1W15A

Rat synaptotagmin 4 c2b domain in the presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
132
Chain Sequence
b'RGELLVSLCYQSTTNTLTVVVLKARHLPLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN IV
publication title Structural Basis for the Evolutionary Inactivation of Ca2+ Binding to Synaptotagmin 4
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 30
structure length 132
sequence length 138
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1w15A00
1E90A 2QZQA 4TUUA 4FADA 2Y3AA 4F91B 1E8WA 3PREA 3FDWA 3L4CA 3QJZA 4JPSA 3PRZA 4TS6A 4XX5A 3KWUA 4F1SA 1BYNA 3GPEA 3QR0A 3L17A 4LCVA 3TWYA 3PYCA 3TL5A 4XZ4A 4BGDA 1TJXA 4WWPA 4L1BA 2D8KA 1TJMA 4MJJA 2WXJA 3KWTA 2CM5A 3N5AA 5KJ7E 3MJWA 3IBEA 3L13A 4Y1TA 5CCGE 4GB9A 1DJIA 4LT7A 4NPJA 4WEEA 4GNKB 1GMIA 4KZ0A 1K5WA 2Q3XA 2YOAA 2FK9A 5JHBA 3IM1A 3ZW3A 2CHZA 1CJYA 5CCHE 2LHAA 1UOWA 3P2BA 3R7QA 2WXLA 3L54A 4ANVA 3OAWA 4DNLA 2RD0A 4DK5A 3L9BA 1DJGA 4ANXA 4QJ4B 2WXHA 4IHBA 3FBKA 2CHDA 4EZKA 3APDA 3F05A 3M7FB 1A25A 2CHXA 2WXOA 3F01A 4QAMB 4WWOA 2WXKA 4PS7A 2UZPA 3HIZA 3OHMB 4LDCA 4WAFA 1UGKA 2WXPA 1QASA 2Z0UA 2ZKMX 5JHAA 3ML9A 2WXFA 2CM6A 1DSYA 1RSYA 4ICXA 1DJYA 3S2AA 3QAQA 4V11A 2NSQA 1BCIA 4F93B 3QR1A 1YRKA 2R83A 2YRBA 4XE0A 4BFRA 4OVUA 4TV3A 4NP9A 2WXMA 3SD5A 2A5UA 4ANUA 2ENJA 2WXRA 4F92B 4HVBA 2K3HA 2K8MA 3B7YA 2WXGA 3F04A 1RLWA 2DMHA 2ENPA 4FLHA 2NCEA 5EDSA 4FULA 2JQZA 1E7UA 3PS6A 1WFMA 3ML8A 1W15A 4QJ3B 4PS3A 2ISDA 1DQVA 2DMGA 3QARA 4FA6A 1W16A 4OVVA 3W56A 5T8IA 1DJWA 2A4ZA 2CJSA 2NQ3A 3APCA 4URKA 3NZUA 5H4ZA 4L1LA 3ENEA 3TJPA 5CCJA 2KI6A 3L08A 3QK0A 2K4AA 2FJUB 3JZYA 1QATA 3APFA 3NSJA 4ICWA 4L23A 3RPBA 3NZSA 4PS8A 5G2NA 3CSFA 4FHKA 4ANWA 4WWNA 4FJZA 2WXIA 4A55A 3CSTA 3HHMA 2BWQA 4IQHA 4G11A 2Q0ZX 4HLEA 2WXQA 4QJ5B 4AJWA 2B3RA 2ENQA 3ZIMA 3F00A 4EZLA 1HE8A 1E8XA 5H4YA 3DBSA 4L2YA 4NS0A 2X38A 4J6IA 1WFJA 5G55A 1E8YA 1V27A 2QZ5A 3T8MA 1DJXA 3HN8A 2V4LA 1UOVA 3LJ3A 2N1TE 4Y1SA 3R7RA 2CJTA 1DJHA 4FJYA 4AOFA 1RH8A 4KZCA 3RDJA 4FHJA 2EP6A 1DJZA 3W57A 2K45A 2WXNA 3ZVVA 2CHWA 1E7VA 3DPDA 3L16A 4KITB 4EZJA 3PFQA 1BDYA 1E8ZA 4NPKA
chains in the Genus database with same CATH superfamily
3BGFC 1T0PB 4PI0A 4Z3HA 4OCWL 4UT6A 3J2PA 4Y19A 5EMYA 3UBXB 3C2AH 3FSAA 2WZAA 3EFOA 5GGTH 3W81A 1FN4B 3QR0A 4HBCH 3A4FA 3ATEA 3MV7B 2FB4L 1N2RB 3LS4H 3EOBB 4V2BA 3ZSSA 5FFGA 1EDYA 3ZUNC 5AG9A 3DV4A 5KSBF 1S78C 3ZKNC 4DESA 4ZO8A 5E9DE 4FFWD 3KXFE 5CEYB 4LT7A 1AZNA 2GSIA 3ZKSD 1IQDA 4OKVA 3MFFB 3O9WD 3EF7A 3VB9A 3JT0A 1LMKA 1JHLL 3ZHNA 2HFEA 3RTQA 4BKLB 3S8GB 5C0JB 1IB5A 1L9RA 2ZAHA 3FAXA 3RL1B 2VXSH 4OCMC 4B9PA 4I9XA 4KOBA 2FVNA 1BVZA 2BFGA 2DM4A 4QAMB 4LASH 4X5PA 1KJMA 2DEXX 4FXLA 3CFIC 1GHFH 3QHZH 5I1EH 3IXTA 5FYJH 3DK2A 1IZJA 1S7SB 1JFQL 3GJEB 3DJZA 4J2QA 5L7XH 4NJAL 3K0WA 3QJFA 1XIWD 4PP2A 2VXQA 4ZO9A 3GZPA 1K4DA 3S5LA 4HWEH 2PXYA 5LAPA 2FJFB 4MQXD 3EYUH 4FQLL 4JY4A 4MKMA 3GGWB 5CEXB 2WGXA 4HF5L 3C6SB 5E1GA 1S3KL 3LNHA 1QRNB 3CAFA 3FQNB 2GW5A 3PHOB 4PJBA 5DA4A 1Q9WB 1WC7A 1MHEB 4LVEA 4A7GA 1XGPB 3CN3A 3B43A 1URZA 3SEPA 1G7PA 4AIEA 2PO6C 3T3MF 5FF6B 2EDRA 2W59A 4WKXA 5IFHL 5JOPE 1CE1L 1NSNH 1NC2B 2ORBL 3U9UA 1JNHB 2D3NA 3N41F 4DKDC 5BUGA 4ODSH 3ROLB 2WB1A 3MOQA 2IVFC 2WINB 2E76C 3S8WA 3NSYA 5ICUA 2NUPB 3PDDA 2V7NA 2DIBA 4RISH 5MP6H 3LKOA 3TYGL 1FRGH 2OXGA 4E0RB 1OAJA 3F7YB 1NMAH 4NGHL 3QJRB 3VFNA 4LPXA 4W6XB 5I6MA 3TBVB 1ODUA 4ZMNA 4QWWC 2VN6A 3QZLA 2G0KA 2XZZA 2QQLH 4GKOA 4NO0D 2O5XL 1QG3A 2WP3O 2IBBA 3HZVA 4W4OC 3FONB 3LKRA 1R3IL 1L9TA 1PZUB 1ASOA 2W65B 3DX6A 2AVFA 2AABL 1VPOH 4HA1A 1B3JA 3K2IA 3NSDA 4FGMA 2EH8L 2VR5A 1USQA 2WYZA 1KGIA 4H4NA 4FKKA 2ZCLL 3KWWA 4LSTH 3L5XH 1EERB 1T3FA 5LO7A 1E2VA 1WBZA 3SDXB 2X2IA 1FNAA 5CJXC 2VMDA 3GSUA 4X7CC 1U30A 1S9XB 2BJML 4I9WD 2GQHA 4QNPF 3HN5A 3BX7C 3E3QC 5E94A 4N90E 1HH6A 1BAFH 35C8L 3PJSB 5D1QE 1YY8A 2Z1PA 5AKRA 3C5JA 4WGKA 2JKTM 5EFIB 3PPSA 3RNKA 1UKSA 4AGOA 1PIFA 2XWJA 5D1XC 3V5KB 4KV5E 4BQCA 5GJTL 3ZTJH 4WCYH 2VE6B 4QHLA 5L4FA 4JFFE 3BPCB 1PX4A 3KEHA 5IHBA 4NIYE 4NKIL 1RK7A 3MV9D 1UM6H 3E6FB 4Y4FA 4QTHA 1JZ2A 1WG3A 3EHBC 5EZOL 2YD1A 5GISL 2HP4A 5HYSA 3UTTD 3PQYD 2X10A 5DMGC 2ZKMX 5L88H 2PP8A 4DN4L 4XCNB 3VU1A 4I89A 2APTA 5TK4A 4Y16C 4UAHA 4NM4L 1EAPB 3PIQA 1RK1A 2G3XA 4FXTA 5DHVH 3TVMC 2CJ3A 3FU8A 3O8XC 4OV5A 1EUTA 4BZ1L 5DZAA 3RY4A 1Q90A 3BN9D 5KYXA 1PAZA 4ANUA 4O02A 4QAWA 3AXIA 3HI1B 4X8JA 2E4FA 4GBXD 2IQAA 3L5JA 3GUFA 1SEBA 4ENEC 3GJFK 2I26N 2X9XA 3C6EA 3H9YA 1MLBB 2AK4D 4JRLA 4IIQC 4ZW3A 3V4UL 3DVNB 5CM1A 4PUBL 4AIZA 2F58L 4P5TB 2A4ZA 4XVTH 3O0RH 4X5RA 5D2LE 3CHPA 1ZA6A 4WW2C 2VLJE 1BFVL 1NAML 2HRPH 5IEHB 5I16B 1SY6A 1XF5B 2E75C 4P3CH 5GHWH 3TN0D 3VE0A 1BAWA 5J57B 3K71A 5E1QA 2YAHA 4DAGL 4F5CA 5B3NA 1UUNA 2WUBL 4UV7L 5IQ7L 3Q9PA 3OWRA 3WY1A 3RWJA 4KKNA 2WQUA 2ZWYA 4NQDE 2BWDA 1QBMH 4QHNA 1F4XL 4GUPB 1F3DH 4X5XB 4LPVA 1U8IA 2N0KA 3DECA 4KJYB 4L1TA 1YNLL 5BO1H 4LEEA 3WTYA 5JHLH 3NJIA 2RH0A 4IJ3C 1MW1A 2D4FA 3SKNB 3P2DA 5HGDB 4RMSA 5GRWA 2MEJB 2QSQA 4GXVL 4HCFA 4PRPD 3KLDA 3U4BL 3BO8A 1KJ2A 3CN2A 3HFFA 1ECYA 2YPKA 4UNTA 1IIKA 4EF3A 3CDZA 2XU9A 3DSFL 