW6A 2CU9A 3A23A 4PCSA 2EUVA 4KQ0A 4AQ8C 1JGEA 5JUEH 4YL4A 2IMMA 3A5VA 5INDA 1GZQB 3BHBA 1R75A 4NHUB 1U92B 5IW3A 5AFAA 5GRUH 5I74C 3GDBA 1J8HA 5HVWA 3TN0C 1M71B 1A7RH 4N4YB 1RMFH 4BFKA 1BVNP 1V8HA 3BKML 3DHUA 3VWJD 3AGWA 5CIPH 4FG2A 1G7QB 1IIIA 4TOYH 3FQWA 1D7DA 4R84A 3Q48A 1JF5A 2ZYSA 5JPNC 2ICES 4MNGB 4YFLF 3TJEH 1N5AA 2H41A 1BFOA 2EYSB 2WB7A 3WMPA 3IBEA 2FZ3A 3WFZA 3BFOA 4RSVA 2A9ML 2J8UF 1CT8B 2ZKYA 5CEYB 2BC4B 3ZR6A 1KC5L 1CGTA 2Y07H 2BERA 3U9PL 3ZHNA 3WNLA 5IB4B 1DO5A 5CN1A 4MXWH 4EPSA 2EH7L 2YR3A 3MRMA 4OQTA 1Q38A 5D7HA 1ETZB 2HH0L 2COVD 4F93B 1FBIL 4YBLB 1F1AA 1TZGL 1QG3A 4K5PA 2FE0A 4JDVA 1EK3A 1ZS8A 4NN6B 3UBXG 3D7PA 4JAMB 4XI5C 4U1KA 3AAZB 4IMLA 1AP2B 1AHMA 2V5MA 2EDTA 4NRYB 5D1ZA 1BFVH 3TBTA 4O2CB 1BMGA 3UAJD 1KB5B 5D5MA 3LYRA 2OA9A 3RNQA 1OANA 4YC2C 4JFFB 3IXTA 3AY2A 3CZUB 5HHMD 3LXAA 3MBWA 2BZ7A 5F7AA 3DXAE 4RBPH 1FSKB 2W92A 2H6UA 3QC6X 2NY4B 1QSED 5ICZA 4QGTA 5FR3A 2XWBA 3H4FA 5F0JB 2KZ1B 5KZCD 1JPFB 1AGCB 3THMH 3HG0A 5DHDA 1X5MA 2X9XA 4MCYA 1MCHA 1BVLA 1G7PB 3H6AA 1CGWA 5EBMB 4CL7A 1O7DE 3MYJB 4GS7C 1JI2A 3C6SA 1M05B 1T66C 4RMSA 3G6AA 1NFIB 2OMTB 3MLZL 4H44C 4URTB 3BPLB 4R2GD 4PJEA 2LTQC 4UM9D 2QL1A 2H8PA 4FG4A 5JQ6H 2C9RA 4G6KL 3ZN6A 5IVXB 4LEXL 4JEGB 3GO1H 4N9OB 2Q10A 1RAMA 2PCFA 5C09E 4Y19A 1WFJA 2B1HL 3RWCA 2YOCA 3PGCA 2OP4H 5I6KA 2DWXA 3MCYA 3B2VH 3B8YA 3MJ7B 4XCYB 4LLVB 3TBVB 4Q8BA 3QIBA 1MWAA 1URIA 4ODVH 2ZP8A 2MHAA 3DDGA 1BYPA 4UBDC 1VESA 2NRDA 1XO8A 2AQ3A 1AH1A 3CFMA 1J0JA 1QHOA 3ARUA 2V3EA 3GBEA 3SQBA 5CEXB 2BLFA 1ZHKA 2GTQA 4LVNC 1JZ4A 3T4YA 2OFQA 2IADB 4TKWA 4WUUA 3S96B 2J6EA 1MNUL 2IAMA 2V8MA 4XAWH 4E42A 1U8MB 4P3DA 4UT7H 1RZKC 4R3SB 3ZGHA 3CFCL 5HGHB 2BK8A 3MA7B 1GW0A 4M1DH 4JL2A 4NDMB 3MRHB 2VW6A 1YY8B 1BZ9B 1B3IA 4UU9B 3ZYIA 4CMMB 1JDAA 4ZI8A 3ASWA 4GH7B 1MCWW 4N6RB 5I1DA 3QFJB 2CCWA 2Z31B 2FO1A 4ZNEE 3EGXB 4FA8A 2CR3A 2WM0A 4MA1C 3D18B 3RP1A 2DL2A 3QNFA 1J87A 4PGDB 4PUBH 2O5YL 4IBWA 2ZJSH 3GNMH 1ZD6A 1Y0LB 2O61A 4HK0A 4U1JA 4LLWB 2W38A 2X05A 1X9LA 2ZNWA 2CQVA 4GKZA 3IGAA 1RIUL 5T1LB 4AQAB 3N0PB 1YY9D 4XRCA 3UZEA 3AREA 4IU2B 2V37A 3OJDA 1AS7A 5FM5O 1D2OA 1C5BL 4OZIF 1B6DA 3HNVL 4Z7WA 1AFVH 3BIBX 1QBMH 2A6IA 2YAFA 4Z77B 1YECL 2WNXA 5IMLB 4KTGA 1RZJH 4I2XB 2OJ1A 4PJ5B 3ULUH 4UI2A 4JNXA 4HIPA 2XWJA 4HH9A 5AOZA 1PF3A 2B16A 4FHKA 1CB4A 4LPXA 3V4PH 2MQCA 1MCPH 5JIQA 4RAVB 5EC2B 2XZAL 3S36H 1OEZW 3LZNA 1DFXA 2OAAA 4NCC2 2IBBA 2XC8A 1IX2A 2W9EH 3FO9B 2GSMB 4WEEA 2X0WA 4Y9FA 4PGEA 1F11A 1UT1A 4AJ0A 4U1LB 4HU2A 1JOIA 4UT7L 3GHBL 3HE7B 4YUEL 3SSGA 3IGUA 2FQDA 4LKCB 1J48A 3JV4B 4A63A 2Y06L 3ECQA 5B1JA 4M4RB 5L2KD 3RVVC 3Q13A 4MAYC 1TITA 1DL7L 5BQDA 2HB0A 3CIAA 4OZFA 1EJFA 1NC2D 3US1A 4XNQA 2DQ6A 2NQCA 1NFIA 2OMTA 3BI9X 3D0VB 3R06B 4M6NH 3FB6A 1EGJH 1JHLH 4FJZA 1DDHA 4UV4L 5E51A 3SDCA 4G70B 4FA6A 1Y1DA 2JKLA 3V4UH 2QVMA 5EEUA 4LLUA 5IJKA 3GBDA 1ET5A 2ZCZA 4GP4B 5HI5C 2R7EB 3BEWA 4GUCA 2FJFB 3IB4A 1JUFA 4XVSH 3HZ3A 3DURA 3GF8A 3I6KB 4HJJH 3WKPA 2PPDA 4GSDH 4XN5A 5C0BA 3WEAA 5JR1H 1JHTB 4R0LA 3W0WA 4PV9A 4CU6A 2RIKA 4AYEC 3QB7C 4FMVA 3DRQB 1I53A 1D7CA 3O2VL 4LU5L 2X6MA 4M4RA 4WFFD 1OE3A 1DBJL 4OFPA 3VMOA 3TGXA 3FTYA 3CGTA 4LGSB 3TBVA 4HISA 1T1YB 2DOCA 2YSSA 3QDGD 4E41B 4WU7B 5F93C 5HDBF 3Q2WA 3ARXA 3GBLA 5A2JH 3F2LA 3IRPX 2MSPA 1I1AA 3I9AA 3QGVA 3ZKSD 3SDCB 3MI6A 5E94A 1A2YA 5DS8B 1RVFH 4A68A 5BNXD 1BLNB 3ARED 4EBQH 2WMPA 2HZHA 5T8IA 1B4JL 3CUPA 3PGFH 3WLWD 3GLEA 2QGEA 3MOBL 3HE6A 1OT1A 4HJUA 5I16B 1P7BA 5IJVB 3DOSA 4I18B 2E3VA 3NTCL 5KWYC 4X5PA 3VFTB 3WY1A 4HOXA 5T1JA 2EDYA 5DUPH 1E2ZA 2V3DA 3B3IA 1AD0B 2BFVL 2DI8A 3O9WC 4RDQF 4XGZA 3DJZA 4Y4FD 2QMJA 1KTDA 1WP6A 1RP9A 1NZRA 2TSAA 4J27A 3ULVD 3QNZA 3FT3B 4MGXA 1UT9A 5SX4H 1FAKT 5FAAA 3QJSB 4P2OB 4MVBD 2BSSA 3TM6A 4EUPH 3BRDA 4AC4A 4YFEA 2ZX6A 3OG6B 1BVOA 