1W15A

Rat synaptotagmin 4 c2b domain in the presence of calcium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
138
structure length
132
Chain Sequence
RGELLVSLCYQSTTNTLTVVVLKARHLPLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for the Evolutionary Inactivation of Ca2+ Binding to Synaptotagmin 4
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
molecule keywords SYNAPTOTAGMIN IV
total genus 30
structure length 132
sequence length 138
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1w15A00
4F92B 3IBEA 4TS6A 1E90A 2CHXA 5G2NA 4AJWA 4F1SA 1WFMA 5KJ7E 1HE8A 4XX5A 3DBSA 4XE0A 2WXQA 4FLHA 3OHMB 1DJGA 3L13A 4ANWA 4OVVA 3KWUA 4MJJA 3S2AA 4PS7A 2K45A 4GB9A 4OVUA 2CJSA 4WWOA 3CSFA 3W57A 2CHDA 1E8YA 4WEEA 5H4ZA 3APDA 4FHKA 4NPKA 3LJ3A 2UZPA 2WXPA 3P2BA 5G55A 4TV3A 4L1LA 1DJWA 4PS8A 1DQVA 4KZ0A 3DPDA 1RSYA 4WWNA 2NCEA 1E8WA 3MJWA 4LT7A 1YRKA 2K3HA 2YOAA 3QAQA 3RPBA 5EDSA 1UOWA 1CJYA 4ICWA 2D8KA 5H4YA 3L54A 4BFRA 3SD5A 4J6IA 2WXOA 4F93B 3JZYA 2Z0UA 4NPJA 4DK5A 2YRBA 2R83A 3IM1A 1RLWA 1DSYA 4PS3A 3QR0A 5CCGE 1RH8A 1TJXA 4IHBA 4L1BA 2ENJA 3F05A 3APFA 2FJUB 1DJXA 3T8MA 2WXNA 2N1TE 3NZSA 4FJYA 4QJ3B 2ZKMX 3QARA 3F01A 2WXIA 1K5WA 4Y1TA 3TJPA 3QR1A 3N5AA 2X38A 1DJIA 4HVBA 4L23A 1BCIA 4XZ4A 1A25A 2DMGA 2Y3AA 3NSJA 4NS0A 1W16A 2CM6A 3F00A 5CCHE 2RD0A 4ANVA 2NSQA 4FADA 2LHAA 2BWQA 2WXFA 4FA6A 4KZCA 2WXJA 2WXMA 4ICXA 3R7RA 1BDYA 3W56A 3OAWA 4EZLA 2Q3XA 4EZJA 4KITB 2EP6A 1E8XA 4V11A 1E7UA 2Q0ZX 4JPSA 1V27A 2B3RA 2CHWA 5JHBA 3HN8A 4LCVA 4URKA 5JHAA 4A55A 1GMIA 4DNLA 3ML9A 4FHJA 3APCA 2K4AA 2K8MA 3PS6A 3TWYA 3RDJA 1WFJA 4F91B 1BYNA 1DJYA 3FDWA 3QJZA 4TUUA 2DMHA 4WWPA 1DJHA 3L16A 2A5UA 2A4ZA 4L2YA 2ENPA 4QJ4B 4G11A 3PFQA 3TL5A 3CSTA 3GPEA 2JQZA 4IQHA 2WXKA 2WXGA 1QASA 2QZ5A 3B7YA 3ML8A 4Y1SA 3ZIMA 4FJZA 2CHZA 3R7QA 3F04A 3PRZA 2ENQA 3M7FB 4LDCA 4WAFA 3L4CA 3QK0A 1E7VA 3NZUA 1QATA 3L9BA 3HHMA 1UGKA 3L08A 4QAMB 3ZW3A 3ENEA 3FBKA 3ZVVA 2QZQA 2WXRA 4GNKB 4ANUA 4EZKA 2KI6A 4ANXA 1E8ZA 4BGDA 4QJ5B 2NQ3A 3KWTA 3L17A 1TJMA 3HIZA 4NP9A 3PREA 1DJZA 2ISDA 2FK9A 3PYCA 4FULA 5T8IA 4AOFA 2CJTA 2V4LA 2WXHA 1UOVA 4HLEA 5CCJA 1W15A 2CM5A 2WXLA
chains in the Genus database with same CATH superfamily
4MS8D 1QFPA 5D96B 4KQ4H 3TFKC 3IFLH 1GOGA 2XDHA 4GH7B 3HHRB 5GGVH 3TV3H 3BRFA 4JPWL 3DYOA 3H56A 4PJDE 3CZEA 4IS6B 4XOEA 4YHPA 5IROC 2E3VA 3CN0A 4NDMB 1SOKA 3V5HB 2C9PA 2NW2B 5HGAA 2X05A 4KNQA 5ACZA 1RL1A 3RIFK 3L48A 3J07A 2EDEA 1LNUB 3I9AA 2JQMA 3ZKMC 5ANMB 5I1GL 3EFOA 4YXKL 3EBAA 4N68A 4WZ9A 2LLGA 2DKSA 4ZUSA 15C8L 4A7UA 5B3JF 2DQHL 4L1DA 1HJCA 1WGVA 2B2XH 3U4EA 1A6AA 4KOBA 5C07E 4KX7A 4BFIA 1TZOA 3RDTA 3PQYD 4DH2A 1VLXA 1GGCH 3MJ9L 4FXGB 1AQ8A 1LYQA 4LCCC 1FAKT 1YY8B 2JE8A 4FYRA 4PJFA 4QGYA 5BS0A 1S7RB 1U36A 1KPRA 1GYVA 4ZTOL 3JZ7A 3DV4B 4LASH 5B21A 3IXAA 4RMVA 4N2EA 4OFVA 3AT8A 3IBOA 2YWYA 3FFDB 4MMZB 1E9QA 3MX0B 2EE0A 4PAZA 2Y72A 3D9AH 4LU5L 3SDAB 4BK5A 3BUDA 1Q90A 4GRWB 5JXEA 1JJUA 5F0JB 5LXVA 2HG5B 1A6TA 3ZLQC 3L2MA 4DPBX 3V4LA 2W9DL 3T6ZA 4G3YL 4G7YL 2J8UB 1OQXA 3HPLB 4ZPVA 3WGVB 4F33B 3MRLB 3IS1X 4QXVA 2MQGA 3CX2A 1NCDH 2NNAB 2DWXA 4P4KC 5AVTB 3HI1A 4GXFA 1A9EB 1GOFA 2AEPH 4FF9A 3P3SA 4H7VA 3DRQB 5T3XD 4KQ3L 1CICD 4MJ5A 2Q7AA 1S7UB 4HLJA 2YEVB 5HHVH 3O6FD 3IFPB 4RESB 3VB8A 3FFCB 2CDGB 4BKSC 1F02I 1C5CH 2AK4D 3UTZB 1UWXK 5FCSH 1PVHA 2CZNA 1UH4A 4FQ1H 4GP8B 4HX1A 4DKDC 1QABA 1VFAB 1UJ3A 1OHZA 1FH2A 5MENB 5I1HH 5JUEL 4GG6E 4X9GA 2B4CL 4F8OA 5IHUH 5GS3A 5E6YA 1T2XA 4MNGA 4AUYA 1VACA 1XR8B 5HP5A 3CZKA 5HVFB 1DANT 4EIGB 3QZOA 5HGDB 4NO2A 3GC3A 5IIEB 5IREA 4FTVA 4U1MB 2P7TB 1BZOA 5D7EA 1RU9L 1VFAA 1WA2X 4L29A 1EA9C 3AROA 2LT9A 3N3EA 3FHEA 3OPUA 1QRND 4HKXB 3ILDA 1MRDH 1WA1X 1YAIA 1GGTA 3CVIL 1XT5A 1L9SA 3LNGA 3P54A 5CNHA 3CNKA 3RX7A 1GYAA 2VXSH 1OW0A 5L7XH 5F44A 5F9WC 5IJVB 1BVZA 1PD1A 3QFGA 4E9QA 3H8NA 3VFRA 2OK0L 2VO8A 2PYEE 3VFVA 2IGFH 5ADPH 4W9ZA 2JJSC 1JZ8A 2VDQL 3WHE1 1G5AA 4L37A 1C5BH 4XODA 4L18A 2XETA 1HK6A 2J72A 3A4AA 1HX0A 4PJ7F 1A9VA 1GIGH 1HTYA 4WCYL 1A7PH 3NIDF 1MCBA 3IXTA 2UZPA 1FORH 5H8DA 4BIKA 4ZW3A 5KVFL 3V5HA 4RFNB 2QFRA 2X4OB 2NW3B 4Q6IA 1KIUB 1CLZH 2Z34A 1B4JH 3ARZA 3B7TA 3GF8A 2BP3A 3UTTE 2XUWA 4JO3H 3QQ3B 1KB5A 1NSNH 2KKQA 5I1IL 4EIUA 4K3EL 1O5PA 4ZT1A 2OW7A 5IB1A 1EJFA 1RZKC 4IIQB 5F21B 3IGAA 5DJCA 4NO3B 1R0AL 1CMOA 3HI6H 1EAOA 3L4TA 1JYXA 1YNKL 1FNSH 1VGEH 5E5UB 4PB0L 3ECWA 3KLLA 2V7HA 2BW4A 1E5UI 7FABL 3CFJA 4HAFA 2DS4A 1T04B 4PY8I 2EYTA 2PTVA 1TSRA 2FJGB 3D12B 3N0PB 1S6NA 1FN4A 4L8CA 4AG4H 2FNBA 4DN4H 1OOWA 1G7HA 2VMDA 1SXAA 2WUBH 4DGIL 4OJFH 3PAVA 4Q8BA 5IQ9A 1B0GB 1KB3A 2OM5A 3CX5J 3QUKA 5FXCH 4KVNL 4XE5B 2OR7A 1AO7B 2WC7A 4HH9B 1USZA 4L2YA 5FDWB 1OSZB 2HVJB 3O6ML 1XCQA 3ZDXB 5KS9A 4YC2B 1R24A 4NZFA 4KJYA 4CC4A 5DURD 2FECI 2FATH 4ZMWA 1AKJD 2ODHA 3KBEA 3QIWA 2VLLA 2X9YA 1FBIL 1F6AA 2VYRE 2JJSA 32C2B 4XMKH 4N2IA 4HS8L 3ROLA 3ULVF 2DLTA 1JPGA 1U8IB 2WP3O 3I2CH 3IDIB 4LO9A 4E5XG 1OD9A 2N0KA 3HFML 5CGBA 5DZAA 4UOW0 4G59C 2HT3D 5F8QC 1LK3L 3ME0B 3C6LA 5LGJB 2F7IA 2P52A 4JFDA 4YHOL 5GS0D 3HR5B 