1X9UA 4YXKL 3V0GA 5A2IH 5HDLA 4PN6A 5BZXA 2YXWA 4DGYH 1OAUH 2OMWB 2R8SL 3S5YA 3BIKB 1M6OA 4TNVF 2LU3A 3GXNA 5LLIC 1RCYA 1H6UA 2MNJB 4K9EC 2L7JA 5DDHB 3HS8A 3GBLA 4HUWA 3O81A 4OT1L 5GS2D 4LSDA 5BRZA 2OKMA 5HHNB 4MXWH 4MJIA 1K3IA 5I74C 5CILH 2ENYA 4HWZA 4EO5A 5E2JA 5B7FA 2VN5A 5HJGA 3R18A 3L3OC 5KVFE 4JO3H 4GNKB 4GKSA 3V52L 4ZMWA 3CQFA 3VI3E 4BQBA 4MA8H 2BSRB 3MNWA 1E67A 4PJ7A 2R0LL 3FQ2A 1HS6A 4A38A 3BOVA 1M53A 1PQZA 4RGNE 1WAAA 2L04A 2XXGA 2JE8A 5TH2B 4FQ1L 4YBLB 2PCYA 3A67L 2WBJC 2YGOA 1JYWA 3LQAL 1CDHA 3KLKA 3PWUB 4B3VA 2ZXWB 4CU8A 3GS0A 4ATTA 2CGYA 1ZEAH 3WHE0 2NZ1A 3PV6A 3ZYOA 3DX4A 4AMWA 5T3XL 2W60B 3QIUD 2NY1B 3JYCA 3K6IA 1VZIA 3CPLB 5D70H 4YR6A 5IHUH 1PAMA 4EDWL 3SJVA 3S4SB 3B3IA 1YDPB 1P7QD 1CI3M 2XZQL 2P42B 1D2OA 1PVHA 1IT9H 1DL7H 2FD6L 2PPDA 2COQA 4HC1A 4N2DA 3JV6A 3AREB 5E5UB 5IB5A 1F42A 3QQ3A 2DF3A 4UDUB 3US0A 1EHLL 5KSBE 1MREL 5CSZB 4GP5B 1T66D 5JO5A 2AJUL 2FT8A 2Q6WA 4N26A 3PP3H 3L3IA 2EKSB 2H3KA 3PWLB 1IM9D 3W3BA 1CDUA 4MCYB 4PGZA 2EIJB 2YPLD 3IJEB 4HK3J 4A55A 3MRDA 4A2HA 4DVBA 3UBXI 2OMUB 5HVHB 5BXFA 2J55A 1EHKB 5F6HI 2VMFA 2ZOWA 5EU4B 3SZKC 4HWBL 4BGLA 2NOYA 1AE6L 1W9XA 1BBJB 4G7VL 3T6XA 1D6EB 4F3FA 3MLZL 4IEFB 2VN4A 3G5VB 1A6VH 2BVEA 2ZYRA 4J1UA 1DVSA 4JM4L 4QD2E 1EFXA 4XN2A 1OTUC 1A1NA 1CU4H 4KX8A 3CHXA 2AV1B 2NLJA 3LH9A 2IFGA 4F7TB 2ZYSA 3AMLA 3V79C 3WKYA 2DQJH 3KJ4B 3S96A 4Z77B 1WA1X 1TJHH 2UYLA 1JXGA 1DZ0A 1ZHKA 4J6RH 5H2BB 1NCDH 2Y2TA 3IGUA 1TKWA 3ILQC 3OBAA 3D3VE 4NP4L 3CN1A 4XPBL 3DUSA 5DUML 2XWTB 4FTVB 4TLKA 3BWAB 4OZIA 3TIDA 3LPFA 5AKTA 3HE6A 3PP4H 5FYLH 3F6JA 3K72A 4W9LC 2ICEA 4M48L 3SYOA 4TUKH 1C1EL 1RMFL 4NKMB 1CD8A 2P8MA 4C55A 3LV3A 3P77A 3LXBA 1FE8H 3T3ME 4EOWL 2LHAA 1AI1L 1CLZL 1DVXA 2Q76A 3LD8C 1FNFA 3QIBC 4P46D 2O5YH 2IWGA 1B2WL 2RBLA 3EYQD 3CFUA 5E51A 2AKRA 1KCLA 1KN2H 3DUUB 1LO3L 4P4KB 5DT1H 1V05A 1GMEA 4PJCA 2PPCA 1ZJBA 1G7IB 2I9LA 1UA7A 4WU7A 3QHTC 1GY2A 1UQSA 3HS0A 1O9VA 3U0PB 3TURA 1EO5A 3CZJA 4KQ4L 2FQDA 4MDJA 2JKJA 2VOTA 4Y2OA 1CLYL 2XXFA 1EEYA 4ZFOB 3ARZA 3PHQB 1XO8A 4M4RA 3VG9C 4OGAC 1NCBH 2H1XA 5ILTL 5LBSH 2ICWJ 2OZ4H 5J9PA 5J7CC 3AJ7A 4D9RE 4UQ2A 1RZGA 4JKNA 4MVBD 3MLSH 2CA3A 5IMLB 2IDFA 4MJ6B 3VTTA 3DI3B 5GZOC 1TTUA 1ADQA 1MKFA 5BZDB 3VQMA 1CG9B 1GS6X 3FAWA 4BK5C 4QNPE 2VR7A 5K5YA 4HFUL 4G3YH 1OAKL 3EOTH 3HE7B 4LVNB 4WUUE 1X5HA 1BMZA 4KNQA 2WSPA 4R97C 3LB6D 3NZSA 4G5ZL 3RGVA 3MRGB 3SBWA 1IAIL 4HGKC 5DJ2A 5HPOA 2BSDA 2O93L 4LRIA 1CLCA 4B50A 4JFEB 2WYIA 1QO3B 3NACH 3QEUA 5JDSB 3WGVB 1FGVH 3OR6A 3IJYA 1KFAH 4ZFFB 1R3JA 4JVWA 1AGBB 1CFNB 1HQRA 1AIZA 1KIQA 1Z9LA 2QZ5A 3MLYL 4P5KB 3VXPA 2R29A 2QPEB 3QIWC 4K8RL 3WHXB 3S88L 4KK9C 4G1MB 1A0QH 2Z8VC 4I0CC 2JWYA 2Z65C 1UCBL 3NRPA 4H25A 3HW7A 2V8MA 3HB3C 5TDNB 3I3DA 3OAUL 1KTCA 1B0GB 1RK0B 1ZD6A 4HFWA 2K8QA 4AEFA 2ROYA 3AQYA 4ZMYA 5DGRA 4PB9L 3LXCA 1CICC 1Z5LA 3U48A 2NR6D 2YK1L 2CO1A 3NDYE 1KTRL 2Y22A 3H9SB 3KM1A 4NNPH 1QSFE 3WIFA 1A3RL 2BIOA 4QRRA 1M9SA 1QLFB 1YEKL 3QW9A 1S7TA 4YHZH 5F7YC 1IRAY 1QHPA 1UACL 2AS5M 4L1DA 2EC9U 1HINL 2B5IC 1F6AA 2Y25A 3IJHB 4ANVA 2YEVB 2AEPL 4GSRA 2XBZA 3F5WA 1KCRH 2OMTB 4FOMA 4ZRGA 1UKTA 2WWKT 2BP5M 2CGRH 3T4YA 3IFNL 4Q9BA 1QA9B 3APDA 3UTPE 1E9OA 3E7JA 4N8UA 2BNRE 4AC4A 4TULH 2IH3A 4N87A 3DX9A 5EBLA 3INUL 3KPSB 1ES0B 3BMVA 3IVKA 4LAQH 2X41A 3OVUB 1FYHB 3GXIA 4WLCA 3PL6A 5FYKH 1QVOA 3WFZA 3DXAA 3TTSA 5SWSD 3RUGF 4AW7A 3RWDA 3G04B 4FG6D 2A9ML 1KCBA 2XKUA 3RVXC 4KK5D 1QZNA 4LCYA 2X9ZA 2JI3A 3RG1C 1U95B 4WHYG 2CCVA 4QRSA 2UX6A 2F5AH 2ATAA 2EDFA 4N8VB 4EI5B 2D3LA 2DQIL 3PAUA 2W92A 4LSRH 4NQCE 3ZKXB 3S34L 3HC4H 2A99A 4PJAB 1MI5A 3F7QA 2Y5EA 2PO6B 4QRUB 3RPIA 1N10A 4BQ9A 2JI2A 2ODHA 3WNNA 1F6LL 2YGVA 2CU9A 4MAZA 4S1DC 2ZXEB 2IXQA 4V1DB 5AYQA 1IC1A 4MLSA 4XN7A 1X4XA 3GMRB 4M6ML 5E2UL 5FKAB 3RDTD 4ADIA 4WI7A 3EAKA 2OYMA 2FT6A 1MCKA 3VFPA 1IAMA 4EMZA 1DBKH 2FH6A 4FABH 4AXWB 4E41A 4NLAA 1ORQB 3K6SB 4D0CB 3S5LG 4HXAH 4MKTA 4NNYA 1VA9A 4TVPL 1PX8A 4LLAA 4YL4A 2HXAA 1C5DA 2VDLB 3KR3H 2AXHA 2B39A 3KLAB 1OQOA 3KAAA 4X6CB 4ABWA 5D5MA 4M7KH 4FJYA 5D7IF 3RZCD 3CVIH 3S3JA 4LKXB 2PCFA 2VM4A 4U6VH 4N86A 4LMQI 3TEZA 1CZ8H 5JIIA 2F9BT 2R7EA 3QPXL 4BFFA 4NWTL 3S97C 1CGXA 4QOKE 2XXCB 1NCCL 2IDSA 4H0LC 2PUQT 2C3VA 4MD4B 1BMWA 5DRNB 2GJ6E 1IAKB 4BFIA 2X1QA 2CUIA 5FUOL 3VD5A 3MYJB 1E4XH 5FUCE 3HVNA 3KGRA 2EUXA 4TL4A 4MNGE 3WE1A 1OALA 3O3DB 3Q3GA 5GS1C 1COBA 4OZFB 4Z0XA 5CCKH 6FABH 1WFTA 4WEEA 5D2NE 1FL5A 1SHMA 5BRQA 3B9KD 4FX5A 1ZVHA 2J72A 2X4PB 4H26B 4JM2A 4P0DA 1OGAE 1IVLA 3QE5A 2QHRL 1NUNB 5IY5B 1FG2A 4H20L 5FX3A 3FBKA 1SHSA 2YJQA 3SCMD 3SKOA 1CVSC 3KL5A 3WKML 3ZKQD 3ARUA 2ZSVA 4A2GA 3F58L 2EO7A 3QPKA 3TA3B 1HL9A 1SDYA 1ZPUA 2WP3T 3H3BC 2IWKA 3O8XB 4A04A 4I18A 5JQ6H 2J1YA 1C08B 4FAAB 4JRYE 1LE5B 4KVNL 1A6UH 2DLFH 1N26A 1BX2B 1MLCB 3GKZA 4XWGL 3PP3K 2RB8A 1CR9H 1N70A 3FH5A 3Q8AA 3QR1A 5FM8A 1S7WA 5T3XE 3F83A 1CDBA 1I7RB 2YO3A 5DHYA 1KPVA 4IIQB 3EOAB 5CLTA 1T2JA 4XMPL 1RSFA 2ZOOA 1XEUA 4R7VA 1TU2B 4JFYA 2JB5H 4JFHD 1OD9A 1OEZW 2NYKA 2X4QB 2XNAB 2YQGA 4NOFA 4WW2B 4OSUL 3UO1H 5I1KL 1GGIH 3DLQR 5J6HB 3KPOA 5C8JB 5DUBA 3MA7B 4NYLA 5DU7A 5TD4A 3V95A 