1L7IH 3TVMD 3L2LA 3N43B 2JKXA 3EIFA 3FFCA 5EDSA 3RWFA 4UB0L 3D4YA 2VDML 1KG0B 5GS2D 3WKQA 2ZAGA 4BA8A 1EXHA 5DRXB 4FULA 2NZ1A 1Q9KA 4I4WA 1QW8A 2P7TA 2XYBA 3IKKA 5GGVL 1HQRA 4F58L 4H25A 4PJCE 2EABA 2YPLE 1SY6A 5E2VH 2YKKA 4JHUA 3LN5B 2EE6A 2F5BL 5I1KH 3M7OA 2V9QA 3W5MA 4JB9H 2ZWLT 5DMIL 2JK5A 2ZYHA 1HAWA 1IC5L 2XHNA 4PRPB 3D2UA 3G7TA 3QUYA 5C86A 2AV7A 3QS2A 3RZCB 1XBRA 3T6VA 2Z4QA 3NCFB 4AV5A 1MW1A 1GXEA 1ADQL 2RALA 4TVPH 1FA4A 5DR5H 5AB2A 1NC4A 4YK4C 4LDOB 4Y5VC 2JKRM 4Z3IA 1FZMA 3DETC 3PDOB 1CFSA 1IGYA 4IHBA 4J4PD 3V5HB 3V52H 3RIFK 1WIOA 4M6OL 5L6YL 4C54A 4FZEL 1U42A 1Q72L 2VIRB 2GTWA 4NRYA 1WBZB 3EBHA 5IFAH 4CC1A 2UZYB 4JY6A 3VVWA 3FB7B 5CHNA 2NQ3A 4PJGF 3QG6B 5KJRL 4MA3B 5LB1A 4F37K 1HINH 2BSED 1FZKB 1K6QL 1R3LA 2XETA 4P46A 5SWZE 4C4KT 3RTQB 3K5SA 4Y8AA 4FTVB 3QEUB 1DQQB 1ZK5A 4AIEA 2ZSVA 2H1LM 4AGPA 4AC2A 3JYCA 3PYCA 4G9FD 4LFHG 2JB6B 4WV1B 2R2BB 3RGVA 1SJHA 1TYEB 5A43C 2QQNH 3UZVB 2FRGP 2O5XL 5LAXA 1E0OB 5I1CH 3NJGA 4F5CA 3P9LA 5I6XB 2OCJA 3FB5B 5D93B 5KBPA 1AQKL 4OCSL 1JPTL 3CHQA 3G6AB 1LK2B 2E4FA 4KROC 2V2TA 5C0GA 2ZOWA 4PJHF 4MQSB 3K72A 4WEUD 4KVNL 3I9IA 4A7GA 1IVLA 3HS0C 3P02A 4JFED 4WKZB 4E0RA 5D9SA 5E1AB 1T03L 1E3ZA 1XF5B 1Z9LA 5KSBE 3DX8A 4L4VE 1GKEA 4M93C 1MCFA 4P9HL 3RTQD 3OJVC 3RVXC 3VG0L 5CM1A 5INCA 1MPAL 3KBFA 3VRIB 3C9NB 1J88A 4RFNC 1H19A 4LVOC 5E08H 3MV8E 1OV8A 4QAMB 3QUML 3DPBB 1OAXH 4Z76B 4JE4B 3UIZA 5ADPH 4JRYA 1SDYA 3MGOA 4YZFF 2HRPL 1AHWA 1KLUB 1K4DB 1A4JB 4X42A 4BM7A 3BN9C 2AHIA 3R19A 4ODHH 2YRLA 1BREA 2F1EA 4PRHA 2NR6A 3QORB 1Z9OA 2VM3A 2XVGA 4PJFB 3SDAA 4D3CL 5IBTH 4U1HA 3FC8A 1INEH 1E7UA 4DK3A 4EMZA 1KCWA 3FYEB 4R4FL 3VFUA 1RK1B 1UZGA 3EO9L 4UQ2A 5I6NA 3W5NA 2LU5A 3QQ4B 1HCYA 1WAAA 1IE4A 5BJTA 3LHPH 4HGWB 4NQTA 3PWUB 4QY8B 1WTGT 1E4JA 3FQ4A 3GSVA 1GW6A 2HLAA 1BLIA 1XSKA 2VSKB 1Z0NA 4TLKA 5GJTL 4EI5C 1JGLH 3KPLA 2C8NA 5E4EC 3I2CL 3LXUX 3KLSA 4HS6B 2VR6A 5TE4H 1S78D 3DVNB 3VQLA 1J12A 2P5EE 5HVGB 4H8PA 1W72A 2OPCA 1P6AB 2Y25A 1T2QH 4CSPA 3C60B 3OTTA 2VC2B 4G7YH 4O58H 4JJ5B 4EI6A 4Y2LA 1FZMB 1XXFC 2QFPA 3PQYE 5I0VA 1GGCL 4LL9A 4BK8A 1T21B 3PREA 5I8KH 2FHCA 2H32A 2ROYA 4WO0A 2JELH 4NM8L 1IM9A 3HS8A 1NBVL 1NINA 5C0FB 4UZSA 4U0RB 3RE0A 2DQFA 3RPIA 4JKKA 5C3TA 1MI5B 3E80A 5T5NG 2K6ZA 1JN6A 1UZ8A 1R3KA 2E7DA 3BYYA 1T0MA 5I5IA 1S7SA 1ZPUA 2PTUA 4WTQA 2WLLA 3HC0A 2BS8A 2D9QB 3R0NA 4FDWA 1PLGH 4OLVL 4NNPH 3APCA 3WEMA 5LNDA 1BX2A 4U1KB 2BSBA 2NNXA 2ZONA 2CO1A 3CX5J 4N2OA 5E9DD 4WNQB 1WEJH 1RHFA 25C8H 2X1XR 5LAPA 3PWNA 4MB3A 5FUCC 1V7ML 1CO1A 2ZSVB 3FPYA 3FB8B 3MRNB 1T1XB 1R3IL 3EF7A 1A3QA 3QEUA 4ABWA 4YHYB 2FEDC 3GJFA 1R4XA 1GPOH 2CPCA 1JHKL 3ZE1B 5J8OA 2PP9A 5I30L 3MV8B 3BUIA 4K3GA 5GGVH 2EH8L 2XZQH 4OZFH 4Y1AD 5HJ3A 3NSJA 4WENB 5FOJA 3L2MA 2N7BA 2XIBA 3E6FB 2A0LD 4JO5A 4O02H 2Z8WC 4OM0L 5D4QA 4GO6B 3T0ED 3P3SA 2XTJD 4D8PA 3SDYL 1KBKA 4WEMB 4ICWA 5C7XL 1XF4B 3A4EA 1A14H 3BPOC 5HDQL 4ORZC 4DCQA 1B4JH 2NY6D 3KPPA 1N12A 5I17B 1KELL 2BRQA 3A6BL 1V3MA 5C0NC 1IGTB 2AS5M 4TXVB 5K69A 2I69A 1DANT 2C3HA 4LEBA 1XF2A 3GTTA 3BKCL 1LJMA 1KPUA 3ARDA 5J13B 3R1GL 4I77L 5K9JH 4HWZA 3RGBA 5KVMC 3KJ4C 4PJCF 3OC8A 2C9UA 1FV1A 2WK2A 1ZS2A 4MX7B 3S3CB 4QHNB 3ULUD 2FX8L 4MZRA 4DW2H 2VDPB 4FGMA 4QHMB 43CAB 1ULVA 4QJ5B 3ABMB 4HULB 1AOZA 2AEIT 3TWYA 4J6RL 4LARH 2Z91A 5T5NF 4MSWA 2UVFA 5K9OA 1I7RB 3RJQB 2R4RH 2ZCKL 4AL8C 5L2KB 1ESOA 2N56A 2PPCA 3QO1A 4XVUC 3SZ6A 1FVCB 5F1NB 3GZOA 1LD9B 1YEGL 1C8PA 3M45A 3DOSB 4GFTB 4I18A 2Q8BL 3CHXA 1CF1A 3ISWA 3RILA 5C0CA 4X98A 1TQBB 2E0PA 1AKPA 3QA3B 1H3PL 4R2GC 5B8CA 1SOKA 5DJ8B 3ZT7A 4AQAA 1ZT7A 4JDEA 5FM5M 4AEHL 5T1KD 1U0QA 5T1DL 5EZJB 3TS8A 4KOCA 3SDDA 2PP8A 2XY2A 4OTXL 4JUSA 3TEUA 2ZYIA 1EZUA 2J25A 4K7PY 2L7JA 1XH3B 2XWJB 4HH9B 1PCSA 1LK3L 2BVPB 1XIWD 3VXMD 3ZDZE 3MUHL 1IT9H 1ZXKA 3AQYA 1KG0A 