3N41F 2WXHA 4POZC 3T4YA 3X13A 2PYFB 4Y5XA 1OV8A 3EJJX 4LCWD 5C97A 3SY0A 3GZPA 5FGCB 5G2NA 4Y4HA 3OMNB 4ZW8A 1EZLA 3ZX1A 1I82A 3GBDA 5AAPA 4DPAX 4JFVA 1FVDB 3HLAB 2HAZA 4ZW6A 2HP4A 2CBMA 2LE9A 3SQBB 1K4DA 3W39A 3TN0B 2O5YL 3HMXA 1BD2A 1UWEH 1CYGA 3LIUA 5EU7E 3RGVC 2VDML 3SDXB 4G7RB 1Q4NX 3AS0A 5I23A 2ZX6A 5GSVA 2EEDA 1QR4A 4I77L 2J1XA 2LLNA 3ARBD 1QG3A 1CR9H 5KUKA 4H20L 2CCWA 1CDYA 4AIEA 4AKPA 2K3HA 1IFHL 4OW6A 2HT4C 2IBZX 3TV3L 3ZKNC 3D39E 2VR8A 2E27L 3PF2A 4UI2A 2EDHA 1FFRA 5F9DC 3OAUH 4FAAB 1BIHA 1L9TA 1JD9A 3VXUA 3AG4B 1YEEH 4H0LC 1TPXB 2CNZA 2IQAA 2Q8AH 1OCCB 4F58H 4YS4A 2VDMB 2X0WA 2VDLH 4YFEA 2I24N 2OMVB 2O6EA 3LB6C 2AABH 1EAPA 4AUUA 3B34A 2WSDA 3K7UA 4YLCA 1CE6B 4OLUL 2G9HB 5C09D 3E0GA 3BC9A 2WUCH 2Q10A 4AE1A 1AI1L 3ETBF 4WFEE 2YD0A 3QNZB 3N6YA 5F9OL 2JELH 3R7RA 2CA4A 4YEEA 4PRIE 5E08L 3IDMB 1L0YA 5F7HA 3L2NA 1Z3RA 4FI6A 5I1EL 4XMTA 1C9SA 1JGDB 5LAPA 3QQNA 5DQJB 1SXCA 2Y5EA 4NC0B 2HH0L 3SYCA 1RIVH 4S0SD 3FRPB 4FCAA 5B8CC 2BNRA 2IWFA 2ZKYA 3CFCL 1CGUA 1LNUA 4F3FA 3NAAH 5EZLB 4RFOH 2AP2A 3A23A 5D5MF 5BUGA 4KFZC 4Z7NB 2F74A 1FI8C 3B6SB 3EZ8A 4JQIA 4U6YB 1HL4A 4K5NA 2NUPA 2Y2TA 2GJ6E 3MGOA 5EZOH 3R7QA 3SOBH 5CBAA 1HH9A 2XG5B 3EO9L 1F13A 3KBPA 4OM1H 1G6RA 4V2CB 2O6DA 3GS7A 3WHE0 1WAEA 4JN1H 2CUMA 3QDHA 1V3KA 2BJML 3OG6B 1PD0A 2QPSA 2ADIA 3FSWA 4E42B 4HUVB 1RPKA 1U8HA 4U3SB 4N0RA 5E2UH 3K0WA 3SDDB 5C0CB 2W0FA 4E5XA 2B4CH 4NO0B 1NOLA 5TPWL 4PRBA 1MCOL 4U1HA 2YAFA 4JRLA 1AO7E 4HJGA 2D31B 2J73A 4WI7A 5C0IB 1TQWA 3C6LD 1GC1L 4HBCH 1MVYA 4HULB 3G5WA 3D08A 1ZLEA 4YDLC 3RFRA 4M62H 4WHYH 4DKFL 2XYBA 5J6HA 3EOBB 3P02A 5IFAL 3FN9A 1OQOA 2MTAA 4Y8AA 1RSYA 2NCEA 3ARBB 1IGYB 5D1QC 5F72S 5FYLL 4HK0A 3F58H 5GIRA 1DEDA 1U8OA 2OMZB 5GJTH 3T3ME 2UZIL 4XN5A 8PAZA 3WO4C 2VDQB 3D2UD 3GMMA 1T3FB 3JWOL 4ELME 4MSWB 2DI7A 4NQVA 3BIBX 3UTPE 3NJNA 1DUYB 3L7EA 1M1XB 1RJZA 1FO0A 4U1GB 2VL5A 12E8H 1FVDA 3QH3A 1PU0A 3MSPA 1U58A 4PJGB 5GRJH 4QCIB 4ABVA 3KWWA 4M6NH 4X6BA 2HTLD 1MHPH 2RMNA 1HL8A 4GP5B 4ORZC 3KPRB 4X83A 1QFUH 3T0BA 5B3NA 1D9KB 3NCBB 2CNYA 4W6XB 4YL4A 3MV8D 4YVNA 2WJ5A 3VFTB 4AXWB 3W0WA 1T7VA 4LVHB 5JHLL 4JG0H 1AD0A 5IROA 3HZKA 4X5XB 3VGDA 2Y2WA 3QA3A 1N6QH 3VD7A 4HU8A 4JO2L 2ICES 2VIRA 4RGNE 1J87A 3QXAA 2OTWA 4JRYE 3KYNA 6FABH 4N90E 3GWJA 3MXWH 4OIAA 2IQAB 5CHNB 1XCWA 4CBZA 3GTVA 1D5BA 4P2OD 4CC1A 1ES0B 5K1NA 5KYYB 3O3DA 2P44B 2EZ0D 4JGJA 1KZQA 4NQEB 3UBXA 2BIPA 2X5PA 3GBNL 1J5OH 3MJGX 4NN7B 4RSYA 4UQIM 4RMSA 5DD5H 2B1HL 1CICB 2WUBL 4M4RA 5EUOF 5DMYA 2AQRA 4JGUA 1QACA 3K8LA 1T0NA 4MD5B 4KKBC 5D2LB 2DMCA 4GNKB 3IDYC 4B95C 2KHAA 1XF3A 1OF0A 3GZQA 2VTFA 2DQCH 1K6QH 1F6FB 3DV4A 3HIZA 1CDUA 3CBRA 5I2IA 4UV7L 4FQLL 4FULA 4LLYA 5HDBF 1YEDB 1HQ4A 1I7ZA 1XGTA 4MDJB 2A99A 1K9TA 3NVQA 1J1XL 5AKRA 3BAXA 3TOPA 4O00A 1RZIB 1KNOB 1T0NB 4KWUA 1A6TB 4P49A 3VXSE 3P0VL 2DLEA 1UD8A 1NL0L 1XGQB 4QHNA 3SE3C 1S7XA 4FLQA 3UIYA 4UNVA 2F1EA 3MUHL 3POHA 3U2SB 4H13C 2MWCA 4JLRB 3NZHH 1HL9A 5I26A 3MR9B 1M9SA 3VXRA 1ZOXA 3RA7L 4EDWL 4UTAL 5J1TC 5K9JH 3CHRA 4GRLA 3O8XA 2OA9A 2ITFA 3OB8A 2YGNA 2OYKA 1UWXH 1CO1A 1AZVA 2J5LC 3MLVH 1WIUA 4QWWC 3RPKA 1DQQB 2G2PA 2WQVA 1LO3H 2NY4C 2YEZB 3AWEA 3K6NA 4Z7WB 2PO6D 4LBEB 4GQ9H 2FNWA 3AS2A 4HX1B 5MP6L 1U8HB 3L5XL 2UUDH 1YCSA 4L5FH 3BAIA 5AW6B 4BWUA 2YRBA 3BZEB 4V1DB 2E6JA 5D55A 2WLIB 3UJJH 2Y5TB 2YBGA 3DBXA 4OCWL 1CFBA 1QKZL 3VWJA 1UWEL 3T0WA 5F9JB 4XNUL 2WSKA 1UXSB 2DAVA 2VDMH 4ELKB 1TO4A 4HXAL 3IKCB 4NKOB 4PJBE 4N0CD 4I77H 3DGGB 2XZCL 1YMMB 2ZWYA 1BLNA 3KXFB 3RZCB 2EIZA 1BVNP 1H6TA 4AZUA 5K9OA 1C8PA 1ZVYA 3C5JB 3FQ4A 3L7EB 3ARSA 4KPHL 3IDYB 5IBTL 4X7SL 1YEGL 3NIGF 1GGBL 2F54B 1RJYB 4MRBA 5G4MA 1BDYA 5EBMA 4KKRA 3RL1B 1PZCA 1YDPA 4U4BA 4PPTA 2OMZA 2PP7A 1K4CB 2FX7H 5K69A 1S9YA 1JVLA 2YGOA 3GSWB 5F7EL 4Y9BA 5F89A 4S0TD 2RBLA 3OAZK 4MSWA 4WTWA 3V52H 3VCLA 2D7QA 4A7TA 1SYSB 4RDBA 4GS7B 2WLNA 3RP1A 4N0FA 1NBZA 5GZNA 4NLAA 3B9EA 1KCSH 2MNJB 5DUJA 4YHKL 5AWNH 2C9XA 5I5RA 3FQTA 1CG9B 5SWSE 3ZTNL 4LVHC 3L9BA 1RK1A 3SKOB 5JA9A 1RY7B 4HLZH 2XZZA 2YPLA 3GLAA 4G8FA 2KUTA 3H6JA 4NQEA 1Z66A 3P73A 4YFLF 3UBXB 1R9FA 4MVBD 4O2EB 4FFYA 4HJ0D 5TF0A 2VQTA 1HSBB 1WSST 1XF5A 4F7TA 3G6JA 1MCNA 1PZ2A 3RIAK 3V4VA 4PLNC 1T7XA 3L5IA 3D5OF 2IGLA 2ZE0A 1FZJB 2VZTA 4TSAL 4RFOL 3EO0B 4YVUA 2X9WA 4XZUB 2FQFA 5DD3L 3DNKA 4AJWA 5C2BH 4OCYH 3DC0A 4U31A 2XY1A 4UQ3B 3LHPL 5EC2A 1CE1L 3L95A 3X17A 3EHBD 4FG0A 1KXVA 1U6AH 1O6SA 3GIVA 5D70L 2V5RA 4ELMA 4WY7H 5EN2B 1I1RA 3TFBA 4XNQB 2GT9B 3KPMB 4XCNB 1BG9A 2UXFA 3ARGA 3ATBA 4QHNB 2YK1H 1YC8A 3HG1B 1PW3A 4GP4B 5EC2B 2FAUA 3UDWA 3PQYB 3VH8G 2APXA 3OAYK 4M6MH 1XV8A 3ISYA 3AADB 3QO0A 3BVXA 4YDLB 1M6OA 2AQTA 3QAQA 1UOWA 1LEKB 3C6SA 1F8TL 2YPKB 5AOMA 4A2FA 5GSRB 3P3TA 5CJOH 2ROXA 2F1BA 3AS3A 5DT1L 2BCKA 1BYPA 3MA9L 4Z7WA 1N5AB 4AYEC 5JW5A 4JR9L 3IGKA 1NCUA 5LHDA 1R4XA 3IMVA 1UM6L 1VFUA 4TQEL 2ZD0A 1PAZA 4I0PB 1NCTA 4S1QL 4PJCF 5FYLH 1PNDA 1SN2A 5FHAL 1AVAA 3HAEB 5C2UB 5DK2B 3UTTA 4ANVA 4OFQA 4POYA 3S98A 3F8UB 2YFOA 4EKJA 1Z9SB 2IQ9H 2F58L 5I8OH 1OLZA 4ZAKA 4ZUVA 4A7QA 2IBBA 5EF0A 4CMHC 2BMKB 