5IIEB 3H4HA 5INCB 3MNVA 5FFOA 3IMWA 3VDCA 5C97A 4GMSL 5HYSG 2NUTA 2R2CA 1AKJA 2ITDB 1YMMA 3QQ4A 5T33L 1IBYA 1G84A 3MJ6A 1NMBH 3X12B 4FNLH 2WCSA 1MG3C 5G5DA 1M56B 2XIDA 4ODWA 5IJVA 1I9IH 4TTDD 4XNYH 4ACTA 3ZT7A 3EO1A 3SB3A 1LLAA 3DK0A 3TFKD 1JG9A 3HN3A 1X4ZA 4HUNB 1BQSA 2HTKD 1OAYL 4U4IA 2FIKB 4K5MA 1YYLH 2H47C 4HS3A 5HXMA 3NAAL 3GLAA 3AT0A 3P73B 5E9NA 1I8IA 3RAJH 4G8FB 3VRLF 4OV6F 5FO8B 3QWOA 1Z66A 3BP4B 1QYGH 5HHOD 3GBEA 5T1DH 4PR5B 1MUJA 1KB9J 4L48A 1J5OL 2EVJA 4PG9B 3MUZ1 1U8MA 2NY7H 3EGSA 4Y2LA 4AG4H 1IGCH 2DWXA 3H9HB 2AXWA 4Z7WB 1E4XI 2H2SC 3EJYC 2FX8L 4KTEH 3QNXB 1NEZG 4NC1C 4TUUA 4TMPA 1QUPA 1TJGL 4UINL 2JKRM 3IXAB 3LSOB 4Z76A 1DUZA 2DQFA 4G7RB 3V6OE 4JFQA 3T8XB 4FFVD 2P80A 4J3OF 4U7MA 3C09C 5DD0H 1DEEA 5BVJA 2I07A 2XWXA 4M8UA 3D50A 1OKEA 5D4QA 1P1ZB 4ZAKA 2P8LA 4PW3A 3VFUA 1ZHNA 4DT2A 4ZMAT 3RHWF 3MCKB 2WBJB 1JGVL 1NGPH 4G8GE 3C8DA 5CZRA 4K3EH 5IF0A 4P2RA 5LKNA 1A3LL 1X44A 2PWGA 4X6BB 3U4AA 5LG1A 4B9YA 3P9LB 4G6MH 1KTBA 4AMKL 3KYKL 4B0MM 1U2HA 2BSTA 3NCYS 1CFVL 1RU9L 4UU9B 3WNMA 5L2KE 3F05A 4A39A 1HH9A 1MAKA 1TOXA 3V0IA 5F0LB 5DS1A 3VFOB 5KBDA 1BZDA 1AS6A 2VJ8A 3CUPB 1J8HD 3RTQC 2VW4A 3QC5X 2FX9H 1HXMA 3BZEB 5AW9B 1JZ6A 5JOEA 1DCLA 5FM5M 1CYWA 3X1GA 3VSVA 3UZEA 1CYXA 1F18A 1MXDA 3QNYB 5HY9A 4ELMB 1OD7A 1I1AD 3V5DA 2CIIB 3DMMA 1R5VB 1V3MA 1O0VA 1NDTA 2BHYA 2NRDA 2PR4L 2Z93A 2WZ5A 4PPTA 2ENSA 1N3NA 2WLLB 4HKJA 5I6XB 3BPOC 2CK2A 4X7SH 1F8TL 4NKDB 1ILUA 5D71H 3ARDA 1OTTD 1T20A 2PXYC 5C2BL 5INDA 3NVQA 3WAKA 4L23A 3LX9A 1EZUA 2NXYC 2CKBA 4N5UA 3T65A 1E28A 4HMCA 2OMYA 1VERA 2VDLH 5HI4D 2Y07H 2KDYA 2OTPA 3VVVA 4QHKI 3ORJA 3KBEA 1YEGL 1C8QA 1QFWL 3UYRL 5K9OB 1UWGL 5I1IH 3VXUB 1BQLL 4NX0A 5IV2A 2GB2A 1EPFA 1A4KB 1MCPL 2Y1VA 1XXDC 1T21A 3OWEA 4YHIB 1JTOA 5DZJA 2Y7NA 4XHJD 3BPLC 3OKLB 1IC5L 4MTMA 4ZD3L 2CO4A 3ZE1B 4JZJA 4YDKH 2F5BL 2YD9A 3OL2A 3IS1X 3RUGE 4Q2ZB 2V9UA 3G08A 5E8NA 1AO7B 4JO2H 1YEJH 2BZ7A 1GPOL 4D2NA 3ERXA 3FUDA 3U7YH 2R0KL 2VQ1B 4OZFH 2JCWA 4POZC 4PJEF 5F1NB 1I8MA 1KBPA 3VRJB 1JZ4A 3WMQA 4GEJA 5F7EH 1OK0A 3DIDA 2X89A 4GW1B 5IJCC 5ECGA 4ODUB 4JFFA 1SXNA 1KPRA 3VQ1C 1BZ9B 4N6RA 3L5WB 4YDJB 1TQBC 5E2TL 4DKFH 4L4VD 1JGIA 3UPAA 3PHSA 1AQKH 1FFPB 2WNKA 1IV8A 1U33A 1RZKH 3LD8B 3QIBB 5TDOA 1KYFA 2A6KB 1G6RB 1ECZA 4XVOA 2JKSA 3VXMB 5T1JA 3FQTB 1UT1A 1D5IL 4AQEB 2UY6A 5B21A 1A7PL 1XH1A 2QR0B 1Z9SA 3UXFA 5DWPA 2WCGA 4IK6A 3VH8G 4J4PA 3ESUF 3FO1A 2EYTB 4LLYA 5CKGA 2VW7A 3RBGA 3W39B 5BQ7A 1J0HA 5C3IA 4UYPA 2V2WA 1KN4H 1G7MA 1JPSH 3QC6X 3T77B 2PTTB 1W72A 4L8DA 1OPOA 2ZOTA 3VFVB 1UA3A 4Q0XH 5FLVA 3VO0A 3QFJE 3UJIL 3VG9B 1DDTA 4HJ0D 5D7IE 3U0WL 4Y4FC 2CIKA 3WN6A 4BFKA 5KUKA 3OHXB 4IRZH 3VXRB 3H7LA 3NQKA 5KANG 3L4TA 4DVRH 5BS0A 1KLGB 2WHVA 3GSVA 2GSGB 4NXSA 4HD9A 4YVNA 5EEZA 1WIUA 2EADA 1RULH 5KYWA 1GYCA 3NCJL 3EZJB 5GS3A 1VADB 4I4WB 4AEIH 2X6MA 1ZK9A 4R97B 3KGUA 4D94A 1ZHBA 4B7LA 2NNXA 1IEBB 2V5YA 3IMVA 4KMTH 1U92B 2YEZB 1AGCA 1NBQA 4DP2X 2VH5H 3D0VA 2R59A 4EJ1C 2V6HA 4C47A 1P6WA 5DJZB 4W6WB 1TEYA 2Y7OA 2J43A 4XODA 2IIJA 3U36A 2P7TB 4I3RL 4WFEE 3B4NA 1B0RB 3TEYA 3HZKB 4J8QA 1E5ZA 4K9EH 3D69A 4RX4A 4Z95L 2NXZD 43CAA 4XVJH 1S7VA 2K4WA 2P46B 3N42B 4HIHB 3ULUL 5EF2A 1Q1JL 3VU2A 4CMMB 3FHEA 4TVPE 4E68A 2B4CL 4GO6B 5HGGS 3CFKB 2C1PB 4P2QA 5DQDL 3T1FA 3LKPA 3BWUC 1HHIB 1CICB 4LLMA 2XXMB 4PV8A 1IGFH 4F8NA 1A7NH 3KPPB 2ADGB 1KEML 2CR0A 2J25A 4M1GH 1Q72L 2FR4A 1SBSL 3QJZA 3C60A 4MASA 5IFJB 2PW1A 4NHUB 2DL2A 3JWOC 4TUJB 3LVEA 2Y5TA 4DP9X 3G6DH 2A9NL 4YN3A 4NHCH 2MMXA 2B5IB 9CGTA 4YE4L 5DZOA 1HU8A 3DBXA 3FU5A 5A43C 4MA1C 5E99L 1XCQB 4JK0D 4IBLT 2BNQE 5I8EA 4AYEC 3QXDB 4WV1A 4PJ9A 3CZFA 2P5EB 5GPRA 4P05A 4QHMB 3SPCA 3GDCA 4P59L 3PWPE 1IQWL 1HZKA 4OI8A 5BW7C 3A4DA 1L0QA 3KCPB 4H1LA 4HS8L 1I7UA 4M8QA 3S37H 1A7OH 5EN2A 4XO9A 1LL1A 4PJ8A 4XAKE 4Z9KB 3E1ZA 1NBCA 3VACA 2ADFH 2ZXDA 3VXTA 2AANA 3VRLE 5ALCH 3WEBA 3SGKA 1J0KA 4L29A 1KB9K 2F08A 4WJ5A 3ULUF 4DGIH 1TZHB 4AL8C 3QG7H 1UURA 4LK4A 1EH9A 1WEJH 3D2UD 1ED3B 1EEZB 2EH7L 1KXTB 1I8LA 2V3EA 3CSYA 5DEFB 1WDAA 1IE5A 5EZJB 4BEIA 2WUCH 1WPCA 4PRIA 5JHDE 3CCHB 4LFHD 1N0LA 4JO5A 1GAFH 4N0UA 1QLRA 1VFMA 4X6FA 2PP9A 4ZPVB 1S5IL 3BAIA 1M3JA 3J07A 4FFYA 3UL4A 3BUYA 5TDPB 1PG7W 1JPGA 3NJNA 3VFGH 4BH8B 3S7GA 1DZBA 3EO0B 1G7HB 5HBBA 1UT9A 4KUZH 5L6YL 3NDZE 1PBYA 1RLBA 4OR1A 5KSAB 1OTSC 3JWDC 5HDBB 3UZQB 3H3PH 4U0RC 5FGRA 3PXLA 2TRYA 4MZIA 5D7JA 3GSXA 5D72L 2UXFA 5MERB 1Z9MA 1QSEB 1ZSDA 4LHUB 5EUOA 1V10A 2NDFA 3UTSE 3GIVB 1FVDB 4K4KA 5HJ3B 5CGBA 4CW1A 3FZUD 1V54B 3DVGA 5CWSA 3L7FB 4Y2DA 5KTEH 2XZAL 5DD3L 2F54D 2BY0A 3BMWA 3FT9A 3HG0A 1S3RA 1CFQA 4JZOB 1H6EA 2FWUA 3FB8A 1U41A 3MNZA 2MPAL 4JPKH 2OS7A 3GMNA 1J5CA 1JF1B 1CUOA 4WUUB 1A2YB 3GMOA 1G6RH 1D5ZA 5CEZD 5CXPA 5GS1B 1TPXC 4RQQA 4P57B 1XH2A 1BF8A 4GMTH 1MCSA 2L3BA 3SE4A 5GGSY 4TUOA 3UTZB 2ZICA 2VC2L 2OMBA 4RA3A 2KZWA 4DKAA 4LCWB 2E0PA 3WXWL 4XPHL 3BUPA 3RI5K 4C83A 2GITB 4ES9A 5JXEC 1Q0XH 1TZ8A 5FOBA 2X6AA 3ABZA 3T0ED 3HE6C 1OCWH 2FL5B 5HYQA 2RA1A 2ICEC 2APSA 3CVBA 3TWCH 3VXNB 3VFMA 3TV8A 1JBJA 5CU9A 3TCXA 1Y6MR 4HISA 4LSSH 2DMBA 4IHOA 4YQXH 4HAGA 2GBAA 3SN6N 4G71B 3B56A 