1IGYB 1QI4A 1SVBA 2D2CC 4LRIC 1BA9A 3V55A 3EDFA 3UBXA 3LD8C 1BMWA 3C5ZD 1MCPL 1YN7B 4HPHA 2SEBA 1DJYA 1R33A 5I18L 4HJGB 3BMWA 5GGQL 1SQMA 3FCSB 3CG8A 4X9IA 4G7YL 3MLWH 1N0XH 3ZSTA 1HJCA 2EDLA 3GSOA 4M6AA 3C8HA 5F9OH 4R6UA 3LS5H 2X4NB 5KSUA 4J3OG 3GHBH 4JHBA 3T0XA 1K9TA 2C3VB 5IR1B 1NMBL 4MNHA 3W9EB 3UBXI 5CLZA 2DAVA 3T2NL 5ECGA 3CVCA 2WP3T 3FFOA 3H7BB 3IMRA 1WG3A 3DVIA 3TCTA 1JGLL 3HZYA 3VTMA 3IE9A 2J4WH 3S37H 4QJ3B 3VI3B 4FQ1L 2IH3B 3GJEB 2A77H 4KRNA 4ICXA 2R23B 3VFRA 2WVVB 4WK0B 1OAYL 3VFGH 1II4E 4PJ7A 4FFYL 3CLWA 3ET9F 3F3HA 5DEJA 2NNFA 4G80B 4LGPB 2WW8A 2EXSA 3IJHB 1JWSB 3MLRH 5AZ2H 2YARA 4N2CA 2F68X 5AD0A 3QEHB 5DMKB 3QJHA 3RFZB 1JTPA 1MUJA 2GT9A 2NXYC 3G9AB 1S9XA 2GUYA 3KJ6H 4MXVF 4Z7VA 3QJUB 1SNRA 3VXPB 2UXFA 1INEL 3VXSA 3DUUB 2YD3A 5EDXA 1LP9F 2I26N 1N5YH 3GMPA 2NW3A 3X12B 3HMXH 1JZJA 1P0SE 1TYRA 2G9HB 5EZOH 4I3SH 4WEBH 2IWKA 1IKFH 3T4AA 3ZO9A 1TTBA 4LPUA 4P07A 3MZGB 4Y4FA 3O3BA 3LJ3A 3SQOH 5LDUA 3PHSA 3L16A 3QBTB 3DXAA 5I0YA 4FLOA 4U05A 2RBLA 1D6EB 3DK2A 4N90D 2YAQA 1QFWI 3RRQA 3VRLE 2GK2A 4JM2A 1ZCRA 3RDTD 2O5ZH 2EDRA 2ZD0A 2DWEB 2R1YA 4P23D 3SGJC 1LVEA 4RDBA 3C5ZB 4XC1H 5JW4Q 4DETA 4TVUA 3FH7A 4LPTA 3CXDL 3N9GH 1CGXA 2VJXA 3H6JA 3RU8H 3IFLL 3VI4B 1BM3H 1OGSA 4XO3A 3VXMB 5I28A 2BIOA 4W6YB 2YRPA 3B2UC 5K33A 4EZKA 1BP3B 2WC7A 4NZRL 2P5WE 3MKGA 2XWZA 4OCXL 5JPNA 1TQVA 4KJWC 1QUNB 3U0PA 3SE4C 3L48A 2Q3ZA 1QW9A 4LHUG 1J5CA 1A8JH 2CD0A 4HQQH 3BLKA 1BAWA 1ZSDB 1FGNH 4ODTH 4ENEC 1ORQA 2X4SA 3MLVL 5D8JH 5BS0A 5H94A 1OD7A 3KDPB 4UQAA 3TN0A 2ZF8A 4Z7QB 2JNZA 3HOGA 4GMTH 3CN0A 1UYWH 4KHTL 3TBWB 1MCLA 1K8DA 1WTLA 3WIIH 3NFNB 4F8QA 3WS6A 1JXDA 1NGQH 3LKRA 4FZEH 2PR9A 3TJHD 3UMNA 2IO5A 4FFTA 3GI9L 4X2UA 1TJMA 5KSUB 1J05A 3VWJB 3ZDZB 4BE5A 1CFMA 3BD5A 4LEOB 5TFSH 4KK8C 1HH6B 3WUWB 2AEWA 1XGZA 2KZBA 1R24B 4IRJD 1A7NH 3E1ZA 1G9HA 1PSKL 2AJZA 3LXCA 1JZ2A 3ZKMC 2EVGA 3O41A 5C0EB 4LCUB 1HQ4B 3VG9B 4MCNA 1SHMA 3MGTA 4OTXH 1NKRA 1R3JA 1PY0A 1WS7A 4P2YA 5LBSH 5HDQH 4KJWD 1GZPB 4JRXA 3QUMA 3GJFK 5DDHA 2AF2A 4PJ7B 4FTVE 1GYUA 2ZXDA 3VXOA 3D8MA 4FX5A 5CMAB 4UTCA 3MRPA 5F6IC 3CQFA 1X5XA 4H26A 1RUML 4WI0B 3AACA 4Y5XB 2IXQA 5I1LA 2W60A 3MMEA 4K8RD 3K8MA 2MWCA 3O6FB 4AYSA 1A6PA 3CLEH 1YAZA 2Z7WA 1FLRH 1MCBA 5C0GB 5GS0L 3O4OB 1Y6KR 5AUMA 3NCYS 1USQA 4W4NA 1DQIA 4AJYV 5DD5H 3U2IA 5HVHC 3CC5A 5JYMA 4J3BA 3SDXF 4G11A 4PJ8A 1IM3D 2WWOA 1HH6A 3IJHA 4HMDA 5KOVC 2XTJB 2HMID 1SMAA 3MROB 1U92A 4URKA 2H6PB 5DJAA 3NZ8A 2QPDB 4RGND 1PAZA 2CUHA 4PJFF 3ROLB 4RFNB 2AEQH 4GNKB 4JRXD 4JANB 3RA7L 1FYTA 4Y4HA 5DQDH 3CZKA 2EE3A 5HJ3B 3OX8B 3AU1B 4C56D 5ABDE 5JPMC 1DZBA 4QO1A 4WTZG 4O02A 4I1PA 3KHOA 4OFYD 1BQ5A 4UANA 3CX5K 3OMZA 2DWEA 2R1YB 1RHHA 2BY1A 3I50H 2VZTA 3VFWA 1XIWC 4QRSA 1IBGH 4Q56A 3REVB 2NX5B 1QVOB 4C56E 1H0DA 4AT6B 1E8ZA 2N3JA 4FL4C 4HYTB 5FB8B 4L3EB 2COQA 1HNFA 3LH9A 1FDLL 3O4LA 3P9MB 5EH1A 5J0BA 4WI9A 3K81A 3KPLB 3JUZA 1QRKA 1G6RH 2GJZA 4NZJA 3ZDWA 3W81A 2VUKA 4CADB 2DQEL 4P5KA 4OCRH 4L9LB 5IQ9B 2EINB 1FG9C 3NT0A 1WFUA 4QRRE 3ZE1E 4LHQB 5C0BD 2OL3H 4U1SB 3MQIA 4ZS6C 5CLXA 3O0RL 2RH0A 2K8QA 5G5DB 3RNQB 1HHHA 1KXQA 4JPIB 2IQ9H 4G7SB 2NUPA 4JJ5A 4DO5A 2ESVE 4EI6B 2CGYA 4JFEA 5DJ6B 3OF6A 5C0BE 3ROOA 2WQ8A 1KCSL 2VXQL 3G5WA 1JV5B 1PMYA 2Z1KA 1NM4A 1EIBA 3BUYB 1RZPA 4KKCC 1KCUH 3UTSA 4MCYB 1DP0A 3S3JA 4P2QE 1NLBH 1TTAA 1MI5A 2I7SA 2AJSL 3NRPA 5GGSY 2YZ8A 4B3EA 4WTWA 2XQYG 3VFRB 4F2MA 4YSEA 4FRWA 4OZIE 3FAXA 2V17H 4XNAA 3VD4A 5CWSB 3D25A 3MV9B 1I3RA 4KC3B 5D2NA 4TN9A 2MMXA 5C6TH 4K7PX 5C09D 2YLHA 3I9GL 5A16A 5FUOL 1BFOB 1BEYL 3QQ9C 4TNGA 1YQ2A 3EFDL 1E30A 1SRDA 1JZIA 3GMLB 5IR1A 4M7LT 1XGUB 1IEAB 1WRFA 3G04B 4PW9A 4M00A 4QRBA 4EXKA 1EZLA 1GMEA 1R24A 2G2RA 1N64H 2CZNA 1VADA 3QORD 4FFYH 4KV5F 4LRNL 4PP2A 5A2LH 5DWUL 2YEQA 4ZZFA 1CXLA 5LAXB 2ERJB 3BH8A 2ADFL 