3HPJB 3HN8A 1NBYB 1NLDL 3NACL 4HU2A 4QOKB 4FQIH 1JP5A 4TOYH 4IJTA 1KJ3L 1BVKA 2IAND 4UOQA 3RWDA 3RWIB 1TVHB 5HJ3A 4E5XB 1TYEB 1MCRA 3U25A 3BAJA 2B1OA 4JM2A 3SQBA 1QQDB 4IRJA 5EBMB 1HS6A 4M1GL 2XZAL 4C56A 1MCWM 4XN7A 1RIHH 1T22B 1SDDB 5CJQH 2O61B 4ILDA 4Z7UE 4AMKL 5I0ZA 2NY6B 2WXGA 4LSVL 4Y5VA 3FMGL 3KD4A 5EFIB 3O4OB 2P45B 4Z0XB 3R8QA 2W1NA 5DRNB 4N87A 5I73B 4DCQA 3VFOA 2BVOB 2WVUA 3FCSA 3FQ1A 1N10A 1CFNB 3KJ4C 2V7NB 1E3ZA 3GSXA 1LE9B 2LTQB 4ONFH 3GDBA 2PPCA 5FYJU 3FB8A 3K5RA 2B0SL 4BRJA 3CZUB 3TPUB 3VXTA 1WZKA 1EXUB 5F0PB 3PJLA 1JGUH 4N0YL 5BUPA 2WNWA 1B4RA 3K0YA 2CPCA 4Z95L 2WWKO 4A38A 4UB0L 2V2TB 4BGLA 1FPTL 1RUQL 2ZWKA 3DX1A 4FNTA 2DYRB 4NP4L 4Z7NE 2O93L 1LWJA 3C5ZB 3QP3A 3HC3L 1I9JL 2W5PA 2J4WH 4XNZB 1J0KA 4FP8L 4BK5C 2VLKA 4DEUA 2WP3T 1YJDC 3ETBJ 1X5FA 4Y2LA 2AF2A 3LRLA 4GXVH 4PJDA 4GRLC 2Z7WA 3K3QA 3L6FA 3DTUB 4XC3H 4WGVB 3RGVB 3ZYJA 3BJ91 1UA6H 3MRIB 5FF6B 5C6PB 2IADA 4IU2A 3MCLH 3BPOB 5D7JD 5J9PB 4ADJA 3TEXA 1L6PA 4P4KA 3TURA 1NL0H 3ARVA 3QPKA 1IBGH 1TXKA 5IBLC 4E41A 3X1BA 3O0LA 3UFIA 2NYZA 3DUHA 3OQRA 4YHIB 3MFFB 5IGXL 5CP3H 4LCYB 4OM0L 2DV6A 1TYJA 3RA7H 4DZ8B 4A63A 3VGFA 1NAMB 1DJXA 3L3GB 5IEKB 2VDOB 5K39B 2WQAA 3RGVA 4Y9CA 2GHZA 1EAJA 5HYEA 1G6RB 3RBSA 2YUXA 1VCBC 5DJCB 2WQUA 4M4RB 3ULUC 3MO1A 3REWA 3TBYA 1QFWM 3CHSA 4ZNCD 3ZT5A 1XO8A 2ZKXA 4FFTA 1NGZB 2UWEB 4YBLC 1XCTA 1JFQH 5K1JA 4KK8C 3HC4L 2G3NA 3HE6B 4Y5YC 3ZPDA 3T04D 1T04A 4KZCA 3L3HA 2VZVA 3BWZA 4O51B 4RDQG 3UC0L 2OMXA 5TDPA 4B9YA 4FNLH 1MF2H 2XWBB 5EUOA 3B56A 3MLUL 4DQAA 3ULVE 3C6SB 5CSBA 5SWZD 2DIAA 2NLJB 4HIIA 5DZJA 1AS6A 3N9GL 1ZHKA 1H8LA 4KRLB 4MA3B 4PJEA 5FKAA 3ZO0A 2E7BA 1OCWL 1OCRB 2KLTA 3HMXH 1MCWW 2EDDA 2BXZA 3FCUB 4XVTL 3D3VD 3A6BL 3U46B 1BVKB 4X7EC 1EWHA 1Y6MR 1YEKH 5F1SA 2IPTL 3HJEA 4EI0A 4BFGA 5HGHA 4WAFA 3QK0A 5D2NC 4MVBC 2ZOLA 4HGKC 4MD0B 4UMGA 4U1JB 4IKIA 4LLMA 4I48A 3EW3B 4KK9C 5F3FA 1XEUA 4LLUA 4K5LA 2P8MB 4BKLB 1AHWB 1U8PA 4F15C 5CEZD 3AT9A 4EUPG 2V37A 5AKVA 4OFYA 1NAKL 3BUQA 2C1OB 3SD2A 1IEAB 4NO5B 1OLLA 3PP3H 3V0GA 4AH2B 4APXB 1HZHH 3GDCA 5HGHB 1TVHA 3A4FA 4HP5A 5HJ3B 3IBEA 4R97B 4OF5A 5AWNL 3TZVD 4HV8B 1QOKA 3P4LA 5T5FA 2BSSA 3TNMB 1AGFB 1IE4A 1UXMA 1MVUB 5AVRB 3LEVH 3VFTA 2A77L 3PHQB 3GK8L 3COOA 4YDIH 3W0WB 3GB7A 2CKBB 3NSDA 4QO1A 4ZFFB 4X4XB 1J05B 2V9QA 3O2WL 4OB5L 4QYOA 1W9XA 2ZJSL 4PR5A 4P23A 1DQVA 3O11A 5FLVA 4RH4A 3S0PA 2X41A 3KXFD 1JI2A 3HAEH 5GSVB 3RZCD 4OCYL 3F5WA 5EDSA 1AGDA 2CCLA 2DQDH 2R0LL 4XP5H 4PHXA 1L9PA 1AGBB 5D7IB 4YWGL 3D87B 1XGYH 1RUAH 2B16A 3D69B 2X2IA 1RKRA 3GFUA 3Q01A 2V33A 3SOTA 4AENB 1LK2B 1R6VA 2QSQA 3HHSB 4K4KA 4GRLD 1FNAA 3Q2NA 3NIFF 3V6ZB 2N1TE 4U05A 2VSMB 3OSVA 2OJEA 1ED3A 3IE9A 4FI8A 3ZDYB 4JFSA 4D8PB 1VRSA 2R29L 4L0ZA 2DQIL 4AM0A 4BH7A 5JHDA 5LBGA 3E9TA 1UB6A 2VDRL 4MB5A 3D4GA 4U2YA 5ADOL 3WEMA 5I19H 3C2AH 3WIFB 2BNRE 5IKCB 2E8YA 4NOFA 2BK8A 3CFTA 4XPFH 2H41A 3FBQA 2VSCA 2WWKT 1TJGL 2IXQA 3MGAA 3FL7A 1QSEE 3HNTL 2JWYA 2EAEA 2PP9A 5A16B 4D8PA 3MA9H 2XN0A 3SIKA 4K8RD 4CU8A 4H2AA 4PRID 4KMQA 1PKQB 5EBLA 3PS6A 1ZTMA 3FT9A 2P24A 5B8CA 3MRNB 3CFDA 4YHIA 4FQQA 4M61B 2VR7A 3DVGB 3HB3D 2YSSB 3AU0A 4HH9A 1BP3B 2W60B 1XDTT 3C8KB 1E4JA 2TRYA 2PWFA 3EYFB 1Q94A 2WYHA 3D85B 3SKMB 4ZYKB 5DJDA 4MJID 2NY5C 1UJ3C 3MTRA 4LBAA 2NX5A 3PRZA 1CLYH 3LH8A 4MD4A 4HQQL 3VQMA 3I9PA 1QA9A 3WLWC 2IOMA 4YN3A 4FQIL 2GJ6D 1ITBB 3ESUF 4AMWA 4AKQA 1FJ1B 1OARH 1KIQB 1MHHA 4HS6A 5KVFE 3WG7B 4J1UA 3VFSA 1I3VA 3NT0A 4R6UA 4LSUH 5HHMD 5E2TL 5CBEB 1SJXA 2XBDA 1T0PB 4TUKL 1GL4B 2XPYA 4MBOA 2OMBA 1WHOA 1E9OB 4K5MA 4OCXL 3OQ3B 3DBSA 3MHZA 5HD8C 1XFPA 2BNQB 5TE7H 5J0BA 3A22A 4KH9A 3PL6A 5HYQB 3BX7C 5CLWA 1QRNA 4EXPX 4F37K 1HHIA 2YC1B 4N6QA 4Z7WF 1BFOB 1FFNA 1D5MA 2D0HA 4KHXH 1GS6X 5B1JC 5F7LB 1HYRC 5FYKU 4G7SB 2AGJH 4HHWA 3TVMD 4OKDA 4XHJD 4BJLA 2QQLL 2ZPKL 5EBGA 2OI9C 1HXYA 4CGUB 5J12B 2YC1A 3T3PB 3I6LE 3SJVB 4FI7A 1G9ML 2WVVA 5DVKA 6PCYA 3QI9A 3GMOA 1OVZA 3IM1A 1HCZA 2VISB 3RB7A 3HC3H 3VDAA 4TKWA 2IC2A 5T5NF 1LO0L 5D96C 4KVPA 3T8MA 2VERN 2NY4D 2ENSA 1A7OL 2WB7A 3BP5A 3M7OA 2CLVB 3MA7B 1UTDA 1G6RH 4XPTH 1GAFH 3JVGC 5F7UA 4KV5E 1I8AA 1A47A 4D9QE 1IX2A 4PJ9D 4J2XA 2GAZA 4NCC2 5I1AA 1T03H 5IW6A 4ZXBB 1TUPA 1A7RL 1DN0A 3BKCL 1SJMA 5B3SB 2NW2A 2ZXWB 5HGAB 5LG1A 3VFRB 2CLVA 2LAGB 3BKJL 3VWJC 2EC9T 4UQ3A 2WINA 4N3UA 3GSVA 1QLFB 4HUWB 3GXMA 1T1XB 1KC5H 3TWYA 4CSTA 2Q1EA 4TXVB 2GK2A 5T1KA 1FC1A 3KGUA 2E7CA 2WWNA 5DS8B 2ZAGA 2J88L 3ULSA 1F6LL 4MX7B 3Q8EA 2G60L 2VITB 4NWUH 4N22A 4ZFOA 4XCEA 5FA3B 1AHMA 1PKQA 5EBLB 5SX5H 4EI5D 1E27A 1MAMH 3VGGA 2A73B 3SKUD 4XAKD 4PRPE 2QTEA 3MVSA 5AQ0A 2HLEB 3K1DA 3NJIA 1ZD6A 1QNZL 3C9NB 2V2XA 3EUDA 2N0MA 4AEIH 3KPQB 2MOQA 3X3GL 1EJ8A 2J3SA 4ZYKA 4X80L 1PKQE 1X5YA 2C9SA 4LCWE 2K0RA 3HMXL 3PGDA 2CJTA 4GEJA 5DRWB 3TH4T 2XCMC 5HHOA 5IQNA 2X28A 4HCFA 5I1HL 4OI8A 2Y9RT 4NSKA 3MODL 4HOMA 1JOIA 1IVLA 3LKSA 4J3UA 3NABL 4BHUA 3SODB 1TQSA 3TJEL 4OZGE 4I3SH 2DQEH 3A24A 3MC0A 1HHJA 2HFEB 4PG2A 5FB8B 2CPUA 4FQXB 2KDGA 2V3EA 3MRGA 2YEQA 4PUBH 3T2PA 3QE5A 3GUTB 5CGMA 1NAKH 3L2LA 3UZVB 3U2SA 3V4PA 1PTZA 