4ETQB 1F4HA 2J5LC 3QUGA 5C07D 2CM6A 2RQ8A 3ZHFA 5ICZA 2CRIA 2XPZA 3P9MB 4Q7DA 4X4YA 4XZUB 5DF0A 3PGFL 2L8AA 2O72A 1UUSA 1T5XA 2VQUA 4X6EB 2VLLA 3HPLA 3WI9A 2D03L 3B7RL 3BAWA 4IYKA 1FVEA 4X7FC 4R83A 3I74A 3LHPH 5IROD 3CFCH 4LVOC 5DEZA 5HVWA 1Y18B 3FYEB 3NJMA 2GAZA 12E8L 4PJEE 4K23H 3HAEA 4R8WH 4FNQA 2P47B 4FULA 4JRXD 4NRZB 2NW3A 1OT2A 2CBOA 3KPLA 5E56A 3HS0C 1TVHB 3EBIA 3QDGB 4DQOL 3EBGA 1ZSHA 2KS0A 4FYSA 4NFBA 5E03A 4E9WA 2XFGB 1YA5A 5AOZA 4OD3H 1C5CL 2AJXL 1PLCA 2WCPA 3BYTA 4JFDE 4UT9L 2BCMA 2YD3A 2NW2A 4E9LA 3HLAB 5K59F 3BRFA 3VGAC 4C4KT 2FEEI 4KMLB 4OZHB 1MFEH 1RZIB 1DBJL 1NIEA 1PZSA 2CO3A 1NCUA 3HKFA 3MACL 4X7TA 3IAQA 4GRWF 1JRHI 4WO4D 1MAML 4QPEA 5ANMB 5IOPA 2UZYB 3NH7L 3NUKA 4NO3A 4KO6A 4YHPA 4P23D 5DD5H 2DYPB 2C7UA 2R2HA 1IC0A 4KY1L 4TM9A 1SJHA 4JZNA 2BIHA 4XNMA 3RGVC 3ULSA 3SBWC 2JB6B 2V4LA 4WDIB 3NIDB 1MFCH 2QQKL 2ATPA 2YPVH 8FABB 3IRZA 3R06A 4LRIC 4FHBD 4OFDA 3RLSA 1G1YA 2C1OA 1EBAA 1DUYA 1RIHL 1TCMA 6TAAA 1AKPA 2H6PA 2QPSA 3HHSA 4QKXB 4XH2A 5CP3A 5LVEA 1CDCA 1QX1A 2VISB 1N4XL 5AALA 2ESVE 3C08H 5FECA 4DZBB 3QDMD 2Y69B 3C09B 3D4GA 3D52A 4QT5B 1ANUA 2M1KA 4LPCA 4EXKA 4K5NA 1LO0L 3L13A 4IGBA 4R7NA 1NJ9B 5ERWA 3RB5A 5GRUL 3S3DB 4NFDA 3N1FC 2IV9A 3QJXA 3CVHL 3HLKA 1EO8H 3GYRA 4D8OA 1FYTE 3P0VH 5AYUL 2F1EA 2HFFA 1F3RB 1IQDB 3L9BA 2P1YA 4OKVB 1UFGA 5LJYH 2HKFH 2YRZA 3GI8H 3MJ9A 4HIEA 4R26H 3JT2A 3MCYA 4KUCF 4Y2NA 3RTQB 1U9KA 2B15A 4ZYKA 5J4MA 4GQ9L 2Q8BL 1U8QB 3IWVA 4ZFGL 4GG6A 4I85A 3FU9A 3IJSA 1JUFA 3X1EA 3O9WA 1ZTXL 5DHXB 1YEFH 4M5SA 1KJMB 4QXWA 4Y4HD 5HVFB 1M2OA 4RESB 3IXTB 4B97A 1EJOL 5JORA 5JPMA 3FQRA 1E43A 2B3IA 3U6RA 5EZIH 1T0NA 1NDMA 2XZCL 3B5HA 4ONFH 4S1RL 2Z4TA 3QJFB 1S78D 3BPOB 3GXPA 4OW6A 3ZKND 5FA4A 25C8L 4NAQA 1PLGL 3N3EA 4OCYL 3PL6C 1K4DB 3FO2B 1L9MA 4O2FA 2PXYB 3DX0A 2VITA 1NCNA 1ETJA 4JY4B 2APWA 3NIFF 2NXYB 3L95A 3NCXA 4PTUA 1KIRA 5IWLA 4XR8C 3H2WA 5JOFB 3AUVA 4R5VA 1WC7B 1G7QB 4ICWA 4DPRA 2VZ3A 5IHLB 1TUPA 2F19H 2ZPKL 4KKCC 4M5YL 5IZ7A 4JRYB 2XRAL 2W8CA 2PN5A 4HKXB 3GSQB 4PVMA 3U9UB 3EDKA 5CIPA 3ZO0A 1KT2A 5AW5B 1TSRA 4X5WA 1BZEA 4JJHA 1BW8A 1DVUA 1GW6A 3C9NA 5FYJU 3IFOA 3IBOA 4H0HB 1DQJA 2BDNL 2CDGA 2NY2B 5DI8A 1I1CA 3QZWA 4ZUSA 3U1PA 4ZUTA 2OXGB 3H9ZA 2VJ0A 4K0OA 5DSCA 2H1PH 2XPGB 4E9YA 4LCIL 5A16B 1V7MH 5I23A 1E5UI 2VDQL 4UIKH 2ADIA 4GEIA 4BXVA 3ULUE 4MB4A 2EIDA 3H42H 3JBG7 5FW6A 1Q94A 2R56L 4QRTA 5AOIA 3RIKA 3GSRA 5F1IB 5KBLA 1FC2D 3O6FD 2HN7B 4ODVH 2DYSB 4NO0A 1R24A 4MHHG 1XGQA 3KWWB 2IH9A 2DQUH 3GBDA 3SE9H 1T3FB 5AQ0A 1NLDL 4NSKA 2VR4A 3VFWA 1H3VA 1WBZB 4LSPH 3EH5B 2A6JA 5GJSH 1A8ZA 4PS4H 3TFBA 3GSUB 4CILA 2DQCL 2NNCA 3OKNA 2EILB 3OPZH 4NGHH 2X3BA 5E94B 1O5PA 1HH6B 1RV6X 3RKDC 5KW9L 2CHZA 3JWNE 3C5JB 1ICTA 1SQ2N 2OR9L 2ZCKL 4HEMA 4RAUA 4C57C 5T3ZD 4I0PD 3RNKB 5IFAL 5C1MB 1CE6A 2VL5A 4B9IA 2ZX8A 4YJZL 1FORL 4OF7A 3MRQB 2A2QT 3FQWA 2LV4A 1XTLA 3CV5A 3UZVA 2V2XA 3M17B 4QHLB 2JKIS 4KJPC 4Z7OE 2I5YH 4JPVL 2DOCA 2KZ1B 5I82A 2I85A 3GIZH 5E2WL 5JHAA 4JM2C 4C56E 2FLBT 2ZCLH 4Y4FB 3FQXA 2D2OA 4ZMZA 2QDWA 4WI4A 3LZNA 2WO3B 1D3CA 1N6VA 1WTGT 3AITA 5DXWA 3OMAB 1W0YT 4TSAL 1IFHL 2BVOA 35C8H 3UGEA 3BDYH 4Z3GA 5ABAA 1N9PA 3QS2A 3VNYA 1L0XA 4I18C 3U9WA 4PB0L 3IDJA 2WQAA 3PQYA 2FBJL 4EQ3A 2VXVH 5KYXB 2ENPA 4O02B 3RIAF 1BD2E 2JXMA 2HJLA 4X8JB 2XN2A 2FATL 1MHCB 5CZXD 4WEUD 1YUKB 4GLRH 1SEBB 2WOYA 5D1XD 3VM7A 5ID0B 3BPNC 3BSZH 4LQFL 2IV8A 5K9KA 3FH8A 4MZ2A 5EZOH 4LAJH 4HH8A 1ZT4A 3SKJL 1RJZA 5AZ2L 4GBXA 2LT9A 3U83A 2H32A 3BT2H 3K71B 1JTTA 4B9KC 2JKWA 4HJIA 2DWDA 2AK4A 4OZ4A 1RURL 3MRIA 3O4OC 1P84J 3GXUB 3RWJB 4YGVA 4R7DA 2X88A 4Y5XA 4Y16D 5FCUH 3SY6A 2QQQA 1ZT1B 1R5IA 3HHRB 1IMHC 3DTUB 5FLUA 1UGNA 3TN0A 2E7HA 1U8IB 1ZGLB 4X2UA 4GPVA 5CLXA 4WY7H 3FQUB 4CRPA 2EXYC 1FFNA 1GOGA 1RH8A 4DZ8A 1P4IH 2LTQB 4KO7A 4ENED 3BP7A 3KJ6L 1NAMH 3HJEA 3ZJAA 1JCVA 1KJ2B 1TNNA 4AQAB 1BEXA 4AT6A 3WEXA 1KC5L 3Q5OA 2AQPA 4XXDA 2R0ZH 3L9YA 2WAQA 1LO4L 2YR3A 4FZ8L 5JQIB 3DGCR 4PRPA 1ONQA 1F0LA 1W0WB 4MA1B 4L8CB 4E42A 5JW3L 3V9EA 4HUWB 2Q3ZA 4EUPG 4FP8H 2XTJD 1CS6A 1F1AA 5EWIL 5BRZB 4CVWA 2NY0C 4MJIB 4CSZA 5DJ0A 5KS9A 4L3ED 4UTAL 4YLBA 3B2UC 1KFGA 2DDQH 2Q3AA 4HWZB 5DO2D 1K8IA 1DANT 4JY5L 5D7LE 5F2FA 1PDKA 5K59E 3BD4A 3U4BH 2V2TB 1QW9A 2YMXL 1NGQL 1FL3A 3MNWB 3TNMA 4GRWE 4PJ7B 2EYSA 2CK0H 2WO4A 4ZAKC 1PQZB 3MTXA 5TE6H 3O2DL 1P0SE 3P4NB 1FFOA 4Z8FH 3D6GA 4OIIL 4JGUA 4FI7A 5HD8C 3TOPA 1CGVA 1DQMH 1FSKC 2R2EA 1IGMH 1B4RA 3LIZL 2DTML 3GXMA 1SF5A 3PV6B 5DFVD 1H9DA 3LHAA 1P2CA 3AQDA 4GLRI 2YARA 3DROB 4YR6B 1M42A 5KAQG 3Q2WA 3JVFC 3ZE2F 2J88H 4NIKB 4U6YA 4EVNB 3B3IB 2IALA 5J3HC 3PFUA 1FCCA 3I6KB 1SOSA 5I66B 1DANU 2JELL 4IJTA 4K7PL 1N8ZA 2F68X 3KD4A 1X6LA 3QIUA 4XPFH 1LP9A 4PV9A 3JV6B 3BKCH 3WFCL 4H8QA 3UZEC 3UADA 5IB5B 1P7QA 1M7UA 3QQ3B 4DFIA 3MN8A 4XMVA 4U0RB 3DMMC 3GTTA 1K6QH 4ZFQA 5JO5B 3WN5B 2KH2B 4PCKA 4ACPA 2Q6WB 3L3IB 3L2MA 3AGVA 1YUHA 4UQBA 2Q0ZX 3OLDA 4JGMA 3RUGA 1H3PH 2JTYA 3K3QA 3QFJB 3ARDC 3AACA 4RMVA 4DVBB 4KKZA 1G9MC 4U1SA 5ABDE 5BXFB 1WS7A 5EZPA 2FD6H 1QFOA 2BERA 4CMHC 2P52A 3IETB 2JIXB 3H4FA 4F3FB 1XH0A 3O0LA 4HSCX 1I3VA 3LJ3A 3FUFA 5CN2A 