1V3KA 5I1LB 3GFUA 3GMRA 4R8WH 1A7PL 4GAYB 5FO8B 5AVRB 2FX9H 1YMMA 2A5UA 4ZO8A 2E7MA 1T21A 5K1VA 3GXPA 1QASA 1Y7VA 2WQWA 3HMWH 3HHSA 4FFVC 1WUNT 2DH3A 3V7AG 4Z5RB 1A1NA 5HHQA 3K80A 5D2LE 1P5VA 1SDDB 3KWXA 1K2DB 4Z3HA 3CSTA 3UYOD 1PEWA 5CEXA 1U8HA 3O3DB 5L7XL 4LMQI 2OLDA 2XXGA 3SODB 3TOPA 3ETTA 3L9EA 4AJWA 5FWRA 2V2XB 4HPOL 3K72B 5EU4A 3ARBB 1V7NH 1OAZL 2ENJA 2H0FA 1P4IH 4Q9QL 4WY7H 3LZFL 1TZIB 1XGUA 4B97A 1XFPA 2FD6H 4UDTB 1BSIA 1B0WA 3WDIA 1NCGA 3LRMA 2PW2B 3RNKB 3QQDA 3PHQB 2P46B 3IJYB 3DPBA 5CJBA 5FO8A 2OMZA 1WFOA 1X5YA 1MOEA 2CRIA 3NN8A 5D55A 2V7HA 4CN6A 5JIKA 3PIQB 4BXSV 4LKXA 5BCAA 3WTYA 1JFQH 4IYKA 4PWIA 4JFTA 2C9QA 3FMGL 4PJEB 4TMPA 1N3NA 1KYDA 4K2UL 3QDME 5DS2A 5E5LA 2HFTA 3DVGB 5K9OB 3NK3A 1PPIA 3LN4B 1NL0H 3TBSA 3V0VA 1J9TA 5HHOD 4OLXH 4DNLA 5GRVK 4BV1A 1G9MC 1MNUH 3MV9E 3EJJX 1IGCH 3LKSA 1OWWA 4M8VA 5DO8A 1DBKH 1UB5B 2PWGA 2Q0ZX 3KEDA 4APQC 3OF6D 2R1XB 3BT0A 3DHMA 4A1RA 2YFOA 3QULA 4FQCL 2FGWL 4GAFB 4QHPA 1T89A 3LRGA 1RULL 3LQZB 4LSVH 2HX9A 2B2XL 2OMUA 4BFIB 3RTLA 4BUGA 3CZJA 1VACB 2OTWA 4J6RH 4LARL 1TQTA 1GA2A 2VXTL 4E36A 2MPVA 1ZVYA 2XRAL 2GEEA 1VZGA 2NNRA 2ZNXA 3C5JA 4HF5H 4BUQA 5ACLA 3LZQA 4BK5A 3V0IA 2EDBA 4Q6IC 4JGMA 5FWQA 4DP8X 5B7EA 2E86A 3FUEA 1X5AA 5E56A 2AW2A 4XP6L 5CBAA 3LRLA 1CG9B 1BOYA 1FFPA 2DZEA 3MV11 1K4CB 4K23L 4CA4A 3F84A 4ENED 3L6FB 1P1ZA 2VO8A 2YD2A 1KMGA 5CXPA 2YUVA 3PNRB 3NIFE 4TLTA 1NCWH 2X6VA 2ZOUA 4CVXB 4NHCL 2WUBH 4XB8A 1NAML 1QNZH 3D2UB 3F6LA 1M57B 2OMVB 4M3JA 4B9KC 4JFDD 3RIKA 3QUXC 4NIYE 4F7EA 5B1BB 4Y5YC 2Y7NA 1OE2A 2DTMH 1IEAA 3FTXA 4FQIH 1NUFA 4AH2B 4EOWL 4BDVB 2VH5L 3EGXA 2HTKC 2Q2EB 1NC4B 4DUXA 5I30H 4PWKA 5CO1A 4OF3A 2MKWA 3QWRD 2HA1A 2Z93B 2WCSA 3NACH 3ISRA 2JKNA 5HHNB 1IGIL 1PFOA 1W0WB 2J1ZA 5IROC 1RJLB 3WNIA 2Y1ZA 2JKSA 4ODUA 5F9AC 2K4WA 1RXLA 3ASOB 5B3JE 5EFIB 3UROR 4FNQA 3OKLA 3UYRH 4JX0A 4AYID 1BLNA 1FFQA 3CD4A 4PS8A 2V7NB 2XV3A 4Y9CA 1XBDA 5AAWA 1HNGA 2R69L 2OSXA 3NACL 5DJZB 1SLWA 2ARWA 2ZTBA 3EOTH 3QQ3B 3GSWA 4FQHB 5IQNA 2D7TL 4XP1L 2MFNA 3S5LA 1NFDE 1E5CA 5TH2B 3QC5X 1RFDL 4MJ4A 4UT9H 4AV4A 2NY1D 3PJSB 4J3TA 2HJKA 4U49A 4X7CC 4PW4A 1SJEB 3HAEB 3A67H 1TZHA 5TE7H 4Y1SA 2DIAA 1LDSA 4AVJA 3L7EA 1IO4C 2EEBA 3ZHLA 1RJYA 2XNAB 3SGEI 2WINB 5HPMA 2Q6WA 1CGUA 1A25A 5DQ9B 4ONOA 3P11H 4YDJA 1DO6A 1E67A 1RIHH 4DO6A 1JYVA 4JPSA 5I0ZA 2NZIA 4TV3A 1L3NA 5GHWH 5HI3D 5T5FA 3K2UL 1JIBA 4GBXB 4N2AA 4MHHI 5E0QA 2VOTA 3J2PA 5GJTH 1AJ7H 5JOPD 1H6FA 2P7TB 4F8PA 4L0YA 1RIVL 1I1CA 2AANA 4YX2L 2WZPD 4BFEA 5CZXC 1O6SB 1SMOA 2Z1PA 1J1OL 3S0PA 1QTSA 2HJLA 2JKJA 4F2FA 1PKQB 1R46A 2NT0A 5FW8A 3VFSA 5B8CC 3OMNB 3CJJA 5E2TL 3GMOB 5DK0B 1E5AA 2X4UB 1Q4NX 4UQIM 5L0QB 4WW2B 1WA1X 2EILB 1T20A 1DBML 2P5EB 4IS6B 4D3CH 1Z32X 3JV6B 1RK1A 1R1CA 3C5ZA 2VDOH 5F9WC 4RETB 4F9PA 2IDFA 2X38A 5E6UB 3IDIB 5ANMA 4FLSA 3HZKA 1QLRA 3DMMC 4N0FB 4PP2B 3SPVB 4NZRH 4GO8A 2ENPA 5DFWH 3EGDA 4XWOC 1CLYH 5KN5A 1QP1A 4BSJA 4PG9B 5L88H 5I75C 1YPZA 3I85A 3P69A 4X7SH 3IDYC 5T3XH 1M7DB 4FQQB 4NRXB 4LSVL 2CO6B 2VLKB 3VM5A 1RZ7H 3MV9A 4FXKB 2BHZA 2X2JA 2B14A 5DC2A 3QUHA 1UWEH 4MKMA 4MMXB 4XXWC 3STLB 1DLFL 2MPAH 3SGDH 4HIEA 1MXDA 2EIMB 7FABL 1Z9MA 3F7VA 4L37B 5ABAA 4P5MA 4P4KA 4QR7A 3ESMA 4QI3A 4HVBA 4IGBB 4YQXL 1A5FH 4LIQL 2VLRB 4XX1E 3CLFH 1QR1B 4Z8FL 1L0PA 5KW9L 1W8EA 4XBPB 1TSRA 1PLGL 4OGZA 1T5WA 3PWPA 2Y7MA 3RBGA 4DIXA 1J05B 2FO4B 3NIDF 4HT1H 5DZVA 4OFQA 1ZLDA 4PJGA 2CMRH 5FC9A 1BCIA 1ZVSB 1TMCB 4YNYB 5G4NA 5FKAA 3RIAF 5DMKA 4G8GE 4ZSOA 5DT1H 3MJ8A 2H45A 5C0AD 4LP5A 2V5TA 3OKMA 3L3OC 5EU3B 3TV3H 3AG3B 3INUL 4OVVA 3KYKL 3ZRSA 3TBSB 3BZ4A 4N25A 4JO3H 3IDNA 1RUQL 2WO3B 2H1XA 3CVDA 1J0IA 3JWDL 2DJSA 3MRFB 4KKBC 4NWTL 2KLSA 1I8AA 1YMME 5FX3A 1JAEA 3V5HA 1GTNA 2YQGA 4MJ5A 4B9GA 5FF6A 4U6VH 1AC6A 4HX1B 3WN5B 3BP4A 2Y9RT 4HUNB 3QI9D 4PLKD 