1VFOA 5E5RB 2ORBL 3DJZA 5TF1H 5FYJH 1OY3B 4BEIA 3SZKC 4KO9A 1F3JA 5JXED 4U6TA 4NZUL 1BAWA 3KH4A 1O7SA 3JSSA 5CINH 2ZWLT 3MLXL 3QDMA 1AANA 2WLYA 1PZUB 3BIKA 4RLDA 5DRXB 4EPSA 5CJ5A 5CCKH 4WU5B 5HHNB 1T80A 5CSZB 2BLFA 4IHBA 3PAUA 4IBYA 2WAHA 4WCYH 3RFZA 1N64H 5D7LA 3OXRB 3LCYA 1PKOA 1YMMD 1PX4A 5C09E 5FC9A 4RDQF 4J3VA 1B4JL 3F6JA 1XGZA 1INEH 2QEJA 3JV4A 3VSVA 5KANG 3BSZL 4GUPB 1JNNH 1WA0X 4Y1AD 4LQFH 2NTFB 4IKKA 3WNKA 3QYNA 1YUKB 4XBPA 3D39B 4MA7H 2HVKB 5C08D 1JWUB 3KL0A 4HIHB 2MFNA 4PJDF 3RGVD 4ZSOE 1SHWA 3Q2VA 2HX9A 5FUZL 3KWXA 2OMTB 4TTDD 2CLRB 3BEVB 2WZPA 3HR6A 3CXDH 3KR3L 3QXAB 3IU3A 2JKRM 1CK0H 1QPXA 5EZPA 3SDAD 2A74C 4QTIL 5ALCL 5AG9A 1SLXA 2EIDA 5C71A 4KJQC 1CS6A 3W82A 1IV8A 3O0RL 2P5WA 4H88H 1SQ2N 1OF2B 1XIWC 2XTJE 1JMXA 1T1XA 3RGHA 4PJ7B 4ALAL 5LQBH 1M7DB 3BZ4B 1M2OA 1IMHC 5C8JA 2A9DA 2UWEE 1PDKB 4DFHA 2QSTA 3O3BA 2BVPB 4Q0XH 4Y16D 5DLML 1KBKA 1RFDL 4OFPA 5EU4B 2JK5B 1QPPA 1HINL 3DHJA 3DTDA 5IVZA 3TA3D 1KCLA 3FSVA 2HYMA 2HN7B 2CAKA 1OF2A 4AJ0A 1CF8L 3HAEG 4QAWA 2AITA 1SRDA 2N59A 4KI5D 1GW6A 2PO6B 1F5WA 3NCXA 3LZFH 3MAWA 2HZHA 5IB5B 1ZPUA 3RTQC 2GUOA 5B38G 4MFHA 1W2KT 2CHNA 2A6DB 3AG3B 3HEIB 5IEHB 1AO7D 1PY4A 1U8MB 2FATL 5IW3A 3WLBB 3GMQB 1NCHA 4YXHL 3WKML 4NQED 1NFDF 3NJLA 2G2RB 3D3VB 1JDAA 1LO2H 2EH7H 3DX8B 1Y6KR 1Z0MA 3I84A 4HJUA 3KS0H 4JFHE 1BAFL 2ICWB 3K72B 2CCVA 4HETA 4KJWD 2WTRA 2JI1A 3H3PH 4JFEB 1S7SB 4GMSH 4J28A 4X9IA 3HG3A 5JIPA 1P4LA 2JFCA 3UZQB 4DOHB 1U8KB 2ITEA 1OZTG 3BI9X 3BW9A 2KZWA 4IEFB 1U2CA 1HL5A 5J6GB 2M83A 2XPZA 3SDYH 5LGHL 3D4YA 3U4KA 1ADWA 4G80B 5HPMA 2HFFA 4XCCH 5DZLA 4UQCA 5I1GH 1U91B 1PYWA 3BP7B 3QG7L 2Z31C 1FLTX 2ZOLB 1U8KA 4MD0A 2FWOA 3K4DA 1BZ7B 4MD4B 1P5UC 2PYFA 4Y5XB 5I8KH 2WCSA 4ODXB 1NUGA 1V05A 4BKTC 2MNWA 3D18A 1PBYA 2X4UB 2E27H 4HCRA 4MNHA 5HGBA 1FL3B 2NTSP 4APQB 3ZL4L 2JCWA 4X7CC 4ICXA 2XV2A 3US1A 1OGTA 4WUKL 2MQ0A 1X3DA 2OV0A 2D31A 4TRPL 1D5RA 4AQAA 2WQXA 4PB9H 1I8IA 1IAOA 3KYMA 3S2CA 4PJ5A 1JTPA 3EJUA 2OZ4H 4NNXB 1A3LL 2YQ2A 3EKCA 1WZLA 4HHGA 4I2XB 1FNEB 1WO2A 3IMTA 4YGVB 4EI6B 1ZEAH 4PREA 5AYUL 4Y19A 2BZ7A 2X42A 2K7PA 4KI5F 4IQHA 4RX4D 2FHBA 1JHKL 2JELL 2OMWB 1SDDA 2W38A 1EO8L 3LS4H 1B2WH 3HZVA 4CW1A 1U2YA 5KN5A 3B9DA 4OAWA 4A6YL 2V9RA 3BAWA 4TNFA 2I9TA 2MTPA 4HZLB 1TTFA 3UBHA 3HRZA 1E65A 2FTAA 5CZRA 3BZ4A 5MI0B 4YGVA 1JZ7A 5JIKA 4BZYA 1OAKL 1QBLH 2C3HA 4XMWA 4JREB 4AVJA 1WPCA 4X6CF 3AWFA 2ZUQC 4KRMB 1QPKA 3GIZH 4F80A 1HHHB 3GJFB 1U9KA 2YUVA 1WFNA 3WNNA 4LSDA 4XB3A 4WLCA 4OCNC 2GPZA 1G1OA 4GMTH 4PV8B 3ZKQD 3BQUD 3E6FB 3TBSA 1X4YA 4DP9X 1K2DB 1S5HB 3O6FB 4X0KA 4XPBH 3VMPA 35C8H 5FHBH 1E4WH 2PO6A 4OM1L 1V3MA 2WYZA 4OVVA 4LOUD 4B5ZA 1H0DB 2PETA 2F7OA 1JDCA 3SPCA 4BFOA 1W6WA 3C60C 3T8XA 3H9SB 4H26B 3FQYA 1HWWA 1MRDL 1W80A 5JW4Q 1WAAF 4UQEA 2NW3A 3W11C 5CHNA 1TKWB 4HIJB 4HDIB 5L7XL 4MA8L 5IFJB 3AB0B 3PV7A 1KLGA 5ID0B 1IQWH 5ES4B 4XPHL 3WGUB 3QNYB 1DEEA 3RPBA 1I1AD 1UYWH 1LM8V 4FXLA 4S1SL 4DQOH 1XX9C 2IPUG 3NABH 1N9PA 1SYVB 2EH8L 5DD0H 5CEXA 1HNFA 1RZ7H 5T3ZE 4N25A 4D94A 3GT6A 1N2RA 1KTDA 3SDDC 5BZWA 1MFMA 4J3OF 2L0DA 4RNRA 3X12B 3Q44A 2O5ZH 3Q3GB 3DECA 5L0QB 1AKPA 4LGPB 3TF7C 1CD0A 2I07A 3DXAA 5TE4L 4R5XA 4FXKB 4IOIA 4G8IB 3MV9B 4JFYA 4TTGA 3HBGA 4M5YH 2EQDA 5DK2A 2LHAA 1UXLA 4WO4C 1CLOL 2H3NA 5GS1C 4BBWA 2BOCA 3D09A 3EJRA 2NY3D 4NQCD 4P48A 3DGCR 1YYLH 4J3XA 4A6YB 1N64L 1DQLH 4LGRB 1W0VA 5KAQG 4DNLA 4W4OA 4G5ZH 3EOTH 5J6HB 3CN4A 2ZCHH 3GM8A 3MPCA 2HB0A 4W4NA 2H3NB 3OAZH 5I8CB 2QGBA 3PWJB 4N2KA 4FZ8H 3OB0H 1KJ2B 1EMTL 4IRSD 4R0LA 4A6YA 3P4OB 5KZCD 4N5EC 1DFBL 5ICYB 2AQSA 4L3EE 5EULV 3U82B 2A6IB 3D34A 4NZDA 3VRLE 1M71B 1BIIB 4HPOH 4ANUA 4F2MB 3ME0A 2OAAA 3MI6A 2NUTB 1KEMH 3ZYIA 3R0MA 3HR5A 1G43A 2DQ6A 4N0CC 2XICA 4FLRA 5EU6D 2UX7A 1BLNB 1ITCA 4IRJC 2WXLA 25C8H 3R06A 1GGYA 3BUYA 3M17A 4YPGB 3E8UH 5A2CA 3CXFA 3KVDD 3NCFB 2CGYA 1JYNA 3FHQA 1AKJB 2VT0A 3PABB 3HCVB 4N86A 1IO4C 3KWUA 3VVVA 1RJLA 1Q72L 3LXBA 4JZJC 2PXYC 5D8JL 3UAJD 5D2NA 3HFMH 2QL1A 3Q5OA 3VTMA 3WNOA 3CSFA 1ZS8B 3S8WA 4NN5C 2DQJL 3GI8H 4NM8H 5FO7B 1BQHG 2P80D 4U0RB 4W9IC 4P23C 1CLVA 3FTGA 3LZNA 2Y22A 4AIZA 1ZTXE 3PHQA 3WY4A 3K71A 3O6KH 3LIZA 4NQXB 2KL6A 4UAOC 1XZWA 3HTLX 3GEFA 5DR5H 1FP5A 5HI3D 4LCWB 3N06B 1HWGB 5LCVA 2CO1A 2AEQH 1MFBL 2CIKB 1CFQA 3IGAB 5LXGL 4U49A 4OGAC 2E76C 3H9SD 1D5XB 4LIQE 4QTFA 4RFEA 5AAWC 3SE4C 4I0KA 3LEXB 2DD8L 1GPOH 4PS3A 2EH7L 2EYRA 2O5YH 1BQLL 5AYQA 3QZWB 1K2DA 1S5HA 3BJLA 4K71C 4X0KB 2EVHA 1KCUL 2BWDA 3BPLB 4M7LL 1MJ8L 2K7QA 4JFED 2FT7A 2H26A 2AKRA 2XXFA 4X4KA 1UT1A 3OBAA 2WOYA 2IFFL 2L04A 3ZZQA 2FSDA 3K74B 4FABH 1MFAL 4R9HA 2XLLA 5L88L 1LO3L 1PAMA 4W9CC 2XJKA 2OJEB 4L8CB 1UOLA 1PG7X 5HHMB 5DZNA 1Q9LB 2GJZA 2RCSL 4Q74A 3V4VL 2QHRH 3OAUL 2DKMA 4R8WL 3JUZA 1NA8A 5B39B 1NOFA 4C56E 4F58L 5C3LD 4G42B 1QKZH 3NSFA 4QKXB 1XF2A 3JTTB 1QSED 3CPLB 3DSFL 3BWUC 5AVXB 2AXGA 1BFSA 4Y16A 4A55A 1TQBB 5GS2H 4H1LH 1GR7A 2AABL 2JKSA 3LXAA 4FCHA 4PJ8C 5KSUA 3VI4A 5T1LA 3LKRB 2GJ6A 4JO1H 5CJBA 5BXFB 3BKML 3DOSA 5HXMA 2R9HD 2H1XA 2M26A 1PL3A 2VRKA 4NN6B 3BPOC 1R5WA 1WT5A 3UPAA 1KWGA 