3TT3H 3A24A 2HT4D 5D55A 1CGSH 3FUHA 3BVXA 5TTRA 2C9SA 1EEUA 4IBWA 1EFXB 4F7EA 1A1NB 1TZIB 4IRSD 1TPXB 2W9EL 4AJVA 4D9LH 1H8LA 3C87A 3QEQE 1DBAL 2GJZB 4NRYA 3SE8L 2CO7A 3V6ZA 5DS2A 4Q52A 2VDML 3S96B 4AIXA 2UYLB 1BQKA 4JZJC 1ZHKB 4N0RA 1FBIL 1SHXA 1R0AL 1UADC 5JW5A 2D8KA 3DUSB 3I2CL 3QQDA 2GCYA 2VXUL 1AE6H 1CQKA 3IBEA 4JRWA 4OIBA 4OZIB 3ATFA 2AITA 1F4AA 3QG6A 4JG9A 2QADC 1QFHA 3F6IA 1E42A 3EFDH 5I6LA 2P8MB 5B7MA 3ZL4L 3QDJD 5JXEA 3LV3B 1CO1A 5E0QA 3E80A 4EI6B 5ESAB 5I24A 5EU6B 2X1PA 2XSKA 4X8CA 3JV5A 2NSXA 3C6LB 1JZFA 3D34A 2UZIL 3AABA 4DW2L 2DL9A 3WYRA 5A7BA 5DRZA 3VXSD 2PW2A 1UA6H 1CXEA 3CZKA 1DCEA 5CJOH 5DUMH 4PJXF 3ZDWA 5LQBH 1JPEA 4JFZL 1SNRA 1DE4A 5HGAA 3DRQA 5C08D 3S2AA 2KYIA 1GJWA 1BQHA 2ADJA 5HYJE 3CGTA 4O02H 4LVOB 4J4PC 4ERSL 4ZMQA 4P46A 5IBTL 4PJCB 1C1EH 5DJ8B 1ZTXE 2I9LB 3NP4A 1KBWA 2ETWA 5FHBH 2YKKA 2O6EA 1KCKA 2Z31A 4D0BA 1I3GL 3PAZA 4MDJB 4OGXH 1EEYB 3HTLX 4M4RB 2FGZA 2IAND 1E7UA 5I1CH 1JPTL 4AZ8B 1SY6H 4FNTA 4HD5A 1C7TA 3FUMA 4XC1L 5J9PB 4UQ2B 1RZGB 3CHSA 2FTAA 4Z7NF 1OZTG 1TVBA 3PWPB 3BGAA 1MW3A 4KDWA 3E2HB 1YMHA 2XN9E 3O3EA 5DC4B 2YD4A 4BSWA 4Q14A 1I7TA 1NZRA 4RSYA 4BKSC 4JFXA 3ESOA 3RGVB 5FK9A 3VFRA 3AB0B 1T2QL 4ODHL 5FKPB 2NY3C 4JDVA 3ZE0F 3JWOH 3QEUB 4CGTA 1F41A 1KJ2H 2LFGA 2LVCA 2G60L 3OR6B 3IJYB 3UTOA 3ARBB 1EHAA 1H9VA 1MIMH 2QTVA 1MF2L 1HQRB 1KIQB 1TO4A 1CLOL 4OGAD 2AJVH 1IARB 4LSQL 3VXPB 3O2WL 1KTDA 4HFUH 2X0UA 5IESL 3QWRD 3ZSTA 2DJSA 1ACCA 4DKEH 4RFOL 3V9CA 5GZOD 1QTYT 5I15L 1NBYB 4G5ZH 1A9EB 1CK0H 3KPRD 1VFUA 4HFWB 1PW3A 1G94A 4NQXA 3STLA 15C8H 3CWGA 2NTFA 3HC3L 1Z5LB 1G1KA 3FS9A 3IS0X 3CMOH 3MRHA 1AXTL 2W1NA 3RVUD 3ZZQA 1MRCH 3IMSA 5ALBH 3C60C 4QRRB 5C09B 4YXLH 1YO4A 3QI9B 1S7TB 3O6KH 1PKQA 3S88H 3T3PF 2HH0H 2NR6A 2QFRA 4RGNC 3PU7A 1CFSA 1T6VN 3AUWB 4ALAH 1QHOA 1F6AB 3VD4A 3QIWD 4AC2A 3ZDYF 2CHXA 1XVSA 5F93C 3F5WB 3OAUH 4KK9D 4MJ2A 4I3GA 3T4YB 4R4ND 1E9OB 4OB5H 4WV1C 4AM0A 4PJ9C 4NN5C 5D7SL 5IVXE 4G9FD 4LIQL 4AEHL 2A1WL 3IE9A 2YRBA 4O4YH 1HCFX 4XMZA 1DEDA 1NPJA 3D0AA 2UZXA 1QVOB 3DXAB 1GA2A 3U9PL 4JX0A 3RWDB 4I2XE 4PJ8C 4JVPA 5AAPA 4F57L 3EADA 1BLIA 4TNVK 3E9UA 2FJHA 2XJKA 4LCYB 1U8CA 3B2VH 3M88A 4PY8I 2VM3A 4M6NL 3ALWA 3SGKC 5AB2A 4QRSB 3JWDH 2AQSA 3GHPA 2JQZA 3OKOB 1HXYB 2A73B 4KMQA 5SWSA 1W16A 3IFNH 1AC6A 3FO9A 4XOEA 1RQ5A 4AE0A 4XMLH 5KUMA 4A2DA 3RPIB 1UFUA 1I8LC 2YAPA 3E38A 4PP1D 4Z78B 3GRWH 4PD4K 1IEAA 3DIFA 3CXHK 3UTSA 5A2CA 2IXQB 1RUKH 4NQEB 3P2TA 4IQHA 4AYDC 5C0CD 4WRLA 3UAAA 3NCFB 4TKWA 5DEGB 3VFPB 3OGOE 2IBGA 2VSDA 3UC0H 4MD5A 5AZEH 5SWZD 4E41B 3LRHA 3QHFH 1Q1PA 2J6WA 3D85A 5FYKU 3RDTA 3JVGA 3J7HA 5L9DL 4NNYB 1RZ7L 3LPGA 3FBQA 3S34H 4LB8A 4PRHE 3UMTA 4DKTA 4RSVA 1B4JH 1C5DB 4KC3B 1UENA 3ZDXF 1HWWA 1HDMA 1A14L 3ULVD 4N2MA 3GHBL 5D7JC 2YGPA 4YBQC 1DBBL 4OLUL 4R2GC 2PCFB 2ROXA 4M6MH 3PREA 1BA9A 1K5NB 4GAYA 4MDIB 3SYQA 1DQLH 3ZE2E 2O4EA 2R7EB 4HOZA 2ZUYA 4LSUL 4G80B 3M6DA 3QUXD 1XQ4A 2D7MA 3OLEA 1EVTC 2W88A 3ABMB 4OFKA 1VGKA 4PREA 4Y2DC 1G4MA 4YSDA 5E5MA 3KHOA 3OGCA 2C3VB 3RZCA 3FYIB 4BFIB 2ZTBA 3QZWG 2R2BB 2B08A 2I9TB 2DBLL 4N0YL 1WE5A 2R1XB 3Q3GB 3ARXA 4Z0XB 2FX7H 1T4KA 4WK2B 1I8AA 2VAJA 3TJEL 2LLNA 2WB7A 3SE4C 1EGJA 3TXAA 5T1KA 5FB8A 4U49A 1KLUA 3X14A 4HV8A 4ZUVA 2KT6A 3QPXH 5L4MA 4QI3A 4C4BA 3QPQD 1FG2B 3FTUA 4RIRA 4BWWA 4HMEA 2GHZA 1OAXL 4AM0Q 1ZLSH 3FC8A 2XOTA 4MNQE 1MCEA 1RZ8A 2ZSVB 3B9KA 5ANHA 4RDBA 1AVAA 1D5BA 3CFDB 1NTDA 5F44A 4GXUN 3U6XA 2R4RL 4OLZL 4XXWA 2I7OA 3SCMA 3BE1H 5C0AD 4F92B 3KLSA 4X4ZA 4B9FA 1IC7L 2PWEA 4OJEH 4ZTEA 3BPNB 2XHNA 1MFVA 1KBKA 1MSPA 1P7KB 4P9MH 1KPVB 2BC4A 4BD4A 3UPCA 1SYVA 3FUKA 4H20H 4PJ5E 4JFYB 1UD2A 5D7EA 1ZLDA 1S7XB 3KPOB 2FEDC 4Y1AE 1QFUH 4KH9A 5DUBB 4HJGA 1H8SA 4NYLB 4HCRL 1Q9KB 2BY2A 1PSKH 5ITFA 3MNVB 5JA9A 4OQTH 3A4AA 2FHCA 1PFOA 3SDAB 2NUTB 1AKJB 5DJ6A 3MI6A 2YLHA 3M46A 4Y7OC 1YMMB 1NFDA 2Y7SA 4N2AA 4XPGH 4HOMA 3H85A 2IWEA 2BIIA 4B5ZA 5IJVB 1NCAH 1ASPA 5TFSL 2VRKA 4P2AA 1BLNA 3EO1B 2YXVA 4XNUL 4AX3A 4E9RA 3BDXA 5J13C 1NGZB 4PJXE 5F7HA 1QR4A 3OF6A 4HS3B 2ZYIA 5CHNB 1T03H 3MLUL 3IGLA 5B38G 1I8IB 5BVPL 5I1AB 3WUWA 4FHJA 3QWOB 1DJZA 2J12B 4GFXA 2BHFA 1E7VA 4GMSH 3U2SA 1MUJB 1UWFA 2VAAB 5T33H 3EGSB 2VLRA 3BEVA 2VMCA 2X70A 3MO1A 3GPEA 4CJ1A 1LJMA 1P6FA 4IOFD 1A3ZA 1M1XA 5CLZA 2NY0B 5HHOA 3OZKA 4NLHA 4PWFA 4K3JL 3DGGA 4WTZG 4Z76B 1DUZB 2DQFB 3QRBA 4JFQB 2DAVA 3NAAH 4OAWB 1FPTL 3VUAA 2N7BA 2OP4H 4Z7NE 3MR9A 1PEZA 3EYFB 2YD8A 1HYSD 1X4YA 2I07B 5BVJB 3QUYD 2JJTA 2NY4C 2AFNA 5FA3A 2EDXA 4ZAKB 1WGVA 3RWFA 1KJ3L 1ZHNB 4W9KC 3VFUB 4XOAA 4QJ4B 1MJ8H 1VGEH 2F7IA 3FSWA 3V7AE 1HN1A 4LOUD 5IF0B 2EVHA 4IGBC 4P2RB 3KW8A 4YSAA 1JWUA 1FSKB 2YLKA 1IM3D 2Y9RT 4O51B 2EE6A 2BSTB 3LN4A 4UINH 2R69H 1KLFA 4PJDF 3ZE0E 1N18A 3BIAX 2YA2A 4W9EC 1HH9B 1QKZH 1UKQA 5C7ZA 3EJYD 2O6PA 2H0FA 1U3HD 5AZUA 1FVCA 5I6OA 5K9QI 1IC4H 1BFSA 1JOIA 3N06B 4YFEA 5F97E 1SZNA 5GGTL 4FFWC 2LABA 2WWMD 3OKDB 4HBCL 4K94C 5E8PA 3LS4L 1KDJA 4UM9B 3VD0A 5E6RB 3C5SA 4WW1A 3SO3C 5J12B 4LL1A 1R19A 2P24A 3O9WC 4QYOA 2Q87A 2FGWH 1J8HA 1T5WA 1A3LH 4Y19D 1CTNA 3FTSA 4PI2A 4FXKA 4YGAB 5GSRA 5HY9B 1B9ZA 3TCLB 3V5DB 4AMKH 3CXDH 