5JIDA 4QNPF 3RUGA 4JR9H 4G6JL 5AEAA 5BMFL 2NSQA 1KYOJ 4RVBA 3B2PA 4ZMYA 3TA3D 4PJ8C 2F5BH 1T4KA 2CO4A 3HRPA 3SO5A 3DBSA 3G6DL 2H6PA 5DJAB 2BOCA 3T4YB 2V17L 3OAWA 2OXGA 4JN2A 3VACA 5IVOA 1ODAA 3FRPB 3B56A 3KR3L 4ONGH 2BIQA 4WFEE 3L17A 4HIJB 1G43A 5KZCB 4HWZB 1U30A 4K3EL 4WWOA 5LBGA 4TNFA 1VFBA 5KSBF 1I7ZA 4KK9C 3BZ5A 1RZKL 2OBGA 2QBWA 2YMTA 2ESVA 2I85A 4ES8A 1EEYA 4IJTA 4Q0XH 4NAQA 5PCYA 3MBWB 2XXMB 3QJFB 3L3HB 1U8OB 4LSUH 2VABB 3KWVA 3MUJA 3FU6A 4M7JH 3DO4A 5KUMA 1KYAA 4WHTA 1A02N 5KVDE 5SWZB 5DUPL 3IAGC 3KLHD 1VEMA 5C0FA 1RUKH 3ZYZA 3T1WA 1G7PA 3D0AA 4HIEB 4NKIH 5CR8A 3N2JA 2NY1B 3OXSA 2GPZA 1JG9A 1OLLA 3KWWB 1HINL 4M5ZL 4BCXA 1G4RA 4LSSH 3BWZA 2VERA 2AABL 4YDKL 1WFTA 3I84A 4AKQA 4JLRA 3EO1A 1R3HA 5F3FA 2OYPA 1Q72H 2BC4A 4HMEA 3DV4A 2D8KA 1IJ9A 8PAZA 1F1DA 2QPEB 2VLKD 4AMWA 2Y36L 4F7TA 3B8SA 5IHLB 1MLCA 1QR1A 4LFHD 4MQXD 2NY3D 3UG5A 4IDLA 1U58B 3K5RA 3UJIL 1B88A 4OGAD 4EUPA 5MI0C 1UWXK 1HCFX 2SEBB 4BA0A 2DKMA 1F3DH 3QHZH 2HH0H 2CA4A 3QZOA 2ZUTA 1OF2A 5B4MD 5DMIH 1A3LH 4FHJA 1TZHB 2NYYD 3PHOB 5F7EL 3VQ1C 5H2BA 3CSBA 2CDGA 4Z7NB 3VFUB 4RRPG 2AFNA 3JZYA 1KC5H 3OC5A 3D85B 2AQ1A 1VFMA 1AGFA 3F65A 2V2XA 1CXKA 1MFAL 2M1KA 1A65A 2ZUVA 3MOAH 4N26A 4AEEA 4X8GA 2PWDA 1OK0A 5DJDA 5ILTH 3VDAA 3QQ3A 2O93L 3UAAA 2FJGB 5GGUA 4XCNB 2A74C 2EACA 3IMSA 5E2UL 1BVLB 1DVYA 2LT9A 3BYTA 3NSYA 3S9DB 2C4XA 1Q1JL 2Q8BH 3ZW3A 4PB9H 1XEDA 4P2AA 1IBFA 2WP3O 3EFFB 2P8LB 4ELMA 2A9AA 5C9JA 4FABH 3JWNG 3OKKA 5H4YA 5IB1A 4WDIA 4ACTA 4JQVC 3QARA 3HB3D 3ULSB 3O8XA 2B1OA 1ZRUA 4X7DC 2HG5B 1AS8A 4OLZL 2R0KL 1BFSA 2H0JA 1UENA 3G6JA 4U7SA 1P1VA 5BZWB 1R17A 2NY5H 1VAHA 3QEHA 4ALAH 3IFOB 1AZCA 4ZAKD 3AGVA 3CVHL 1DVUA 1OTTC 4FF9A 5T33L 3NTCH 3DSNB 5E9AA 5F6HI 5IJCC 1M71A 4AE0A 3C09B 4NPYB 4YX2H 2MTAA 2HPOA 5KVGH 3VSVA 3L3IA 1KIRA 3FQ1A 1IC1A 2IV8A 5DRWA 1M56B 3B9KA 4UF7C 2DQIL 5DSCB 3EUUA 1DR9A 2VDRH 4ZFOL 2WBJC 3OHXA 2QZ5A 2YD0A 2N7SA 3WAKA 5D7IB 2VLMD 5E2JA 5FYKE 4DN3H 2P24A 5F6IB 1FH2A 2YJQA 5CLYA 1KCRL 3E7JA 5E4OA 4M5ZH 1CXFA 4N2FA 1LE9A 2JTYA 3KGUA 5LG1A 2QR0B 3O81A 1Q9WA 2D7NA 2AJVL 2ZX8A 3ARBC 1YEFH 5E9DB 2PP7A 4Q52A 5KN5B 4IBYA 2RCSH 4OZHB 5KVDL 5C07D 3ZTEA 4AG4H 1K5WA 4KKLC 1I3GL 1O9WA 3J07A 5IGXL 3EG9A 2EE0A 4OLYH 4BFGA 5ESAA 2QQLH 2WWMC 3N42B 5I15L 3KCPB 3MNVA 4PGDA 3RHWK 5DUBA 1X4YA 3TO4A 3UTZA 1PVHA 1F6LL 3CFJB 4J2XA 4A7UA 7CGTA 4MX7A 4F2MB 2W95A 1HHIB 4ZD3L 1NSNH 3PGDB 1AR1B 2GSGA 1SF5A 5LO7A 1S6NA 2VKXA 5E8DL 3WV0A 2KKQA 4R7VA 4HZAA 3B9EA 1T2JA 3PWLA 1RKRA 4JN1H 5KVEH 2F7QA 5CCKH 1SLVA 2DMKA 1BHGA 5F9JB 3U6RA 1O9VA 3FU9A 2GTWB 4ENZA 1KF9B 2E9IA 4Z7IA 4JREB 1OTSC 2IQAA 2EE2A 2QADB 3DI3B 4OZHA 4UV4H 1E42A 5ICUA 5IVXF 4F8TA 3MX0B 2C9XA 3HG1E 2ZUWA 3RUGB 4TRPL 4ZPVA 3FZUC 3Q43A 1GZQA 3BHBB 4JQIH 4FFZL 5IVXA 1K3ZA 2VWEC 4ZFOB 1KXHA 4UINL 3VB8A 1A4KB 1OAYH 4OGQC 3VFGL 3GHEL 1ETB1 3ULVH 2YEZB 3TBYB 4J1UB 4LOUD 1ZT1A 2PCYA 3CU1A 4AYMC 7PCYA 1KEGL 4PG2C 3LRHA 2X9WA 2PXYC 3LN9A 2Z7UA 3GMMA 1QEWA 2O5XH 4JE0A 1DTUA 5F0MB 5BOJA 5C09B 2H3NB 2DQHH 5HHPB 4GIOA 1SJHB 2CG9X 2EZ0D 4I8DA 4JZJA 1AFVL 4P06A 4WJKB 4ZMTA 4FZ8H 1UZ6F 2A9BA 2BVQB 4ZYKA 1INDL 5D5MF 4F80A 2RD0A 4V1DA 2DYPD 2DYSB 4RFEB 5BV7H 1P4BH 1YEDA 2F9BT 4XP9L 3WNNA 2VXVL 1RUPL 1U8PA 4OZIA 1JGVL 2P26A 2JJTA 5HYQA 3U6XA 3FYIB 3DIVA 3HPLB 3DTXA 4U3XA 3ILPB 4W9EC 4F91B 2VABA 3FO1B 2H1PH 3QJXA 3L3KA 1S9KC 4JL1A 4HGKC 2X70A 4OD1L 5EC1A 4I3RH 5I5JA 4E9VA 3VD0A 3PWPD 1XGYH 3AAZA 3DK0A 2DD8H 5AKVA 3H2PA 4Z3FA 4OF5A 4YWGL 4XPFL 5HXMA 4XXCC 3VXSD 1T1ZB 2VLRE 1YO4A 5EUOF 4JGNA 2GQHA 5KVFH 3R4RA 3T0DA 1YC8A 1LE9B 4X6BA 4G3YH 3D12B 5DWUH 3W11D 1YSOA 5FLVA 4YHZH 3HZVB 5GRYA 1QSFD 4NQDD 4ADIA 1ND0A 4KAQL 2ZX7A 3N6YA 3QXAB 1JGEB 1BD2D 2WVUA 1GOHA 1L0YA 4PRPA 3LPPA 3QUYC 3VD2A 2BP8B 4LASH 1FNSH 2BNRD 1QSFA 4IMKA 4NQDA 5FB8A 4X5WA 