1MLBA 3RVTD 1OGAB 1DDTA 2EXYC 4WI0B 1ZLSL 4MJHA 2I07B 4WUKH 1MWAH 4FXKA 3I6KA 4MJIE 3OKLB 4DN3H 3TO4D 3LZPA 1E6JH 4JHAH 1JIBA 4M7ZC 5T1DH 3JYBA 1KJ2A 4UF7C 3GRBA 2BCKB 2I85A 3VM7A 5BVJA 1N5AA 2AXWA 1AHWA 1U8PB 3BLPX 3MRKA 5FFLA 2VR6A 3ULUF 3P9LA 4HCRL 1ZKAA 5D4IA 4PRAA 3WN6A 5CAYB 4GKZB 2C9VA 1JMZA 4MXQC 5HDBB 4D7PA 1JWSA 1W15A 2G3XA 2E56A 3I6KB 3WY2A 2V2WA 5IJBC 3NAAL 4PJ9B 2H6PB 2XWJA 5J7CC 2KZ1B 3S8GB 5DSCA 4L9LA 3NIFB 1U3JA 3I3BA 4K3DL 3W9DB 3MQIA 1IEBA 1WD9A 3DRQA 3SPIA 3WTTA 2J6EL 2ZICA 1A7BA 2HT2D 3EDEA 2NSXA 3O2DH 4A37A 4Q2ZB 3H2PA 4G6KL 4JN1L 4PW9A 4BK8A 5JHMA 2FJHA 4ODWB 3FT3A 3P9MB 3KPSD 2XKSA 4X8JB 1ASQA 3N42B 2WBWB 4AVKA 4CADA 5CMAB 4YXLH 3T1WA 3QC5X 4KX8A 5D2LE 1DQIA 3D4CA 3ESVF 1P2CA 4KHTH 4E41E 2DQFA 3JTSB 4P59L 2EXSA 3TA3B 4MQ7B 4L05A 1UWFA 2VJ0A 4AQ8C 2VAJA 3GLEA 3OKNB 2AV1A 1WC7B 4GINA 3MMEA 3AAZB 3L3JA 1QSVA 1QLEB 3B9KC 1BJ8A 4JL1A 1Z9NA 3LKOA 1KCWA 3I6LD 3D69A 4OCMC 3LN5B 4M1DH 2OPCA 5AAMC 3HFFA 3D07A 3X1FA 2KT6A 3FB5B 2X7LA 4DCQB 4ZUTA 1M42A 3TVMA 3TYFB 4EQ3A 4NUJB 4G7QB 4JGMA 4RA0C 4M6ML 2FBJL 2DMGA 4BUGA 5D9SB 4FG6C 2YD7A 2VXQH 4PRHD 2R1XB 5IMLB 1CZ8H 2MJWA 4BA0A 4TF4A 5GJTL 1OO2A 4J3BA 3MNMA 5AZ2H 2UZIH 4HUCA 4G1MB 3QUXC 1CFVH 1O6SB 4LFHD 4LKXA 4BUHA 2FGZA 3KGTA 1NAMH 3KPOB 5LG6A 3BH4A 2B3RA 4AQ1C 1UATA 1OSPL 5KAQF 4LSRH 1MXDA 1WIPA 1ZT7B 4AT6A 2EYRB 4U3HA 4TUUA 2VZOA 3UTSB 3T6WA 3KYOB 4WFGE 5H37G 4YR6A 3DVGA 2ZSWA 4H2CA 4M8RA 1CL7H 3UO1H 3WKQA 3ZQXA 1IUZA 1A2YB 3US0A 1MCSA 2WNKA 1TZHA 4LDLB 4BFNA 2DIJA 4ADIA 3JBG7 4ZTPL 1YNLH 1MUJA 4B41A 5EEVA 4X5PA 1LE5A 2CBOA 3NZ8A 3GI9L 1N7MH 3HA0A 4FL4B 1OB1A 1A6UL 5HY9A 2WIIB 1Q1PA 3PCYA 4L3CB 2IOOA 2BS9A 4EZKA 4ZOCA 1Z9OA 1Z5YD 4XVSL 2Z31A 2GYSA 3SHSA 3B2DC 1HQ4B 1I7ZB 1XGTB 4WNSA 5D1XB 3WE1A 1IBBA 5CJQL 5DQDH 2XSKA 4U6VH 4MMZC 4L9DA 1J18A 4P23D 2HG0A 5DVMA 1DSFH 4MQXD 4DKEH 2IPUK 3Q8AA 3NYKA 5KTEH 4ZAKC 3F7VB 2H2PC 3RJQB 5A43C 4G1EA 2DQMA 4OBSA 2X87A 4MXQD 1TJHH 2FBOJ 2K45A 2H32H 2PCPB 3VXRB 5H35A 1FG9C 4NOBA 4QHPA 4I2XE 4UV7H 1IKNC 3HBPA 3PGFL 5HVHB 2X6VA 2G75B 2FQGA 1DQQA 4N9GB 2OYPA 2PUQT 3VFNB 1E5AA 1ID5I 3E8UL 4GAYA 3TFKD 3MU3A 2X4SA 5CLYA 2R56H 5HSFA 3SN6N 1DUZA 2EXTA 4JFZL 3TF4A 1H3PH 3S88L 1MCFA 2VXVH 4X6DB 1UJTA 5AENA 5BO1H 1OT1A 3WL9B 1ZT4B 2UXVA 4MDRA 1DQDH 5C08A 2VN5A 3EXJA 5B1AB 2YD9A 1WC7A 3VSQA 3D8MA 2XWDA 3PWPD 2XIIA 3NRFA 4LLUB 3SDXE 3VI4F 2X4SB 3V6OE 1HAUA 4EMZA 4PGCB 5KSBF 1BPVA 3GS0A 2MNUA 2IH1B 4FYTA 5F7FA 1XXDC 1A14H 1YN6A 4Z7OB 1JHTB 1IZKA 1RK7A 5MP6H 4F57L 5E4EC 4JKNA 5DJAA 5JPMA 2VERA 4ZPTB 5T5FL 2WQ8A 1KCUH 4G8GB 4Y2DA 1QSFD 3FF7A 1S9YB 2R69H 1NCIA 1PZSA 3ILEA 4FQCL 1OTTC 1OAQL 2APVA 2AQ3A 4B9PA 4BV1A 1UCTA 2JNZA 2O4EA 4JVWA 4TSCL 5DJAB 3ZE0B 2ALAA 1F1DA 4Q97A 3WN5C 1YEGH 5J9PA 3HC0B 5J13C 4LLWA 1K8IA 1JRHL 2VDPH 3G6DH 4ZDHB 5L4JA 5ID0A 5KWYC 2VN7A 2FH8A 2JKWA 3U1QA 3S37L 4B0MM 1XGUA 1JTTA 4WHDA 5I2IB 1P7QD 2Y7MA 4BH8B 2FX7L 4G9FB 5IHWA 5ANHA 1E8ZA 3QDJD 3V52L 2BRRL 5I1DA 3DX4A 5IVZB 4FTDA 3MBED 4LCIH 3LEXA 1CYWA 5MERA 4L4VE 3PXHA 2P47B 4TVUA 3MRHB 2VLJE 5EEYA 5JW3L 3QUKB 2D0FA 4KBPA 5JOEA 1FDLL 1G4RA 1Y18A 5E6IB 1FNHA 2OXHB 3V6FB 3CVHH 4NQSB 7TAAA 1IBZA 1W91A 4XMPL 3PDOB 1BFVL 4X6FA 1TZHB 1YEIH 4R5TA 3DV6B 4DK3A 2J1WA 3E6HB 2OL3A 3QJSB 4JQVC 3B7UX 1BVOA 3VXOB 2WKOF 3EH4B 4GIAA 4TLSA 4S1RH 2IEPA 1FZOA 2AJ3A 2PW1A 2N4IA 1LWRA 4Z0BH 5E9DD 3ZE2F 4K3DH 1AMXA 2HJLB 1CJYA 3FU7A 8FABB 3L5JA 3DV6A 5IT2L 3VH8B 1TITA 3LDBC 1UXSA 4JEGB 4G6KH 4JFPB 5D1ZI 5IOKA 3GK8H 4ES9A 4YDIL 3DI2B 4OD1L 3C5ZD 3J2PA 4F37F 4IEFA 3VXRE 3FT0A 2BCMA 1J1OL 3WTSA 1DJIA 4A39A 3HN5A 1I8MA 2Q7YA 4OJAA 3F12B 1IFRA 4UCFA 2ZKHH 4XO9A 2MCPL 3RTLA 4KKLD 1JE6A 5BRQA 3RJDA 3DK2A 4FADA 2Y1AA 2J55A 2X4NA 4XT1C 3LKQB 5F3HA 4FA6A 3SBWC 3QUHA 4WKZB 4BUQA 2AQPA 4GKZA 1MVUA 5L8JB 4TQIA 1WCBB 4Z77A 3LN4B 4Y4HD 1J1PL 2Z0BA 4QY8A 5ETUB 3IJ8A 3RWDB 1SN0A 1F00I 5I6LA 1QEXA 3APMA 3TO4A 3SYAA 1CQYA 4KKCD 1URLA 4ZPTA 1GY1A 4KTYA 5FUCC 3V0DA 1S7TA 4YSEA 1TJIL 4K94L 1FC2D 3IJSB 4KDWA 1OAZH 2KLSA 4MAYC 5D7IA 5KVEL 3LYRA 4FTVB 4U1MA 3VD5A 3VXQA 3NCJH 3IWVA 4GIOA 3FTXA 4Y2DD 3MNZA 3STBA 1OOAA 1CGTA 4U6HB 1NLDH 4TOYL 1CXEA 3QH3B 4ZO6A 1HYSD 1IL1A 4Z7OE 3I3EA 3QWNA 5DZOA 1IGMH 4M1GH 4MB1A 4YE0A 4YXKH 2FDBP 4DP6X 5DA4A 1UEYA 5D4HA 4Y4KA 1KZYA 4UT6L 4XVJL 5FFOA 2W65A 4X4ME 4HUUB 1BXAA 3RVXC 4AX3A 3SCMC 4Z7QE 3QUMH 4RAUA 4BXVA 1AQDB 2VIRB 5F70A 3LNIA 4KZEH 1D6VH 3HUJA 4G8GD 1T6BX 5I15H 3IDXH 2NY3B 3QO1A 2V8MA 1MCDA 2VN6A 1S7WA 4OGYH 1OAYL 3P77B 5ENWA 2XA3A 4LPWA 3V95A 4WTXA 5E99H 3QO0B 5L2KE 5EPMB 4HIPA 4D9LH 3FF8A 5HHXL 4KY2A 5IQMA 3BP6A 4IBQA 1CD8A 3D05A 2Y07L 4U6XB 4LPYA 1NBVH 1RAMA 5FWQA 3H3KA 3AXHA 5GGTA 4PJAA 2W9DH 1KN4L 4CJ0A 2Y23A 5GGVL 4X5WA 2J25A 3A3YB 4MJ6A 5BUAA 4UT9H 3JV5A 2A9AA 3CDFA 4Y1AA 4IMKA 3CFNA 1NCDL 5T1MA 3ROOB 3E1F1 1FJ1A 4E0RB 2AEPL 1IQDB 2WO2B 1KIQA 2X4TB 2XG4B 4OI9A 3FU7B 4QRPA 5T3ZD 2JKXA 3H9HA 4V1DE 1Z6JT 1I9IL 4GXVL 4MNQE 3S5LA 2R0ZH 3NZ8B 4JPKL 2E9IA 4GRWF 4M8UA 3NGBC 1C5CL 4PJBB 5GQBA 4F7EA 3EO1A 2CM6A 4CA4A 3STZB 3MOAL 1FF5A 4L48A 