5JPMC 5JW4N 2Z93B 3OG6B 3ZZSA 3LRGA 3HUJF 3QO0A 4WKZA 5MEQB 4WFGD 4AYMC 4JHWH 5ACMA 1AR2A 1N3NB 4HKJB 1JNNH 2VSCA 4HWNA 2XX0A 1W6LA 2A6IA 4PQXA 4RRPM 2VXSL 3EIFA 3L1GA 3FN3A 1I1AA 3ARDB 2G3NA 4C56B 4LASL 5INDB 3T3PE 4J8RA 4PAZA 4CMHB 5IUSA 5HDOA 2BVUA 1GHFL 5I1EL 3LRLA 2CKBB 4UOW1 5FYJL 1E28B 4I87A 2OMYB 5IWLC 2BXZA 1QSVA 3ZDYE 2OMXA 4HK0A 3D39E 5L7XL 2PLTA 4MMZA 1OGSA 5DTFA 5FW8A 1EZLA 4MQXC 2DW5A 1YY9D 3IMUA 5ADPH 4NO5A 2PR4H 2ZCHH 2D0HA 5IV2B 3WGUB 3RWGB 2BP0A 5JIDA 3I3BA 1JZ5A 2DI9A 4HWEL 1F8TH 3EYUL 2GI0A 4HX1B 1KXVA 1LQSR 3DV6A 4Z7VF 2B1AL 3UPRA 3OLGA 3I85A 3GK8H 3OAYK 4PTTA 2KQMA 4L5FH 4KKLD 2P5WD 4BIKA 5GS0D 5E8NB 4P3DA 4BSVA 1BYNA 4U2YA 2G9HA 1GYAA 4CSPA 5KSVB 2UWEF 1WFOA 4MD0A 1E4KA 1GGYA 2QADB 5F3BB 2X44D 1I8MB 5D4IA 2BSSA 2OYKA 2F1AA 1PS3A 3V55A 5DC2A 1KPRB 1MCPH 4N6RB 3C75A 4ODSL 2G5BA 4QXUH 4JAMA 2HVKA 1KEGH 3VW3H 1B6DA 3U7WH 4M1CC 4RISL 5MP6L 3ZXAC 5TDOB 4K9JA 2F5BH 3APMA 1WICA 3VFTA 2H9GA 1IEHA 1U3ZA 3QJUB 2UY6B 2H45A 2VZ1A 3ES6B 4L4VA 4S0TD 1Z9SB 3NN8A 2QQLL 3LZQA 4G8IA 4LDCA 1ZVSA 3FO1B 4YNYA 1ZLUK 1FFQA 1OCOB 3ARGA 4LLYB 5BCAA 2BNUA 1NOLA 3QAZC 3UP6A 4DFHA 1VPOL 2YQBA 1G7MB 3Q44A 3VSQA 3K8LA 4POZD 5E2TH 2DKUA 4L8DB 2EDKA 2C7FA 1BM7A 2VXTL 1LGVA 4L8SA 4LSTL 1JPST 2FQEA 3L5XL 1DP0A 5DGQA 1NM9A 4LIQE 3VWJB 3L4YA 5C3LD 2CIKB 3ECWA 5DK2B 3O41A 5EDSA 2X4RA 2E9JA 3UEQA 1JNLH 5BS0B 3PS6A 3N55A 3FFCE 3MX0A 5FO7A 3UTQA 1JK8A 5KYWB 4ODTL 5DUPL 2VO8A 3MRBA 3IPFA 1KTLB 5HGBB 4WCYL 4ZO7A 4GRWB 4IK7A 1BYPA 3FT1A 1E0OB 2OR7A 4YL9A 1XGZA 3V4PB 2OMZA 4BJLA 1ZHBB 1UM6L 5HI3D 4WWNA 1SDDB 4L37A 4YUEH 2NY3B 3D0VB 3VD1A 4I7ZC 2IADA 5L88L 5GGRA 3BN9C 3D2TA 3GM8A 1OP3H 3T71A 3LKQB 4GBXC 4LNRA 1ZV9A 4FQQA 4M7JL 2CXGA 1H3GA 1XZWA 2Z92A 2Z7UA 2GFBB 3D69B 3D87B 1HIMH 4GI8A 3BGMA 5HYEA 2D9CA 4Y5XC 3QJTB 5B1JA 1KZYA 2NY6B 3PE9A 3KDMB 5BUPA 3DO7A 1UTDA 1MG2C 1UD8A 3VI4F 4DO6A 3GM0A 5EO0B 3BVNA 3W82A 3T1FB 3TN0C 3LKPB 4BELD 3Q9QA 4LLMB 1WBXA 1XZ0A 4PV8B 4X0NA 4XVTL 4OJAA 4G6KH 4JRFA 4O00A 2HRPL 1TJXA 3T09A 5E5LA 2FR4B 4P3CL 5GHWL 1ZGLP 1MY7A 1LEIA 2Z64C 3GXDA 2ZOUA 2WVVA 2MPVA 4FZEH 2PW1B 2G5RA 4J3BA 3E8VA 4JCWA 2Y5TB 4WENB 5ISZD 5AUMA 1QBML 1UZ6F 4RCAA 1U8LA 4W9CC 4XCYA 1QSZA 5CCHE 4P9HC 5BO1L 3NCEB 4N24A 2PETA 3DBXB 2JV6A 2EINB 5JHLL 1FHGA 1BVOA 5I8EB 1MPAH 3N0AA 1SMOA 4PJ9B 3K1DA 4WHCA 1QLEB 5ACZA 1TJIH 3MFGB 4H1LB 4I5BA 3LEYH 1R4XA 4M8QB 5L8LB 1CFTA 9PCYA 3F85A 4JLRA 5EN2B 1OAUL 4PJ8B 4YDLC 1BCIA 3DYPA 4XCFH 5C0ND 2A9NH 3G7TA 4GIOA 1YRKA 5F7NC 2V5RA 1PLAA 5FGCB 3P02A 4PGDA 4BWTA 4HGWA 1FP5A 2ZSWB 3O3BB 1UD5A 2R9HC 2CJUH 4U3SA 4U2ZA 4LQ1A 4ORGA 5TQ2H 4WJ5B 2MCG1 3NIFB 5IQOA 2HJFA 3OJDA 4MXWL 5DJYA 3QUZD 3DHMA 4JO3L 2ZD0A 1TYRA 4XBEL 1RHFA 2AXJA 4I1RA 3A3YB 5B1AB 1IQWH 3DYMA 3TONA 5J1SC 3HG1D 4PRIB 3VD9A 5KG9A 3EFFA 5J6GB 2CKBH 3CX2A 3D2UA 4N0FA 3ASNB 1IBBA 1QLRB 3FB7B 4X6FB 4AGMA 1B3IA 4CC0A 3RHWK 1H6TA 2NY5C 1QTSA 2ZNXA 1G9NC 2KLRA 2B77A 3EJJX 3QIUC 4HZLA 1GZPA 4UQIM 3TF4A 2G0LA 4J3OG 1DQDH 3U2JA 4HS6A 2FBRA 3OMNB 4HW6A 1N12A 1ZEAL 3SPGA 2YBGA 4FMKA 1JZEA 5IHHA 2KQNA 1AOZA 2OX5A 2X38A 1U21A 2V5TA 4XXCA 2K6ZA 5H35A 3I50H 4PJDE 1KSRA 5D7JB 3GSXB 5CZVH 1E4WH 1YECL 3MRJA 4JDZB 2FO8A 4N28A 1ZSDB 4GW4A 5EUOB 3SKUD 5AOLA 3C5XA 1IT9L 1DL7L 4K8RC 1IILE 4N2CA 2BHUA 2C5DC 1CGTA 3JQOB 1T66C 4NQVA 3WKNA 4CW1B 4S0SD 3KEDA 2DS4A 3SJVD 2ZG2A 1IJ9A 3DGDA 4TS6A 4KFZC 5DR5H 5G4MA 3FQYA 5L6YH 4RZKA 3FB8B 3MNZB 4R96A 4ZZKA 4CN4A 3GMNB 1QACA 4OFYD 4UM8A 2WXJA 3GRGA 1E9PA 2XKSA 3GMOB 3CLWA 1D5ZB 2FYYA 2RFXA 5IG7B 2OW6A 2F54A 3AXHA 5GRJH 2YGNA 3B6SB 4V2CB 2PYED 3HUJE 4G43A 4KHTL 4TUOB 5D72H 1JGLH 5ENWA 5I5MA 3A5VA 4F9PA 1T4WA 5EEVA 2WQVA 4C83B 1U42A 4Y5VA 2VKWA 4LL4A 4G7QB 3V2AR 1BGXH 1SJEA 1A6AA 3GSNA 3GLEA 4CVXA 5FOBB 4X83A 5KZCD 2AV7B 2OJZH 3FB5B 2E3VA 2EDLA 1M2VA 1OSPH 5HVGB 4TXVB 3HRPA 1R5WA 5ESVA 1MZYA 1T80A 5HYQB 1AXSA 1CU4L 3HFML 2H3NA 5JDJA 3VFMB 4JHBA 3FSZA 2CO6A 4AQOA 1N67A 2DQJL 3UC2A 3UEZA 4J6RL 1IBFA 1NCDL 3OJ2C 1AD0A 4XPHH 5FYLL 3PP4L 3MLRL 4Z7VE 1T5XB 1WTLA 1NPNA 2VLLB 3MVSA 5KN5A 2IPUK 1FVEB 2VCOA 4GRWH 2WLZA 2PF6A 4GOSA 2DI8A 4TUKL 1S7QA 4MBRA 5F7DA 5FYKD 5C07A 3V4PH 3WY3A 5EO9B 3WXVH 4N20A 5JXED 1MWAA 2UWEE 4P46C 2OMVA 4QHUA 2GAZB 2OI9C 4JE0A 1F2QA 4L4JA 1FE8L 1XAUA 3HAEB 3HE6D 3KH4A 2NW3B 2UY7B 2YAOA 4B0MB 4G6FB 2IPUG 2Z31C 3QK0A 4R0LA 3LQZB 4Y9CA 1A1MA 2O5YL 2TSAA 4QHPA 3B9AA 1A9VA 3WTWA 1V3LA 4PMEA 5C6PB 3ATBA 4JRXA 1T7YA 1MQKH 1CQYA 1KN2L 5JXAH 5DT1L 2X2JA 4MGXA 3WFHB 4X7TB 4LDEB 3DTXA 1R3LB 1SLXA 2K6WA 5IOPB 2E6JA 5C2UB 4YHPB 5CZKA 4NO3B 5B22A 4OJCA 3L4XA 4FQPA 4X8GA 5FYJE 3KYMA 1E5YA 1UOVA 2C7UB 5BMFL 1MCJA 4WNQA 3OR7A 4R9HA 2WKLA 4JZNB 4XNMB 1Q4NX 1ULVA 2WSDA 3ULSB 3WJMA 4JN1H 4HZ1A 1NCBL 4XBMA 4WO4A 5LBSL 2K45A 2ATPB 2NX5B 2OZ4L 3R06B 4BDVA 4UTBL 2KHAA 2C1OB 5HDWA 1DUYB 4RRPA 3MLSL 4P23A 4OF8A 4JGNA 2VM9A 5J1AA 3HHSB 4AVIA 4XH2B 2C3GA 2AJ3A 3LB6C 3L17A 3SYCA 1NKRA 2QJDA 1DBJH 5I8KH 4X4ME 3EOTL 2GABA 1GYUA 2GJPA 2OFQA 1IGYA 3QULA 4F8QA 3QUML 2NY4B 4WI6A 1H5BA 3HMXL 4GYBA 5HPMA 4M02A 5I6PA 3WUZA 3QDMA 2WK2A 4IGBB 1XF1A 2WYHA 2ZUWA 4R7NB 1QLEH 