3KPOB 4YIQA 1LGVA 1Q0XH 4G8GD 3UYPB 2X09A 2LLGA 4M48H 1AKJA 5L88L 3RKDD 1G7LB 3VFPB 4JRYD 4GAAA 2VDOB 3MUGB 2YAPA 2CUMA 1RSYA 3HNTL 4Z9KB 5LBSA 5I1EH 1CGYA 1GCFA 3P30H 2PF6A 2Q8AL 4GAGH 2QJDA 5FK9A 2OMNA 1IBYA 1KCSH 4OZHE 2J56A 4XNMB 5I74B 1UA3A 3RX7A 1BBDH 4DOHB 4OT1H 5GRVL 4FKHA 2OP4L 2XWTA 3BW9A 3SPCA 2GABA 4B9IA 3NJNA 4NZTH 1ZMYA 2GSGB 2OULB 4XOEA 2NY6C 1ZKAA 4DN3L 1CLZL 2J72A 2QQKH 3EYFA 1JF1A 5DRZA 2WAQA 3ZRFC 3IDJA 4TPRH 1I8IA 1LP9B 5FYLH 1KDJA 2Y22A 4FQLL 2MHAB 1MWAB 4A2FA 1E8WA 4QXGL 3FSOA 2OSLA 3WO3B 4ZMQA 3MMEB 2OZNA 5LCVA 1E6OL 5I8CA 4NZFA 1RIHL 3LQAH 3GEWB 3SPJA 3HCVA 3MKKA 4YFDB 5T33H 2EAEA 1PZSA 5FYKL 3SOBL 5D6DA 2WUCH 4ERSH 4TLUA 3CAFA 4TTDC 5CLTA 3ZL4L 2JIXA 4I9WE 2XY1A 4HUCA 4XNUH 4GG6F 4ZUVA 2HP4A 2RFXB 1GC1H 3OZ9H 4N0RA 2Z4QB 3RDJA 3QCVH 4ZO7A 4PV9B 1MNNA 3BSGA 3NUKA 3UEQA 4QPEA 3NFPA 3N44F 3P3TA 3PV6B 2E74C 1KGCE 2DJUA 4G6FD 3GTVA 4R5VA 3SYOA 3Q9PA 2WYHA 5HYIA 4F58H 4W9IC 4PWHA 2Y7LA 4PRIE 2OTPA 1AHWC 2GK0A 3FUIA 4PRHD 3ZDXB 2V2WA 4L3ED 3VX1A 2EXYC 2BVYA 3SKJL 2VIRA 4X6CB 3TT1L 1SEBA 5B38B 5DEZA 1FP5A 1P5VB 3C5SA 1NKOA 2A6IB 2WMPB 3QIUD 4FOMA 1JWMA 3T0AA 3ILQD 4NT6B 4GS7B 4D2NA 5HYSG 4C56B 3JTSA 4JZOA 4CSTA 5EZLA 5A1AA 5IBUG 3RGHA 1GZPA 4JRXB 4BKTC 4Y16B 4ZOBA 1QNIA 4BQ8A 1G7QA 5IW6B 4UUJA 3STZA 2QLYA 5E8EA 4K3EH 3UJIH 3NJXA 6TAAA 5GRWA 1JD7A 3VXNA 4RRPM 4EI5D 3PP4H 2XQYK 3F85A 1CFNB 4NBZB 3F00A 1M9SA 3FBKA 4M7KH 4PJFE 3KBHE 4CW1A 4YBQD 1X44A 1ZJBA 3HR5A 1J5DA 4PJ9A 2VH5H 4C83A 1GL4B 1BOGA 4M62H 2H7WA 4ELME 4J3OF 2OV0A 5GSVA 1U95A 5EBGA 1JK8B 4CKQA 2CK2A 1OSZA 5DC0A 1E9QA 3RWFB 3GC3A 3TNMA 2ZP9A 1NMAL 5F7KC 3SBQA 3QUMB 5DDHB 1UM4H 3U4BL 3QYNA 4LQFL 3TPUB 1G4MA 5EO0B 2BP0B 1DDHB 3SPVA 3MNDA 1ZT4B 4FFYA 4X6DE 5I6LA 2PPFA 3KPNB 2YN3A 4L48A 3ZR5A 3TCXA 2FYYA 4GKZB 1JS4A 2JB5L 3CVHA 3VXRA 5C92A 2NXZB 3WN5C 3PY9A 4EAEA 2FATH 1UGNA 3LDBB 5DK3A 1WAAE 1RZ8B 4PIRF 1L3WA 4CNIA 5D1ZD 2JXMA 3QAZC 3H55A 1EUTA 3ARGD 3OZLA 1BG9A 5HGBA 3QWQB 4BCYA 4PCKA 1KY6A 1LO3L 4GP5B 1G7IA 3OMAB 1FAIH 2IH3A 2YFNA 4FHBD 3NIGB 3TN0B 4KNSA 1QQDA 4F8NA 1RIUH 5DGQA 3QZWB 1P7QB 4GMSL 3SDXE 4CC4C 1QSEE 1W9XA 4NQVB 2W59A 5JW4M 1AIZA 1MJ7L 1UJ3A 3QW9A 1L9PA 5I6OA 3HN8A 1OZTG 3PFQA 1MRDH 5KSVB 2WB1A 4XTRC 1Z5LB 4F3FB 2WBWB 5J6GA 1DBAH 4QRTB 3IMBA 3QFDA 4GBXC 3W0WD 3CLFL 3WUWA 3MJGX 1FFPB 1CG9A 1BBJB 1GC1C 1PZCA 1ZHBA 2CRMA 4JM4L 3LEYH 3VXUD 3L95B 2TRYA 1AQHA 3C8KB 3GZPA 2AXFB 2GG1A 4IQHA 5KVFL 5DJYB 3QUZC 2QVKA 1SUJA 1A9EA 1BQSA 4X8CA 1UASA 1YYCA 3EH1A 3SBPA 5I5RA 4OZ4A 4X6CA 2X70B 3AG2B 4ZTPH 4NN6C 3MLXL 1AO7B 3SKMB 1AY1H 1EEZB 3V4PL 2GUOA 4P23B 5I0DA 3QJRB 4G1MA 2OR9H 1TZ8A 3NSFA 2L7UA 2X89D 1DSYA 3IAQA 2VMEA 2WWNA 3MRRA 5J06A 1N6QH 5DD1H 3KM2A 1YECH 1JCVA 1C08A 4RFEA 5I75B 1YA5A 2EDDA 4R3SA 5AZEH 3D9AL 5HDOA 4HSQA 5FW6A 4UAHA 5E00A 1P53A 3KLKA 2CLRA 3MU3A 3WUZA 5K9QI 2JJSC 5HYEA 1X7QB 5IVNA 2F8XC 2DLEA 4NXKA 5GPRA 4LF3A 4RZCA 1HZHH 1A7OL 3IPEA 4KJYA 3RFZA 1I8LC 1UWYA 1SYVB 5C7XH 2MCG1 1LO4H 4H1LH 3VGFA 1EHKB 1UM5H 1WA2X 1DUZA 4Z7UE 2XX1A 1LEIB 2XN1A 4L1LA 2BWIA 4XC1L 4JFOB 5AOIA 4EN3A 3PE9A 4K9EL 4LLDB 1DSWA 4MBOA 3IN0A 3QJFA 4M1DL 2ADJA 2ZXBA 4L3CB 3DTUB 2RQ8A 2X41A 4HS3A 5DZOA 2ZXQA 4AQ1C 3LKNB 1MZZA 1JRHL 3I9GH 4W9CC 1A64A 3EJYD 2ICWA 4PS3A 4WJ5B 4S2SA 1IAOB 4G6AC 2J2ZA 1FYHB 2UV3A 4OJAA 4Z23A 1DVQA 1U2YA 4HK3N 1M6OB 3SKOA 4P5TD 3HMXL 2ENSA 1IC7L 2X4TA 3QJTB 5F7DB 2APTA 4YE4L 3IF1B 3Q2VA 4JFSA 5D6CB 2CDFB 2XBDA 3DMMB 3DXAD 3QIWB 2NDGA 4JJHA 3HPJB 4KTEH 5CP3H 2HN7B 1AOHA 1J5HA 5L2JB 5JMOC 4JZNB 4XBEL 4XE0A 4TSCL 1AXTH 3P0YH 1NEZG 4FYTA 3RQ3A 3VUAA 1OOAA 4GW5A 4G8EA 3ZE0F 1GY1A 4Y5VB 7FABH 1NGZA 3K2IA 2DICA 4LHUA 1JZGA 1TCMA 3P4OA 2BDNL 1QBBA 4FYSA 3BAEH 5EPMB 1X5LA 2H2PD 4PREB 3DNKA 2UYLA 4J3OC 5HGAA 5J5EA 2BSTB 5FYJE 4ZW7A 4BFNA 4Y4KC 