2ICEA 4JLRA 5HYQA 3IAPA 1CDIA 4RBPH 1NIDA 5BRZE 5AVQB 4XMXA 3V6OC 2C9UA 5DGRA 5BO0D 3ZDZB 4XNYH 5AVWB 2FX9H 3H42H 3MACH 4URKA 1A7OH 5J3HD 5I75B 4BQ9A 5CGYD 5DMIL 4FQXA 4JUTA 5FK9B 4XWOD 3U30C 4APQD 3BZDA 3EJZD 1EBAA 2CK0L 3GMMB 3QUGA 4H8WC 3NOIA 4Q6IC 3E2HB 1IGJB 2Q3AA 3RWCA 2JI3A 3AM8A 3EYQC 3WN5A 5I8CA 4C47A 4FNLL 2C9QA 2EDYA 3B43A 4N20A 3U4AA 3V7AE 5HGGS 2GSGA 4HALA 2Z8SA 1PNCA 2AJUL 3TO2A 5JPNC 4KI5E 1TQCC 3NN8A 3L17A 5D93C 1YECL 2Z64C 3BGAA 3DROB 5C0BD 1D7DA 3GSNH 3SDCC 2V4LA 2YO3A 3EFDH 1IGFH 3GXTA 3OKDA 3BKYL 1XBDA 3A6BH 1WHPA 4ZO9A 5GPRA 3V55A 2BXYA 4M1CD 3S8FB 4ZK8A 2OSLA 2VDPL 5JQ6H 5AW9B 2MKWA 5IHUL 1UA3A 1D7CA 1EFXD 3SPHA 3OJMB 3L3IB 4FDWA 1KIUA 1WAAA 1YEHH 2FH6A 3PP3K 1UZGA 1NGWB 1CC3A 5T33H 1A4AA 1Y6NR 4LVOC 2FIKA 5F1NB 4I87A 4N0UB 1RU9H 5GJSH 3GRWA 4L8SA 4RWYH 5EU6A 5IK3B 1RJLB 3QDME 5EZIH 3DIDA 2XWEA 3B7SA 2WMPB 3VXUE 2CO6B 1FNSL 3ALWA 3DO7B 1IGTB 1DDHB 1PZDA 3HS0A 1O9VA 3FTGB 3MBXH 1S46A 2VLJB 1AZUA 2R1YA 3DDGA 3QUYC 1UB5B 2PW2B 2SEBA 4WNQB 2WXOA 4JN2B 4TLUA 3WI9A 2Z0UA 3BPNB 3BSGA 4NPJA 2GG1A 5DJZB 5DQJA 4JY4B 1F4AA 1TJXA 1MVFA 3UX9B 5C07A 2ZZUT 4FG6D 4GFXA 5J6SA 2EIEA 4JQXC 1KNOA 4GXUM 4A1RA 1BHGA 2Q5BA 3HUJB 5DHEA 2XBZA 4XX1E 1QAWA 1AOHA 4QRUA 5DFWH 2A9NH 4JFEE 1YHPA 1MCKA 2BIMA 1CLZL 3QFJB 3CG8A 5DMGC 2H26B 4O51A 4DUVA 5HYSB 3O3EB 3SQOH 4G7VH 1ECYA 4YWGH 4CKVX 1FYTA 1JGVH 3V8CA 5EU5A 2HLAB 4NZTH 4I8DA 2XQYA 5EB9A 1AJ7H 1MFDH 3ULUD 2OFQA 1V27A 3RX8A 3NEEA 1XH0A 4WW1B 3UAEA 4ZMPA 2N01B 3G08A 4YDJA 2YN3A 1ZHLB 5C0FB 4P9ML 3SDDA 3KHQA 1VAHA 3CPLA 5T1MB 2VZ3A 3X1GA 5EU5B 5A7EA 1XGRB 4YHOH 1JNNL 4LSSL 2P28B 2YPKA 5T1LB 4PSPA 1ULVA 2FZ3A 3LNFA 2RR3A 3UZQA 1RMFL 4LLMB 3CFMA 4F7CB 3M45A 3WY1A 5ISZA 5CU9A 3PNWA 2HPOA 3O6LL 2EICA 2A6KA 3EF7A 1QW9A 2BFVL 4ANXA 4PJ7E 4QTIH 2NQ3A 3J8F7 3EYOA 1R34A 4CDHA 4CVXB 5BQDA 4X6EA 5C0IA 2ZWNA 4UZSA 2WWMD 4U7SA 1URIA 1RIUL 3X11B 1J8HA 4CILA 3D18B 4EN3D 3FOLA 4Q9RH 3BGFC 1PZ5A 5CLTA 2VN4A 3WIHA 3WUWG 4KKPA 2WBKA 3MXVL 5C0BA 4GW5A 3S36L 3N91A 1CF8H 1U8OB 1WFUA 5A6MA 2X4PB 3GO1H 5E2TH 1HXMB 4PS8A 3QJFB 3TZVA 3VWKB 4C59B 3NBNA 4ABUA 4YH6A 4Y5VB 2JMRA 3P0GB 5HYFA 1CBVH 4L8SB 5EU6B 4PREB 5DHVB 3KZ8A 3UG3A 5E2VH 3KL3A 4KJPC 4WI5A 2J7LA 5BRPA 5EEZA 2H7WA 3KPSA 4UDTA 1G9NC 3JWNE 3N1QC 3WNLA 2E86A 4RMUA 1JNHB 1NBQA 5KSAD 4M8VA 4R7DA 1DLFH 2BO0A 4HZLA 4Z7OF 4XZUA 3KPTA 3CBKB 3DVFA 3AQDA 5HHXH 1D7BA 1V5JA 1F3RB 1ET7A 4GMSL 1AG0A 4EI5B 2OL3H 1NBVL 2E9WA 2DQGL 5KSBB 4P5MA 1Q0YH 3BISA 2F6AA 2FYYB 3KYKL 4XC1H 3U1SH 3ZHNA 3NCYS 1UD5A 2ZUTA 3QIBB 1UM5H 4K8RC 2R1XA 2YGPA 4Q4EA 3TT3L 3OZLA 2SODB 3WELA 4E9VA 2JF1A 3K6OA 2W07B 1A21A 3FQNB 2LQRA 4PGBA 5FIEA 3SBQA 4OIBA 2F74B 2P5EB 1A7QH 3C09C 3GSRA 5FM4A 5DHYA 1RD6A 3RDJA 3ARGC 4K7FA 4W4OC 3O8XC 1HESA 4HC1H 5GS0L 1HI6A 4Y2NA 3WFDH 4KXDA 4UM9B 3WENA 1FYTE 5K9QG 5LNEA 1TT6A 3UCQA 1FZOB 5CWSB 5MEPA 1COBA 3S9DB 1HHGA 3BP6B 1MCOH 4S1DD 1Y1UA 3WJMB 3KE0A 3HZ3A 2ZXDA 3KGSA 1GJWA 4U7KA 1U91A 4IRJD 3ZRSA 4PCYA 1KTBA 1NCCL 1A1OA 1MG2C 2DW5A 3VDBA 2QKSA 3B2UD 3DETC 4M62L 2J88H 2UXGA 4ODXA 4XMLL 1ODUA 1IAIH 1KPRB 4LZKA 3NFSL 4BQCA 1MJUH 2D7TL 3CLWA 3GBMH 5D2NE 3I85A 4N2FA 4OLVH 4R5VA 3ZDYF 4P4RB 3ZHFA 2BVTA 4M7LT 3ZDWA 4QRPB 3JWNH 4QOKA 4BZ2A 1G9NH 1Q9OA 3N43B 5EHFA 2A6JA 1KPVA 2YMXH 1AGEA 2VH5H 3DJSA 3OKMB 4I4WB 5D1QE 1QNZH 1QR1A 4IRSC 4Z5RB 4I18C 2W59A 1UD3A 4PD4K 5DLLA 3AG1B 4PW4A 5JHLA 4LBEA 3FT3B 3P9MA 2EDRA 1VZIA 4Y0GA 4G6JH 1I31A 4JKPH 4O4YH 3RB5A 4H1LB 1MHCA 2CE6A 3NIDB 5CSGA 1S7UA 3H9SE 4PLOB 2QKIA 3NCMA 1SM3L 3ZMNA 5FHBL 1R47A 5FAAA 2PPDA 1S7TB 4FZEL 4WU5A 4QTHA 1F86A 4GKSB 2F8OA 2Z91B 3NJMA 3HW7A 3DO4A 5ICZB 1ZGLB 2R8SL 4DKAA 4P2OB 2IG2H 1NDGB 4FX5A 1S3KH 3ARBA 4DKFH 3FYEB 3HVNA 4KNTA 5E8OA 3QA3B 1HHHA 5FYJL 4OLZL 1KTRL 1X4XA 2F08A 4N8VB 1IQWL 1JDDA 3EJCA 1NEZA 4F27A 1TQUA 1BG1A 4YBHA 4DQOL 3BESR 3D39A 5JPMC 1HKLH 2EH8H 5DD0L 4DP4X 3D4ZA 2IH1A 3HE6D 4R4BB 2YA0A 4RISH 4WEBL 2WO4A 3L8QA 1J5OL 1S5IL 1CFSB 2EP6A 3BRDA 4LCVA 1S2EA 4AEHH 4MBRA 1XTMA 1SF5A 4AVIA 5IJVA 2MOGA 1E50A 5I1CH 4ADGA 3N44B 3BQUB 2XOTA 2XN9A 1SOXA 1JK8A 1BYNA 1P9MA 1MHPL 1D2OA 4A2DA 5KBDA 3K71B 2EIBA 4U1LB 1GYUA 3SQOL 5CJXA 4PBWD 3EFOB 3L95B 2VJXA 3FS9A 4PJCE 5I74B 5ITBL 2WLHA 1J1XH 1KJMA 1BJ1J 1OP5H 4B9KC 3SE9H 4D0BB 1W72A 2N7SA 4KU1A 5KSBA 4JPQA 2OTUA 2WK2A 2W9EL 1MUJB 3D0LA 3BQUA 1LE5B 3OWEA 2H5UA 5IBLD 2NR6A 2G5RA 3ENEA 1NPUA 3PJSA 4BXSV 1RULH 4RA3A 1HZLA 2EE2A 3QEQB 2F5AL 3H7LA 4DW2L 4LVNC 3QG6B 3GUFA 4XP9L 5T8IA 3TTSA 3KJ6H 3MUZ1 3GRWH 3O9WB 2IH9A 2BERA 3VO0A 4NI3A 5DUML 3MLZL 3GSRB 4D3CL 1EMTH 3LRGA 4L1HA 4UNIA 4WU7B 1INQA 5E1AB 1NICA 2COQA 3GBNH 3QXTA 4HFWB 5D2LA 2YJLA 4RAVA 3NDZE 2HTKD 1DFBH 4W9FC 3OR6B 4K73A 1IFGA 4UNTA 2IMMA 3U79A 3VG9B 3KPSE 5DC2A 1ESOA 1ZV9A 4LLYB 4PJIA 3I75A 1U4EA 3F83A 4LESA 4UBDC 1R3IL 8CGTA 1FYTB 3B2UC 5E56A 3UTOA 3HAEA 3Q8CA 1II4E 4NLHA 2VLRE 2WPGA 4HJGB 2V3FA 25C8L 1BBDH 2JIXA 4YAQB 4KDTC 3WEXA 2B5IB 3JWOC 2JB5H 2NY0D 5EDXA 3AS1A 1HEZA 4G71B 1J48A 1UA7A 4PGZA 2ZOUA 2ZIDA 1UFUA 2BP5M 3O9WC 4X6DA 2J12B 3DX0A 2AV7A 