5ERWB 2QQKH 4J5VA 1BZQK 2JMRA 1FGVL 2VRQA 5IVXA 2D0FA 1TQSA 3O2VH 4H1LH 4L8BB 4JG1L 4MRCA 5KYYA 3MUGA 3EUDA 3EDEA 4GY4A 4RFNC 4UDTA 5E6ID 2HFFB 1KACB 5AEAA 2D7QA 4URTB 3BIBX 3WFEH 1ZANH 1N59A 2EVIA 2KBGA 4FFTA 4HIEB 3I9PA 1A0QL 2VZVA 4L3CA 2UXVA 3QR2A 3WLBA 2FWOA 3PNWA 1JI1A 4ZYKB 2WXFA 5C6TH 4OD1H 4ZNEA 1Z6JT 4JDTH 4J3XA 2NR6C 4JG0H 3GBMH 1T83A 2F53D 2YAFA 4GG6B 1FIGL 3VYPA 1FJ1B 2X0WA 3IJSB 1KIPB 3O9WB 1YVLA 1AJ7L 1I9RH 4XVSL 3VI4E 4WJKB 2P3YA 1DHKA 2WXGA 5HHQA 4NNPL 5JORB 3FQRB 5JPMB 2JLLA 1LHZA 3U6RB 1T0NB 1UWXH 4LEOA 4XP6H 4F9LA 3FOLA 3DTDA 3L5IA 4FFYH 1ET7A 4HUUA 3LH8A 3ML8A 4RWYH 4Y4HA 3D4ZA 4YHZL 5FA4B 3H0TB 1CDJA 1DJWA 3MREA 3FRUB 4O2FB 4HGMA 3AWFA 4RMRA 4XCEA 2I60H 1KCRL 2XV2A 1JDDA 3L95B 2GBUA 1XIWB 3FXIC 2CGRL 3HMWH 1UZ6E 4PTUB 5EH1A 3BN3B 1KIRB 4MNQB 1HHHA 2JKNA 4FJZA 4DK3A 4TULL 4IKIA 3FTGB 1EJOH 1MZZA 2QPUA 4H40A 3NOIA 4H8WC 1NQBA 4FG6C 5AW3B 4KK5C 4LAQL 4XX1E 4QRPE 1E30A 3WY2A 3GXFA 2Y5QA 5CIPB 5B39A 4PJIA 1JGUH 1KT2B 2Z91A 3X1NA 4X5WB 5HDRA 3C9NB 4TQIA 3VWKD 1DQJB 2CDGB 2CHNA 2QV2A 3HPJA 2F5AL 1DSFH 1PD0A 4ZUSB 3P1VA 3PL6D 4ZUTB 5DSCB 4LSRL 2QGDA 1E90A 1YHPA 3RDTC 1WJ3A 3JVGC 3Q8BA 3NSXA 2ADIB 4PRBB 1SJXA 1YPZA 5H37A 4MMYA 3X1FA 3U7AA 2XA8H 4O5LL 2Z9TA 3VA2C 1VFBA 1Q94B 2EIEA 2V7HA 4QRTB 1GSMA 3G6JA 3M7OA 2EDBA 4YC2C 4WK0B 1M7IA 3LIUA 1FZJA 4OM1H 1MI5D 5KBKA 1JGEB 1SYSB 1R17A 1R24B 4NO0B 3K4AA 4FABL 4PLJD 1OM9A 4YHNB 1A1OA 3W11D 3VFWB 1N6QH 2A6JB 4HXAL 1SGKA 3OKNB 4PJXB 4XGZA 5C0RH 3WV0A 2XBTA 1RHHA 3BAEH 3O6FA 4QLWA 3RZCC 2BMKA 4Z7UF 1F3JB 3K74B 5C0BE 4PGBA 4LLQA 3SGJA 4WWOA 1CE6B 2HFTA 4M7KL 4J28A 4Z7QB 3JWNG 4F33A 4LLWB 3K2MC 4NZ8A 1SXZA 3CVIL 1Q8MA 1I85A 5KOVC 3UAFA 4U6VL 2V2XB 4ZK8A 3UZVB 1CZ8L 4AUYA 1AACA 5JLZA 5IM7A 4I0PA 1W80A 3CDCA 3RVWD 3B9VA 3FQXB 1C12A 4FS0A 2G75A 3ILPA 2J2ZB 3C5ZD 4WWID 5E1AA 1CXHA 1FL6A 3HAEH 2NNAA 2BVOB 1RLWA 1E4XL 3B9KC 3MV9B 2WNXA 4XO8A 3I6SA 4RAVA 1NL0H 5CCKL 4BUHA 5C6WH 3IDJB 3PQYB 3UTTB 1GYVA 2N4IA 4P3WA 4XXWC 3SCMC 4UNVA 3IU3A 2JXMB 3TJPA 1AZVA 4JPVH 4G6JH 2XBDA 1PTZA 2TAAA 2CMRH 5K9KB 4V1DD 3FCSA 3QUHA 1JMXA 4AQ1B 3PUUA 2EDYA 3VDAA 3O4LA 4GSQA 4M9OA 4GBXB 3VGDA 4AJWA 1A4BA 2H32B 4ZFOL 1WLHA 5JQ6L 4E9VA 4BE5A 2DLFL 4FCHA 2DWDB 2AK4B 4OZ4B 2F8VA 4BFJA 3MRIB 1CR9L 2VZUA 3D51A 4R7DB 4YGVB 4U1MA 1DVFD 1MJ7H 1WAPA 1R5IB 2FATH 5GGVL 3TN0B 5KVMC 1BF5A 3L9RB 3OZ9H 3QFDA 2X4OB 3QO1B 1QRNE 1YC7A 2FRGP 2JB5L 3KVPA 2CHWA 3UO1L 1GGIL 4LGPB 4MA7H 4DZ8B 5AZ2H 5F7BA 2JKXA 3BP7B 2VLKE 3PWVA 5DZNA 2WLNA 1RL1A 2CSPA 2OJEA 4WIQA 3K46A 4ILDA 3FUNA 1IBZA 4AT6B 3JSSA 3TFKC 3ASOB 3RKPA 3WEXB 4XXDB 5AW2B 3D48R 3RWEA 1NMBL 2HTKC 4FNLL 1JHKH 2D7TH 3UP1A 1I9IL 4PRPB 1KB5B 1U6AH 4Q97A 3EJCA 3MU3A 4IOSA 4E42B 3V0WH 3JYBA 1AGEA 5EUKB 1AZZC 1MDAA 4N0CC 1YYLL 5KS9B 1I4FA 1DJGA 1VENA 3T0AA 1XX9C 3EGDA 1PDKB 1WBYB 3KJ6H 2UUDK 3RAJL 4ZTPH 3MUY1 2EXYD 1QYGL 4KI5F 5T1DL 4AGLA 4YDLB 3A23A 1LK3H 3ALPA 1UYWH 4WFFD 3TNMB 1URLA 3TA3D 1HEJC 1ZHLA 2JJTC 4L3EA 2NY7L 4RBPH 1ETZA 4AG4L 1XB3A 1IGCL 3V4VA 2V3DA 4FZ8H 2B1HL 1FFOB 2NQDA 1CBVH 3Q8FA 1JS4A 3TBYA 2BM3A 4KTEL 4JO1H 4FFVC 5FIEA 5BV7B 1F97A 1B4TA 5EEWA 1HNYA 4YK4B 1P5VB 1E9QA 3WO4C 1TVDA 2R2EB 1AG6A 5E9DD 1X5GA 2LGNA 3KXFD 3X13A 4BHUA 1P2CB 5DD0L 5K93A 4DGWC 5FYLE 1ERNA 1TT6A 5EULV 3BZFA 2I25N 2D31A 2IALB 3EG9A 3UBFA 3VXOB 3W0WE 1WZ1H 1BAGA 2CJSA 3BP5A 2R15A 4TVSa 5AVXB 1NGPL 5I1GH 1N8ZB 4L1LA 4K3EL 3QIUB 1JCKA 3O2DH 2P80D 3FRPB 4AVJA 4PV9B 1I8KB 4OF3A 4G6ML 3P11H 4PS8A 5CIPH 1P7QB 5D6CA 2E7LA 3S2CA 4P5MB 2VUYA 3L3OA 4WUKL 3ROOB 1GOHA 2D9QB 1CYGA 2QGBA 4FLQA 3MRMA 4IOIA 1VKXA 1YUHB 4YO0A 1LM8V 3ZDXB 2R39A 1HCYA 1N7ML 3BFWA 4B9GA 1RUAH 3KNBA 3V4LA 2VZTA 1I1AC 4OCRH 2MOQA 4XB7A 5I8OL 1OWRM 4K7PH 1BVLB 4U6XA 4Q74A 1DJHA 3TPUA 1IM9B 3W57A 3WFCH 4X6DF 1N8OE 2J71A 3ZVVA 2YPLB 2W38A 2N01B 3LKSA 2QSCL 2QZQA 3EYSH 4MMZC 1DFBH 1OAQH 4F7EB 1GTNA 4FD0A 4K71C 4PW9A 4X7SL 1BZOA 1SDAB 2LU4A 3ILEA 4OCSH 5D71L 5AVTB 3ZQ9A 4N2GA 4NRYB 1LWRA 4OLWH 4B3EA 2CO7B 2QVFB 3V6ZB 5A1AA 1TJMA 5JOPD 3OB0K 2YA0A 4HLJA 3FSOA 1KXVC 4UQ3A 3IK2A 4K5OA 4IRSA 3P3SA 1X5XA 2VDLL 2GCYB 1QFPA 2Y07L 4K7FA 4HJEA 3ARVA 4WEBL 3SDCD 3T4AA 4XHJC 5IJKA 4LPTA 3QG6B 1E4KC 1JPFB 3B2DC 5M94B 3CX5J 1X9QA 1LEGB 5AWNH 1WO2A 2EYRA 1WV7T 1AAJA 4IBZA 4U6TA 4YDKL 3B8YA 3OXRA 3REVA 1QBAA 2C3HA 1T6BX 4E5XB 1HQ4A 5DRZB 1QPPA 2PW2B 1YEJL 1FBIH 4JO2L 3T1WA 5C92A 1WFNA 3U7YL 5A2LH 3EBHA 4OZGF 1DE4B 4QXGH 2WTPA 3ARYA 4O9HL 5HGAB 3DRQB 2C9QA 4G7YL 3IDNA 4UIMB 1BQHB 2ADJB 3BKJH 5F7EL 5ETUA 4Q4EA 3LKNB 1ZAGA 4P46B 3VXSA 3D9AH 2OI9B 4N90D 4BCZA 4A6YL 3ARGC 1Y7VA 3ZHLA 3GSWA 5D1QD 1TQCB 3KE0A 5LAXA 4DKFL 4PWJA 5DZPA 1AQKL 1VZHA 3CHOA 4PVNA 1CF1A 5C08A 1BEYL 1JGDB 3PXHA 4LMQE 1T1XA 1FZMB 1RZKL 4JE4B 4D0BB 1DQVA 3OQ3B 4L8SC 3SD2A 4NQSA 3ENEA 2X2YA 4PBVC 4JFFD 4U1NA 2H32H 1EMTH 3DJRA 3KS0J 3KW7A 4KXDA 3RGHA 4APXA 1ZV2A 4F58H 4J27A 4NO2A 3KZ8A 4FEIA 4GP4B 1TVBB 3N43B 4FNPA 2OCJA 2DQTL 4HUCA 1E6JH 1YMHB 3NFPA 3O3EB 4X6CF 4KZDH 2IANA 4BRVA 3IFLH 4L9LA 2EDHA 2D7OA 4HJ0C 1KN4L 1OCZB 1U4EA 2Y1ZA 1JPSL 1WITA 3HR5B 4BSWB 1X7QB 4Z7UE 3L3DA 3O6MH 