1KJVA 3TA3A 1QFPA 2WLHA 4PJDA 3T8XB 5DURB 3ZKQD 3QDJB 1KGJA 2ZCLL 3GSRA 4HUXA 4FQXD 4XE5B 5KYUB 2RA1A 5FUZL 5F0LB 3WHXB 1VENA 4V2CB 3K6DA 3SE8L 4Q14A 2DTML 3CTTA 5CJ5A 4WI4A 2YIHA 3HI1B 4HSAC 2VQ4A 4FNSA 4ZUUA 4BFJA 3NRFA 4Y0GA 4DZBA 5F7WC 1FE8H 1DVFC 3D50A 5T1KB 1NCWL 4HJEA 2LHAA 4B9JA 2CXGA 3S8WA 1ED3B 3B6SB 1S9XB 3S4SG 1OGPA 1P7QD 3KLLA 2HT4C 2FIKB 1G7HB 1UB5A 2FNBA 1T5WB 4YVUA 4YHMH 5F96L 1R9FA 3VH8B 5CJQL 4DPBX 4WGVB 4LSQH 2DLIA 3B43A 4PRHB 3I6GA 5IOKA 3ARGB 5FYLL 1BXXA 1YMMD 1AC0A 1FNEB 1GJUA 1Z1WA 3H1ZA 5LJYH 3F6IA 5KANI 1TT6A 5F89B 4YK4B 3C6EA 3OZKA 5M95B 5DQ9A 3WTTA 2BJMH 1NBCA 3KVDD 4NJAH 1DQQA 2WXGA 3KPQB 4OCWL 1N67A 1H3VA 2ZCHH 4A2GA 4PB9L 3GBNL 4D0BA 1UM6L 2KUTA 3JWDC 2VDLB 3VWKB 2HLAB 5C7ZA 2H3NA 3S3PA 1AXSB 2HVKB 4XXDB 4PVBA 4ZUTA 2FQFA 5KS9F 3DGGA 3QZLA 4YR6A 1CPUA 3E6HA 4G1EB 4GW4B 2ARJA 4KGJA 5AAWC 1OQXA 1G1OA 1SBBA 5LGJB 3V9CA 1HSAA 1Q1JH 4ZAKC 2XV2A 2X4OA 4AJVA 5B38G 3MBXH 4KO5A 1G9NC 5H37A 1BVKA 3QNXA 5EBWB 3KPRA 3UX9B 2P5EA 1I7TB 2ED8A 4PJCB 1RLBA 2BH0A 4NC1E 4EI5B 4XMZA 2DQJL 4KKCD 3MRBA 4LSRL 2R59A 1WBXB 5J57B 5FOBA 3Q8AA 4QTFA 3WJJC 5EUKB 4BZ2L 4FD0A 4NQCB 3W9DB 5E6ZA 4V1DB 3UTSB 4OV5B 1PD1A 2Z8RA 3KM1A 4G3YL 4HWEL 1KPRA 1L4IA 3WIIL 5BS0B 1KTJA 5L2JA 5DHVB 2ED7A 1U9KA 1S7WA 4HS8L 2XVLA 1FF5A 3LSOA 4N85A 2W65A 3FZUD 2A9CA 3ZLQC 2O4EA 4X4YB 4YWGH 4N5UA 3SN6N 1MFCH 3SO3C 4G7QB 4ODTL 3FTWA 2NUPB 5F7UA 4CN1A 5FECB 1KT2A 2L7EA 5JDJA 2F61A 2BIHA 2WZPA 5HHXH 3WO4B 4Z7WE 1NGXA 3SDDB 3G04A 3B7TA 4KHTH 1WFNA 5IHUH 2D0GA 5EN2A 4MNQB 4DTGL 3O4LD 3BIAX 3QPXL 4HFUH 1U8NA 2WXMA 4RDQG 1XCQA 1RK7A 4X9FA 3HBPA 4AYFA 1E28B 5ICZB 1MI5D 4DSYA 3RJDA 2BIIA 3MV8A 3O6KH 3EUDA 2CBOA 3GUTA 2AV7B 3RZCA 4RFOH 5IEKA 3ABGA 5HD8D 3NJIA 4IKNA 4P57B 4CN4A 5KSVA 2WQSA 3GSQB 2AI0L 3ZTNL 2HG0A 4JW3A 3LH2H 2KERA 1CDJA 1QATA 1A4AA 3T8XA 1W72B 1WC7B 1PFCA 4DP7X 1V54B 2PW1A 2VB5A 2G4GA 5A6LA 1G0DA 4JVUA 3C60D 3MJ8B 2XRAH 5IM7B 4QHKI 3TX4A 1H5BB 1IM3A 5E4EB 4UOQA 4LSTH 4MB5A 1S3KH 3MVSA 1NCCL 3E3QE 4MJ6A 4R96B 4Y4KA 3QDMB 1PG7L 1SEQL 3FMGH 1CI5A 5EZOL 4XP5H 2JJSA 3BSZH 3M1BA 1ZE3H 3BW9B 3NAAL 3U46B 1IM9B 3SD5A 3RX8A 4QRPE 4BZ2A 4N2EA 2KPNA 5C1MB 2B08A 1SY6L 4X5RA 3P0VL 3EH2A 3HI6H 5ETUA 1N59B 2L4OA 1OXYA 2AEOA 3GMRB 1PAMA 3QNZB 2QMKA 4PGBA 5DVLA 4HLZG 5IB3B 1FAIL 5E70A 4LCVA 4LLWA 5E08L 3NK4A 1XCTA 2GHZA 2PYED 3IFNL 3PXHA 1P84K 2VLJB 4AUJA 5C09A 1MRFH 2EEFA 2K7QA 4WQOA 1S7RB 5FA4B 4WW2F 1F8TL 3WJLA 1ICTA 1O0VA 3WNJA 3QWRA 4OCNC 1NL0L 1NFAA 2K9UA 4AVKA 5B21A 3PS6A 1RUPH 4QHUB 2HVKA 2F54D 1KIUA 5E95B 4QT5B 4K7PH 5ELIA 2XQBH 3D85A 5AKTA 4MAYA 1YEEL 1U2HA 2WQUA 2OMZB 4UNIA 4OGAC 2A6JB 15C8L 1YPZB 2AI0H 3ZTNH 2AZAA 5GGUB 5AOJA 4MQ7A 3FCBA 5EU5B 1LEIA 4HUVA 1U3HD 1X9UA 5I66A 3QUKA 4R8WL 1IC0A 3O3BB 1BD2B 4J3SA 3QHFL 3MRKB 4PSRA 3OLEA 4LIQE 4UAOC 3NPZB 1HL5A 1HSAB 4CDGC 3F05A 4D8OA 5J1AB 2EO9A 3JTSB 1A7BA 4JZOB 4Z7UB 3RTQC 1ACZA 5TK2A 4NUGH 3KNBA 1YUKB 2V4LA 3QCTH 3ARVA 5HYJD 4QRRA 5JIPA 2RHEA 1OPGL 4RAHA 1UKSA 3WNOA 4XZ4A 4ZS7H 4MJIE 1MREH 1UXSB 2YRZA 3JVFC 3GXDA 1QO3B 2A83A 5EO9A 3WELA 1HL8A 4HUUA 4PJBE 2EADA 5JLZB 2BCMA 3O4LE 4FTVD 3V79C 3KLAB 1NBQA 4JFOA 1IEBB 3N41B 3RKDC 2HVJA 3T0BA 4JLRB 1QAWA 5DS1A 1XAKA 2AQRA 4L1BA 1KCBA 3K6NA 5E8DH 4KJQD 1TENA 2IANE 2R2HA 3HZYB 5EEVA 3MLSL 1QFWL 3H7BA 5IHZA 2JJWA 5F0PB 1XCQB 2A9MH 2XVKA 4ZX3A 3NESA 1EDHA 2W0FB 3APMA 3ZY7A 4OBSA 2W9DL 1YVLA 4FCHA 4QKTA 4C47A 1EXUA 1K8DB 1NLBL 3SOTA 4A67A 1LO5A 4RZKA 1RZIA 2JI2A 3QDGB 35C8H 4A2EA 3O2DH 2FLBT 1PD6A 4OLYL 2R4RL 2ZCKH 4FQXB 2EC9T 2QVTA 4JY5H 1NIDA 1A6ZB 4HALA 3VWJA 1PW3A 4XMLH 1K3IA 3BT2L 1QWUA 2NTSP 4P2QA 1O5DT 1IC4L 5FLUA 2WXIA 4BFOA 2G75A 1G7IB 1U8HB 3LKOA 4XN8A 3FQRB 4PV8A 3K71B 3NGBC 2JB5H 3WL9B 4I0CC 4KKAD 2D7QA 4GXVH 5MENA 3M8OL 1E6OH 2DLTA 4MA7L 2BVTA 