1H5BA 2W8CA 4WK0B 4PRBB 5KBMA 3UTTB 3QDGB 1RI8A 4ZQKA 4QIRA 4IBVA 3JV4B 3O6KL 3WFZA 1BF5A 1OT2A 3Q6GH 2VMFA 2CO7A 1YLBB 1JGEB 1ND0A 4GYBA 4EI5C 1JWUA 2XXGA 4LLVB 4HKXA 3ZR6A 2Z35A 4N2MA 3ZR5A 4QO1B 5D7IE 1X7QA 2YUWA 1X5XA 1QRNB 3AG2B 1UHVA 3QRFM 3M88A 4N8VA 4KK8D 1MFCH 3A47A 4MA1B 5IHHA 1ONQA 3QUXA 4FMFA 3TP4A 1RZJC 2WZ5A 3CGTA 4P8QA 4B53A 2H4EA 3ARFA 2ZOKA 2X1PA 2JJUA 4Y2DB 3ML9A 5KYNA 3RFZC 1ACYL 1M53A 3H53A 1IC4L 2QQQA 1RQ5A 2P5WB 1CTMA 2VKWA 5ETUA 2WCPA 3D7PA 1AD0B 1DBMH 2DMHA 2DQGH 4F7KA 5MEND 1W8OA 1J10A 3OWRA 4QJ4B 5IBTH 2PR4L 3PP4H 3Q6FA 4NWTH 1F4XH 4O2EA 2QELA 3TBTB 4HJJL 4QXUL 3KYNB 2WLLA 1GGBH 3ECVA 4GAGL 4N8UA 5DYOB 1JNLH 3NTCL 4WHTB 3FOMA 5AOKA 3GBEA 3OZKA 3ZSTA 3M7FB 4N8CL 1WE5A 2DQUH 2EINB 3HG1D 1AC6A 2GABA 3LPFA 4JW3A 3CN2A 1AQHA 2X1WL 2YD3A 3U4BH 4JX0A 3ET9F 2GAZB 5FX3A 4TUJB 2CA3A 2CO4A 3MYZA 4P2OC 4ORGB 5EUKA 5JIDA 1F18A 3C6LC 3JT2A 2ILLA 1QFWH 5INDB 1FNLA 2QPEB 3GMRA 3FW6A 1UEMA 3FCTA 2MCG1 3TBSB 4F1SA 4DZ8A 5TE6L 1MH5B 3FZUC 2BIOA 4OZ4A 4F5CA 3QRGH 4KROC 2WWMC 1YYML 4HS3B 4FFYL 3ZXAC 1CB4A 3OZ9L 3DX7A 5SWQB 1W72B 1CURA 1U8LA 2GFBA 5IW1B 1MCJA 2FYYA 4EN3C 4OZHB 2WNGA 2ZUYA 4JKLA 3MLYH 3L5HA 5DFTA 2IALB 1BYOA 3PJSB 1JERA 3CD4A 4YFLI 4J3OD 1CDCA 2CKNA 4HUNB 3V5DB 4OZ4B 4WI4A 2OS7A 3B37A 5ID1B 1A02N 2XTJC 1M1SA 1YRKA 3DURB 4ZMZA 4HEME 4NQCB 1CXIA 5IEKA 1KCRH 3D6GA 1C1EH 4IGBB 2I7SA 4G6ML 1XCQB 1QWUA 5C0RL 5IFHL 5FR3A 1WAPA 2XQYG 4ESKA 3DRTB 5CN2A 4A7SA 3CFQA 2VLKD 3PWPE 2QSVA 4QT5A 4R90H 1RUML 4F24A 1HZKA 3BN9C 1BM7A 3SB3A 5BW7A 4Y2OA 4FHBD 3I6SA 3DURA 3OXSB 1IKFH 5F7BA 2YK1L 2V5SA 1KACB 1QSFA 2K4WA 4PJCB 4JCLA 5TDPB 4UU9A 3BLBA 4HK3J 4L9LB 1N8ZA 1N3NB 2AK4A 5CJ8A 2FD6L 2DEWX 2I69A 4AYMC 5AG8A 4H44C 1L9OA 5DFVC 3S4SA 2OQJA 1QSFE 4NN6C 1JZJA 1H3VA 4PJCA 4DJMA 2VOTA 5KJRL 3EGDA 1E7UA 2GBUA 2KPWA 5EZJB 3DK0A 1UWYA 3K4AA 4XVUD 3CCHA 5D5MA 4OGZA 4Q9QH 3KNBB 5INCB 4G9FE 4F8QA 2FIRT 4S1QH 4ZS7L 5AB2A 1CZ8L 1Z9SA 3CN3A 3GSUB 1CFNA 3GSXB 1LE9A 1OCOB 5EF3A 1BQHA 1ASPA 5EO9B 5CLXA 4DP5X 2A4CA 4IOSD 4L4VB 5E1IA 1T5WB 43C9A 3NP4A 2NY1C 4FNQA 1NLBL 5HI4D 3ZW3A 4JFXB 5AAMA 3RWGB 4XBEL 4Q4IA 2WLLB 2Y3NA 1H6EA 3OX8A 5DYOA 4PY8J 3BDYH 3CFUA 1P69B 2YBRB 1OWWA 4L4VD 5TFSL 5HYSG 4J23A 1RIHL 3H2QA 2CSPA 3Q5YA 4YDKL 2AQ2A 1UCBL 1UT2A 3OKKB 1B0WA 1INDH 3QFJD 3WFCL 4N9OB 1BXXA 1TQCB 1UA6L 4JFXA 4HUUA 2YXFA 5KJ7E 1WF5A 5HI5D 2ED8A 1MHEA 1WGOA 3QXVA 5E6ZA 1BBJA 5E9DA 3DOIA 3H6AA 4M1CC 2Z4TA 4PR5B 1I85C 4EAEA 3QZMA 4IDLA 4X6DF 4B60A 1DSWA 2I26N 1I9RL 3H85A 4ZTOH 3V0JA 2CJSA 4U1KA 3MRCB 3MJ7A 3ZRFC 1A65A 1WIOA 2HFGL 4NN5B 2Q2LA 1KFAH 1SBSL 2I25N 3D9AL 2AZAA 1P4BL 3P3RA 3K6DA 4LPCA 2GEEA 3S3SA 4LT7A 2OTWB 1MY5A 4ICWA 4G7YH 1CLCA 5D1QA 5I1JH 1N2RB 3PQYE 3LMJL 1B4LA 4O02H 2DTMH 3F7LA 3Q9QA 3QIWC 1FG2A 2IDFA 2BDNH 1D5BB 2ZG2A 1EJ6A 3M86A 4NFDA 4N24A 3O41B 4LRNL 1MF2L 3GXIA 3L81A 4M61A 4L1BA 3HE6A 4FP8H 4ELDA 5IHZB 1MI5D 3UEZA 3VFUB 2F1AA 3CWGA 5JR1H 3QZWG 3QEHA 4IKLA 4MCNA 4HH8A 4IRZH 4Q6YA 4AM0Q 2UYLA 2WZPD 2VN3A 4NXKA 1QBML 5EOTB 4AV4A 1L7TH 4GSXA 4K7PH 4TN9A 3GMLA 4N6RA 3BHBA 3MRGB 1X4ZA 2G2RA 1KCBA 4Q9CA 1MCPH 1KFGA 3DMMC 4DEPB 3VFGH 4DT2A 1WWBX 4FQQB 3OKEA 5E6IA 2QHLA 1CGWA 1INQB 5E1AA 4HFWA 1Q94B 4C4KT 3U9PH 1WWWX 4JMXA 1MFAH 2ZF9A 3OR7B 1JN6A 3MDJA 1SGKA 4NQUA 4JPVL 3CN1A 3WIIL 3P4OA 3Q1SL 1P7KB 3AREC 2XQBH 1AR1D 1NQBA 2AK4E 2BSCA 2QHRL 2VXSL 4R8WH 2KQMA 4KRPC 1FCGA 4UU9B 1LO5A 1MLCA 3F04A 2BHYA 4WGWB 5HD8D 3D51A 4OQTH 4RVBA 3CHPA 4W9JC 3F3HA 5CZVH 1LD9A 3SE8H 3TESA 5C0DB 2VXTH 4DP1X 3P69A 3MFGB 3G7TA 3BXNA 1P5VB 1OAQH 3T1FA 3U2IA 3R06B 4LP8A 4W93A 1U33A 3BUBA 3ROLB 4TSCH 3MROB 1Q9KB 3A67L 2P80A 1YJDH 2D3JA 1I8MB 1QRNE 1RXLA 5D72H 1AKJA 3FCSB 3WOVA 1FL5B 4I48B 4BKLA 3UYOD 4X7FC 1GY2A 1J5DA 2QR0B 4G8GE 4AQAB 5BVPH 5C0AE 1PY9A 3QNXA 4XO4A 1MFVA 1NSNL 3CFBB 5I1IH 5C0CD 3E38A 4OKVA 3VGBA 5L8KB 3GKZA 2C1OA 2K6WA 2APTA 1AGBA 1R3KB 5L2KD 1PG7H 4P0DA 5IF0A 2BRRH 4NQDE 4NUGH 4M93C 3VWJD 5LNGA 3ESMA 4OGXH 4LCWA 2VXUL 1HDMA 4WSJA 4XO5A 5I1AB 4YHZL 4QUOA 1SEQH 1V8HA 1JZFA 4O9HH 5JYMA 4JFFA 1HZHL 1FCCA 1IM3B 1FV1B 2QVFB 4GUQA 1AOZA 3ZTDC 5J1SC 1J0YA 1K8IB 3L7FB 1NCNA 2WINB 2TSBA 4HC1A 3JZYA 1SYSA 3WNIA 4AG4L 2XT1B 3FU3A 2F18A 1J8SA 1Q0XL 4PJXA 1URZA 2XPGB 2GCYA 2KQNA 4UNUA 3CZLA 4FXTA 4V1DD 4J8RA 4MNQD 5D93B 3TYFA 4F9LA 4PYHA 3DJ9A 1U8MA 3MRMA 3QW9A 4OB5H 4OSUH 4KVNH 3RX5A 1CD9B 2Q7NA 1SDAB 3TCXA 2ED6A 1KENH 4ZODA 2BIQA 4KKCC 3O6FA 4P4KD 3WFEH 2JVUA 5ESVB 2DQDL 2R0LH 3O6MH 1NAMA 3L3GA 1B6UA 1NCOA 4QHLB 5AW1B 1BF8A 3D33A 5DEGA 5JW4M 2LU5A 5BRZD 1RUAL 1THCA 2G9HA 5KSAA 1U92A 3G6JB 3IPEA 5I0WA 2UYLB 3EGSA 5LCVH 3SO3C 3UO8B 4ZD3H 3MLTA 4ALAC 5LWYH 2HTLC 3FB7B 1ZLUK 2NY2C 3ARXA 3FPXA 4YIQB 4C55A 1VPOH 1BVLA 4LSTH 1B0GA 4UUJB 2F7QA 4YK4C 4R3SB 5BQ7A 2Y7QA 4XNAA 3WTXA 5J6GA 1D9KD 4FRWA 4A2HA 1GZQA 2K78A 2YQ3A 5FCUH 4ODHH 2AXFA 1U8QB 1SYVA 2XA8H 4PGEA 1QI3A 1TJGH 3ZZLA 1EH9A 1FNFA 5BV7B 4FXGA 4YIQA 4XNDA 3IFLL 5HYJE 1BV8A 3N40F 4OCXH 1MRCL 5LKNA 3GXFA 4LDCA 3HG0A 5EUOE 4JDTH 2I32A 4I3RH 4NC2B 5IG7A 3X12A 3CK0H 4BYHA 