4PLNC 1XSIA 2JJSA 3MROA 5I8CA 4L2YA 4JFXB 2HLAA 4XNXH 1I3GH 4J4PD 5FK9B 3RTLA 3HR6A 3THMH 3S9DB 2XWRA 4WHTA 1RZPA 3GMMA 2GUOA 4JDVB 4IRZL 1UH2A 4DVRL 4NPYA 2ARJQ 3K7UA 4FXGB 2Q7NA 2X87A 2GIXA 1RULL 2DH2A 5FUZH 1IE4A 3VQLA 4KITB 1A4AA 3PLYA 4Y9EA 4JN2B 4UNIA 5E4OA 5T5FA 4P9HH 4X0KB 3QORD 4AEIL 1KTDB 2YS4A 1J5IA 2C9XA 3N9GH 1KB5H 5D8JH 2VLJD 4LPUA 2W5PA 4LE8A 1R47A 3ABGA 4HDIB 3RIAK 3SGDH 1TZAA 2WWOA 1YAIA 4FA7B 4KMTL 3CH1A 3T0EE 5B1JC 2VH5L 3FT4A 2D0GA 3GJFA 4NQDD 3WENA 4OJDH 3QWRA 5MI0C 4NPJA 4MQSB 3STLB 1CF8H 2NXZC 4RFNB 2BRQA 5JHBA 3X3FL 1PCSA 4N85A 4KWUA 3MRHB 3FCGA 4ODXB 3W5NA 2OW7A 3KBFA 3ARQA 3KPRA 2F8XC 1E3FA 4K9EL 4N8PA 2EDTA 4PJDB 3WJJA 3O2WH 4XVJL 1FA4A 1PKQB 1Q0EA 1HL8A 1NGXB 3QJHA 5BV7H 1NAKL 1TMQA 2AF2A 4OLVH 1RY7B 2DKMA 1CFSB 4PYHA 2R27A 5I15H 2RJMA 2F74B 1PYWA 2ZT9C 3ASWA 1EZSA 1IGFL 2CKNA 3QZOA 5KJRH 1A7NL 4WW2F 4FFZL 3CMGA 4FTVE 4M1GL 5DLMH 1BPLB 1HI6A 3U4EA 2B2XH 1L7IH 5E9AA 2JTDA 4AM0B 1UASA 1HNGA 2BW5A 2X2HA 1ROCA 4H5SA 4P2QD 2NY5H 2WIIB 4M61B 1G9NH 5LGKA 4G9DA 1C16A 2DPKA 4ZMXA 3GTVA 3G6DL 2WKOA 3L3KB 3OJVC 3CZEA 4NHCL 4P07A 4H13C 2NCEA 2P44B 3MJ7A 5C0DB 1INEL 2DQHH 3C60D 4G9FA 1U8CB 1V3KA 2BSBA 2YUVA 4HWUA 3MJ8A 4BINA 4G83A 4HSQA 5I71C 4RGND 3I84A 4HG4K 2JK5A 4P06A 5SWSB 3VQ2C 2X9WA 3FO9B 3SO5A 3TT1H 3G5YA 3CC5B 5T1LD 1NICA 3CZGA 4LIQH 4RGMC 3S37L 4AEHH 4XBPA 2A1WH 1A7OL 1ZY9A 2CBPA 2KPNA 2APFA 1IEAB 3DKHA 3AGWA 4MLIA 1G7JA 4M56A 3TS8A 2ADFL 1HE8A 2BIQA 1UVQA 5ALCL 4Z7WF 4PJHF 3F7VB 4KI5E 5F6IC 3BC9A 1XBDA 1WIOA 5F3HB 3QG7L 4YHOH 1S7RA 1YNTA 3S6CA 4XVUC 5JIHA 1OIOA 3QXAA 3RDTB 4XNZC 3SGDI 4WI0A 5C0CA 4OLXH 1PEWA 2EEFA 2W07B 2WUCL 1XMWA 1JWSA 4N9GA 4XXCC 4UZGA 1GAFL 5SWZA 2P8PB 5JMOC 2IAAC 3FSVA 3K5SA 3QGVA 4XE5B 3CU7A 2F8OA 2E47A 2IDUA 3X11A 4Y9FA 5CJ8A 4GAYB 4KNSA 3PNRB 3VFGL 5AB0A 4U1HB 1BECA 3MV11 4XMUA 3QCVH 2FQGA 4JFEE 4EDXA 4BRJA 3CZNA 2OBGA 4KUZL 5ESQB 1VGKB 3BW9B 3OGCB 2HFGL 3RZCB 4DUVA 3ZPDA 3QQXA 1JVKA 1RZ7H 1XDTT 3H3PL 4YSQA 3F7PC 4YIQB 2FEEL 1OP4A 3QUXA 3BP6B 1EXHA 4WO0A 2IOOA 4HHAA 1MCOH 1AQ8A 1JRHL 2IAMD 3B34A 5FB8B 3X14B 4OLUH 4FF9A 4HV8B 4ZUVB 4F9PC 3ARSA 4MAYA 5JR1H 4Y5VC 4ELMF 5KTEL 3FQ1A 4RIRB 3D08A 5SX5H 3HRZB 4KXZI 4R2GD 5HI5D 3D3VD 3MOBL 4JPKL 4Q4IA 1RZ8B 3B9KB 3H9SE 4GKZA 3BEWB 5B4MD 2A74B 1TEGA 1G6RL 4X6DE 3SD5A 2A5UA 3S48A 5DMIH 4PW4A 3LPOA 1OVZA 4GMTL 4N0YH 3B7YA 4OUUA 4Y2DD 1A02N 3V0VA 3SCMB 2WTRA 5SV3A 3AT9A 1BYOA 4L0YA 1Y0LA 4QJ3B 1Q0XL 3DETD 5D4JA 2DM7A 2BC4B 4YSCA 2FIRT 3EJPA 4CA4A 3IGKA 4B5EA 1OCWL 4F2ME 4A37A 5C0AA 3APNA 3S98A 3TWCL 1A66A 2J44A 5C70A 2AZAA 4KNTA 4IRJB 3KPSE 5ID1A 3QCUL 3AT8A 1UZ8A 4LSSL 4C58B 1LVEA 5ITFB 4YQXL 4I8DA 3ZGIA 1CD1A 3BYYA 3EJSA 2VGLM 3G9VA 3ZE1F 3FHAA 5EIIB 3TBCA 5ADOH 2ZP8A 4OLZH 5KSAD 4GUOA 1LD9A 5DJ6B 5CBAB 2P49B 1NFDB 2WV3A 4FNRA 4R0LC 4WSJA 4R3SA 1GW0A 3NCWA 4J3TA 5IBUB 3TZVD 1ETA1 3O6LH 1UXWB 5DRXB 1YQ2A 3EW3B 1WHOA 1Q0YH 4ZUWA 4E2OA 2Q9OA 3KHQA 4X4MA 1PMYA 5I30L 3LHPL 1DFXA 2CLRA 2XFXA 1U8NA 2E27H 3CFCL 5CP7B 2X1OA 3L81A 2YBRA 1VHPA 4D9RD 4KX9A 4OZGE 4QCIA 1I31A 1GJUA 1JSYA 4K23L 4R8WL 1TTGA 4UOW0 3ZBMA 3JTSB 3WUWB 4KJWD 4WWKA 2BVQB 3U2SB 2WSKA 4Z0BH 1DLFH 1A4JB 4WUUD 1AQHA 4XZ4A 4OD3L 1U8PA 2RHEA 5C0FA 3BEVB 5DQJA 5IQNA 4BCXA 2X70B 3MO1B 1BJ1J 2NTSP 1MN4A 1H0DB 5TFSH 5FHAH 2J6EA 4NC0B 5CCGE 4J23A 5HHOB 2A38A 4IMLB 3LRSA 4L1SA 4P23C 1BXUA 3DGGB 5EO1B 2Z1KA 2HX9A 4F7PA 1CJYA 3WAJA 3MR9B 3N04A 5DD5L 1RZJC 4BCYA 1QRKA 3RX7A 4X6CE 1HKLH 1E2ZA 1H5BC 3J8F7 1BQRA 2P4AB 4CKVX 4MS6A 5F0PB 4Z3JA 3M7FB 5F96H 2YPVL 4DEUA 3D4CA 1V55B 3ZHKA 1GL4B 3P69A 4ZXBB 3WKQA 2Z0UA 4HKZA 1IL1A 3WO4B 3NQIA 3QUYA 3V7AG 5GGQH 3LS5H 3E3QE 3LN4B 3AXLA 1KLFB 4L3AA 4YSOA 3BQUD 1CCZA 3ECVA 3AS3A 2EEAA 2OV0A 3NGBC 4EN3A 1XXFC 1OT1A 1QSFD 3SPVA 4CVZB 1IM3A 1K8DA 2W0LA 4V33A 4LLVB 3RA7H 5E8PB 1L4IA 1T83C 4H8WH 4DCQB 3C5SB 32C2A 1MCWW 4WW1B 2B9BA 1E27A 1U3HA 2P24B 3IGAB 4GW5A 4BUGA 1FUNA 3GKWH 1EO8L 1T5WB 3FMGH 1HILB 4FDWA 4JPWH 4M6AA 3P0VL 4FXKB 5IQLA 3MRKA 3Q2LA 2AXFA 1WH0A 5DK0A 4KY2A 2OK0L 2WD0A 3A47A 3MMEA 3RX8A 2DV6A 2HKFL 4FI8A 4R26L 3PDOA 3E1F1 4WKZB 3S37X 4UUJA 2AERT 4NN7C 3UTPD 2BNRD 2R1YA 3U1QA 1F4WH 4Y4HC 3A22A 1FZKA 1HHGB 3GMPA 4ELDA 4MA3A 2WXQA 3CFQA 1I1AB 5LGHH 1VFAB 3NZ8A 5HGHB 1FNEB 4EZLA 3UACA 1VACB 1CTMA 3BLBA 1AS8A 1T7VA 1WIPA 2VT0A 1YEFL 1I82A 2GTQA 1WCBA 4ZFZB 4DO5A 1EIBA 1ILSA 3ZYJA 3S36H 2O30A 1KGWA 5EZIL 2OMXB 4HK0B 4MX7A 4ONFL 3R7RA 1DVTA 4MMZB 4R5XA 5DTFB 3G3LA 3DURA 1S9KC 4EZMA 1MY5A 4D8PA 2NZ9D 4NQCD 4HKBA 2W80C 1BIHA 4UMSA 3C12A 5EOCH 2Q2LA 5C7XH 3HI6H 3IEAA 5JPNC 3UPRB 1NIBA 2XG5B 5LDUA 2MQCA 2C8NA 2CPUA 4PTTB 2H8PA 4U1GC 5DLLA 4P3DB 2G9HB 3SDDD 4MD0B 2R0WH 1VFOA 2IG2H 2F19L 1T1WA 4G8EA 1EGJH 2CNZA 1FWXA 2P5WA 2Z4QA 4Q8BA 4Z1PA 1ADWA 1GTFA 1FN4A 4X80H 1UJ3A 4YHMH 4CC1A 3MV7A 2HVKB 1N2RA 5JHMA 3EOBA 4ONOA 4PY7B 3CNKA 3V8CA 4CADA 4ISVA 2B1AH 2MHAA 5L4IA 3HG3A 1A25A 3N1PC 3T6QC 4GQPH 5K1JA 4DTGH 2H1PL 3VFTB 2H9GB 2GTZA 4O2CA 4Z7WE 2Y7MA 4KK8D 1V7ML 4L4VB 3GF8A 3RFZA 4UIKL 3P4OB 4QOKD 3NN8B 1YNKH 3HZMA 1FH5H 2VLKB 4G8IB 4LZKA 3H42L 3O6FC 4PG2A 3V6FB 1ZVSB