1NCTA 1CYXA 3ZE2E 2J43A 2LFGA 4K07A 2H2SD 3QHZL 5DJXB 1YJDL 3UPAA 3MRPB 4HIJA 5L8KB 2DQEH 4Z95L 5C6WH 5GZOC 4UQBA 3U4EB 5J11C 2GSIA 1KFGA 1IU1A 1J8SA 1BBJA 3FT2B 5MEQB 2B0SL 5BW7C 4A39A 3FOMB 5I71B 4FNRA 1NUNB 4L4TB 2AK4B 3WMQA 1AR1D 4BH8B 1D6EA 3PAZA 3CZEA 4RX4D 2R29H 1KGWA 2YGVA 2Y2TA 1T80A 2YMXH 4UU9A 3L45A 3MRHA 4IBUA 3T4AC 4YE0A 3TEZA 3PNWB 4XVSL 3QHTC 3SE8H 4AE1A 3DLQR 5AW5B 1IE5A 2NMSA 3HE7D 4HK3J 2IPUK 2NXYB 4PHXA 6PAZA 3QZBA 3NCJH 3O3EB 4OD2B 3EOAB 4Y4HB 2KMWA 4YOKA 3ESUF 2KQMA 5DRWB 2NW2B 4LU5H 1Z3GL 2WZ5A 2A4CA 4B7LA 4GKOA 4POZC 5EF3A 3AREB 3OV6A 1KWKA 4M61B 1ID5I 3FUNA 4LSUL 2HFGL 4N2DA 4CILA 3L3DB 3PWJA 1P5UA 2ZX5A 4OLVH 5DO2C 5F9DC 3S88L 2UZIH 4AENA 2OSYA 3CDGB 1CDHA 1X3DA 5EO0A 4KY2A 2VZ3A 5JOPE 1GZHA 3MYZA 3NCMA 2Y1VA 5AENA 2AVGA 1IAOA 1EHLL 3FH5A 1AGBB 1URZA 3S37X 5I73B 2ETWA 2BNQE 1FO0H 1I7RA 1YNKL 1FZJB 2J5WA 5E8PB 4YHML 1ACCA 1MZYA 3LIZL 4H0HB 1TVHB 4G9DB 1UVQB 3OR6B 2YGPA 3UL4A 2KT6A 3IJ8A 3LN5A 1FNAA 2F53D 2ITDB 2GBAA 2WVSA 3LRSB 4N0YL 3V0FA 1DUZB 4KDVA 3HNSH 1W8NA 3QFJD 4R7LA 2HXAA 3X17A 1NBYB 3QHFH 4AV0A 1XB6A 3L3HA 4FJ6A 4RGOH 5K59F 4XO9A 1MCDA 4IMKC 1ASOA 4IS6A 4JFXB 4PREA 3J8F7 3Q2CA 1CK0L 5DRXA 1JZ6A 5MENE 4JQIA 1G9ML 1LEKB 1MEXH 2GTZA 4PBWD 5FGSA 4OCMC 3OQRA 3O0LA 3SPHA 1CGVA 1MFNA 3O6LH 3FCGA 3QUGA 1UA6H 1XD1A 1E4XL 2IQAB 1SXAA 2A77L 3GS4A 3TC9A 5CKGA 5GSRB 3DURB 4PJHB 3WJLC 4PJEF 3SE4A 1ZS8B 2FT6A 3M88A 3S7GA 2CDFA 3DMMA 4TUJA 4PMFA 3W38A 1U93A 2VRKA 4IDJL 5DVMA 3F7VB 2WD0A 2AQNA 3MRIA 3BRFA 3P0YL 4XAKE 3UAFA 3T2QA 3AWGA 3N3EA 1AZUA 2DQCL 4KQ3L 2IAMC 2Q8AH 3TYFB 2VN7A 5GS3A 4OZHF 3HKZA 4Y9BA 7TAAA 1PIGA 4ODWA 1RK0A 4W9ZA 2GIMA 4WWKA 4P9HH 5DLML 4A66A 1UHVA 3DHPA 4GPVA 3QYMA 1QI5A 2DQGL 3OJDB 3CBRA 1LDPH 3FUFA 2BWQA 3FTUA 1KB5H 1BQHA 3KGRA 4H8UA 4IKJA 4UZGA 5HHVH 4JKPL 3T65B 4LCUA 3WIHH 1UJTA 1EAJA 2QPUA 1WT5A 3O11B 1RJYB 2XNAA 3AS0A 2ZXWB 3EYVA 1MJ8H 4NQCE 4P4KD 4P05A 1U8JB 2X12A 1NA8A 3SIKA 5C08B 3VGGA 4YDVB 3OKMB 5EU3A 3PWUA 4WU5B 4DGYH 3M1BB 4F8LA 2R8SH 4ZUWA 4BHUI 3GGWB 1TZAA 3AUWB 5HHMB 2R39A 1U8IB 4JFFD 1KBPA 1NCOA 3IJSB 3MACH 3Q6GH 1D7BA 3MFFA 4AG4L 3BX7C 2MIZA 1HZLA 3QIUA 4M8RA 3CDZA 4YSSA 4P4RB 1D5MB 1ETJA 1OW0C 1M3IA 1KGYE 4N3TA 3K6SB 1LO0H 1HESA 3BPCB 4MLIA 2M2DA 4NN7C 1R6VA 3FBQA 4XN1A 5DI8B 5JHMA 4HU8A 4QHLA 1W2KT 1FVDA 4N0CC 4TNWF 1EDQA 2NNAA 2Y1AA 4GUQA 1HKFA 4NQCA 5MERB 2WLZA 3UYPA 4EIBA 4TS6A 4YIQB 1GGIL 1B4TA 2PTTB 5IOPA 4HV8B 5AB0A 3VGBA 2PUQT 4XHJC 1R5VA 3QQNA 3VW3L 3EFOA 4UILH 1I9EA 1PZ5B 1UKTA 4FTDA 4WO4D 3UTTD 2WLJA 4YMPA 4AYBA 4QXWA 1F6FB 3ZL2A 3QNYB 2GJPA 4Y2OA 3V10A 2AK1L 4MHHG 5I9QC 4NZDA 5D1ZB 3BGFB 1LEGA 3ETSA 1HXMA 5BXFB 1KJ2B 3U0TB 5LQBL 1QR4A 3L5HA 5DR5L 3MCG1 3P2BA 3ULUC 1Y6NR 1WGVA 5B3NA 3EYFB 1N4XL 5C0CE 5JPMB 3TIEB 5T1DH 3MRBB 4UT9L 1SJXA 3L5IA 1JTTA 3MBED 4GT0A 5T3XL 3UBXB 4L18A 2WLMA 2XFGB 1TEGA 1TJHL 3SJVA 1NGXB 1QI3A 4GG6B 3N1QC 4K71B 1GPOL 2VDNH 1FVEA 1D5ZA 5DQJA 3HCVB 2WLLB 4JPIA 1FNHA 1OSYA 1FIGH 1YYLL 5EZIL 2EE9A 4LCCC 1EH9A 1KNOA 5CSGA 1MFMA 3RY5A 3VFTA 2OSWA 5IMOA 4X5WB 3UACA 3IE4A 1FFOB 4FEIA 1AZBA 1V3LA 3LH8A 5F3BB 2AV1B 1DVFA 3GKWL 1Q9OA 1EHNA 1T04B 3EH4B 4BZ1L 3P3YA 1ADQA 1R19A 3BKMH 3A0OA 4K3JL 4MB1A 2H5UA 1SN0A 3X11B 4WW2C 2XV0A 4KKBD 2KC0A 3RGVD 4G43B 4YHIB 2ALWA 4JHVA 4BD4A 3F7YB 4MSWB 4RA3A 2BY0A 5I26A 5F88B 2XZCH 1JNNH 4UBDD 2CBMA 1OAKH 1R34A 4N2HA 5JOFA 5I1JH 1IGJA 5E5MA 3WOVA 4IBZA 2EKSB 1FNLA 4NQQA 3DSFH 3RL2B 3DROA 3IGLA 5HHXL 3MGOB 1DLHB 2NY4C 5FGBC 1OTSD 2XI9A 1PEZA 4DERA 4DUWA 3ABZA 4XP1H 2FHFA 1DQDL 3VRIA 2WNGA 3A6CH 3VGAC 1JHKH 4JCMA 4KXDA 1OT4A 4ABUA 4LHUD 4HEPG 1NWOA 3DA0A 2OYKA 2CALA 1H15B 1UD4A 3KVPA 4MD5A 4FFVD 1NC4D 4FFWC 3WIAA 3K6SA 4QF1A 4U2YA 4IGBC 4ZAKA 1FIEA 2W07A 1Q0YL 2YBRB 4XPAL 1X5FA 3VE0B 3ELAT 2VN6A 4GXFA 1ZA6