1E9OA 3VMOA 2PWDA 1LWHA 1UACL 1BMZA 1LO4H 1XB8A 3MV9A 4ZS7H 3HBZA 4LB8A 1NKGA 5FYKD 3ABKB 5IVXE 3U83A 3WO3B 3BPCA 4P57A 3RX9A 4MAYD 5CEYA 5KVEH 4Z3EA 2B2XL 3NFPA 2BSED 3T0XA 1FNGA 1OSYA 1J5IA 1X5JA 3R19A 2QQLH 1OTSD 1CT8A 3MJ9H 3S34H 3GI9H 1N7ML 4W9GC 4C58B 1A1NB 1D5ZA 4N2BA 5JOFA 1IARB 3WFHA 1JPSL 4Z76A 3QDMD 5LO7A 2VDLL 3MBEB 4NZJA 3GMNB 4GUPA 4JUSA 4G83A 1BQRA 1M7XA 2AK1L 3MRDB 3TT1H 1RUKH 4K7PX 1JSYA 4RGNB 5C0DA 1KBPA 1MNUL 4P5RA 3DX9B 2BNQA 3HUJE 2N7BA 2Q76B 4RZCB 2JCCE 3LPGA 3LVTA 4UTAA 3QRLA 4NRYA 1BD2E 4MKMA 3RFZB 3FUIA 4L2LA 3I02B 1GGIL 1NBZB 2IAAC 4N2AA 2XN1A 3EBIA 1T22A 2VABA 3ORJA 3IDJB 5IOPA 1EEZA 3V0VB 2X89D 3VSUA 3OPZL 5DHDA 2QTVA 1A3RL 3G5XA 3VW3L 1Q0EA 2BY1A 4QJ3B 4WW2C 1PLGL 1RK1B 3SKOA 4XTRC 5D7JB 2CRIA 3B83A 4O58L 2Z4QA 4XCYB 2Y07H 1QO3B 4O2CB 4HIHA 5C0GA 2BH0A 4L0YA 1WZ1L 2UY6B 3E1ZA 1RIVL 1G9MC 3D50A 5DO2C 4XXCC 4BSWB 4JFZH 3FUJA 2QGEA 2G60H 4NWUL 4O02L 4OQ1A 4WTZA 1XGPA 2UXTA 3QDJB 3SJVD 5BO1L 5L9DH 2CU9A 4AM0B 3KPNB 3VG0L 4BH7B 5JHDB 2XRAH 1KTLB 5G4OA 5EG6C 4XCYA 1KB5H 3Q43A 5E8NA 5EBWA 3FUFA 4TVPL 1OHQA 2EKJA 4ZZFA 4XN2A 5E8EB 4YNYB 2CGZA 1LK2A 2KPNA 3QIBD 4PM1A 4GPVA 3TU6A 4AC2A 1UOKA 2J1KA 3FQWB 3ZQ9A 2RFXB 3WE6A 4KAQH 1TG8A 4GKLA 2R0KL 3T0AA 3CSTA 2Q8BL 4F57H 2XWRA 3LQZB 1SHMA 3ZIMA 5ID1A 1I8KA 5I9QC 1NFDB 2I5YL 5KVGH 4K2UH 4YUEL 3B5HA 4Y4FD 1J9SA 2OK0H 4LEXH 3STLA 5J1AB 3EDDA 2WTRB 5AL8A 3UG5A 1DVYA 3U9UA 1GC1H 3W3BA 2NCMA 2GTZB 1C5BL 2IBZY 2V5YA 2F2HA 2LW3A 3KM2A 4MX7A 1C12A 1RZFH 4RZKA 3LNDA 3DJRA 4HZAA 4JRFA 2ADGB 4RGOH 1MCIA 1VB9A 3MUY1 5KVFH 3M1OA 2NQDA 4PVMA 5DJYB 4M43H 3SSGA 1BGXH 4CVZB 2IF7A 1HEJC 1E3FA 5DVLA 3KDMB 4M5ZH 4OLYL 3P0YL 4LHUB 2D9QB 3HI1B 3HNVH 3IFNL 4HGWB 1A9EA 3BPCB 1HILA 1RPUA 2HRGA 2H0EA 2IOIA 3ASOB 3IFPA 3VFMA 4X8CA 1YECH 3G08B 3HI6L 5F93C 3UTZA 4QLWA 3BKYH 4KDTA 3UACA 1QUNA 2YIHA 4BWWA 4HG4J 1B3IA 1CIDA 1G7MA 3FQRA 3OXRA 4G6FB 3INUL 4HIIB 5AOJA 2Q86B 1IC7H 4H40A 4JPIB 1BFOA 3PL6D 1ZT4A 2HJKA 3K8KA 4N1CA 1MOEA 4ZMAT 3KEHA 4DK5A 1T21A 4UANA 3L1OL 4JG0L 3L9RB 4BZ1L 2CUHA 3ABZA 2GTWB 1GGUA 4JAMA 2VXUH 3IDIA 3DX2A 2B59A 2BOBA 4IGBD 1NIAA 1S9VA 5LBVA 4Y1TA 2VZSA 3SDCA 2Y6TE 4BZ2H 5E24E 1HCFX 5ALCH 2PN5A 1U58B 3CX5K 1Y7VA 3QORD 2YBRA 4JFWA 2FEEL 3G5XB 3IEAA 1R5VA 1EERB 2EDNA 2FECL 3DX6B 5CD3A 2A38A 2GI0A 3J7HA 2VDNB 4XXDB 1N5YH 2YAEA 4BE5A 4EZJA 3P40A 4G72B 5AFAA 4HMDA 1XZ0B 1PLAA 5IK3A 4V33A 1VKXA 1YDPB 2F53E 1KENL 1ZLUH 1S78D 1IGTA 4JRYD 5J5EA 2VW4A 3QWRD 3HS0C 4LL9A 2OTPA 3RY4A 5E6UB 4XO3A 4KUCF 1V7NL 3HRZB 4MA7L 4LCUA 3RI5F 4F7MB 3O4LB 1WZMA 3PL6C 4QPEA 5FGCE 1AJ7L 1MFDL 2BSRA 3G3LA 3MRQA 3FRUB 3MRRA 4KV5F 2HRLA 3CC5A 1T1WB 2OJ1A 3LKPA 2EVGA 2P46B 4G8AC 1TO5A 4C8XA 1KIRA 5GGQL 4HEPG 1T66C 2NT0A 3G5VB 2PWGA 3D3VA 2P43B 4WFFE 1XSJA 2C9RA 4G1MA 4H88L 5F88B 5EO1A 1NMCB 1GTFA 5SX4I 4DUWA 1RZIA 2DIEA 2ITDA 3QI9C 3UJTL 3VX1A 4X0NA 1G7HB 3F2LA 4PJGE 4MNGE 2NXYC 1NC2A 3U7AA 1MW0A 2K1MA 3VXSD 4JFUA 1PGRB 4KC3B 2MQCA 4WDIA 3U7YH 4EDXA 4XCCL 4FQHA 4DHLA 4BHUI 3ASNB 4Z7WE 1JF1B 3RBGA 2EKSB 4TUOB 5FA4A 4LAJH 1BZ8A 4DUXA 1D7FA 3BP7A 4F9PA 2FO1A 1BVLB 4X5LA 4ZFGL 5KVDH 4PJ8B 4LNVA 2GIMA 2DEYX 3AT0A 3DXAD 4EDXB 1AS7A 1MW3A 3SD5A 1L0XA 5I66A 1GOHA 1P7KA 1QZ1A 2HKHH 3SQRA 1HCVA 4FFVC 4ZZKA 1F4WH 3ZMEA 3KCPB 1HQRB 1UUSA 1OAYH 1NC4D 3QAZB 3QIBC 3WBDA 2ADFL 4JQVA 1P4LB 3P3YA 2KLRA 1MIEL 4CMMB 2X9ZA 3QIUB 4OV5A 2CO7B 1CQKA 1KGXA 3AY4A 1KN4H 4Y4HB 4MAUL 4N85A 4HUXB 4NJAL 3VI3B 2B15A 3L45A 3FH5A 2IDSA 5KVEE 3QQ4A 4AH2A 4X7TA 2IWKA 4M7KL 3NJHA 5E6RB 4EKXA 4QRQA 1UZ8B 4A7VA 5IJDC 5F1IA 1A3RH 3WCYA 1AH1A 3ZE1E 3ASWA 2X2YA 3CVCA 1KBVA 1MJJA 2WKOA 3ZRCC 1NGPH 3ARFB 1O6VA 4GAYB 5DD6A 2DJ4A 4ZSOB 1BX2A 1QRKA 1P4IH 3EGDB 3F6IA 3I9GH 4AQ1B 4ZMQA 2R4SH 5CSZA 2EUXA 3C87A 1IJNA 3BE1L 4YX2L 4G9FD 2R2EA 5HHOE 4ZFZA 3BAEH 1H15B 3U1SL 3GPEA 3MV7A 3L1FA 3NFNB 4U0RC 4GXUN 2X3CA 3ZE0E 1MAKA 3TT3H 1RZKH 1VGKB 3WMPA 1SJVA 4NI6A 2R2BA 1FL6B 1E4WL 3FQTB 3LKNB 5DC0A 3E6FA 4QHUA 1E2WA 4GKOA 5AW2B 4B27A 3DO3A 4HBCL 4ZOBA 1MREH 1VEMA 3K2UL 1DUYA 1OM9A 1JVKA 4JHWL 5DMKA 4R2GD 2XPGA 4WV1B 2EUVA 2B39A 2XU9A 5IV2A 3WS6A 5D71H 3ZSSA 4ETQA 4QCIA 1DVFB 1KJ2H 5AYUH 5B22A 2R2BB 3RE0A 3RVTC 3A0OA 4U1NA 3QIUD 1ZCRA 3EO0A 4DKTA 2GEQA 1BQKA 1UYWL 4KUZL 1UD4A 4IIZA 1I7TB 2CDFA 1CBJA 1AXIB 1NCBH 2EZ0C 5F6HI 4B6ZA 1J8KA 3EAKA 3TA3C 1I8UA 3RPIB 1I9EA 5CGYC 4NPYB 1M7DA 2FB4H 2AVGA 4BSVB 2VLRD 5DT1H 1RZFL 1UKQA 2NY1D 3DIFB 1H9DA 5GZOA 5GRVL 1DO6A 4HA1A 1DZBA 4RGOL 2H2SD 1JZIA 4JANB 3FRPA 2GC4C 1XD1A 3RDTB 12E8L 1TTBA 2HUEA 3RUGE 3QWOA 3ZYZA 3LEYL 4QRPD 4KTGA 3KPRD 3DPBB 4HWNA 2ZUXA 4GMTL 4WUUB 2FR4B 5TE4H 2ZP8A 1JF1A 3ZTEA 4XPBL 2IWEA 3IN2A 2AEIT 2VH5L 4M5YL 4QI3A 4J3SA 4N1EA 3ILPA 3ULSB 4NENA 4JJ5B 3RVWD 1QMUA 3QBTB 1BEYL 4H5SB 3LAFA 5CIPA 2E9GA 1AIZA 2GJRA 1AHWC 1BJ1H 4GT0A 4JKPL 4O4YL 3S5LG 4M7ZB 3VX0A 2V7HB 2HKFL 4IU3A 1X6NA 1Q8MA 4BFEA 4XPHH 1IC7L 4QRRD 2O30A 4X4YA 5L8LB 2EYTB 4TULL 5TH2A 5CEZH 4DERA 2NY2D 3NCWA 4YZFF 2YD1A 3VXMD 1ECZA 3KVQA 4LARH 4N5UA 3ZHDA 1XH2A 2QFPA 4HFUH 4DETA 5I1KH 5F7KC 3L9YA 1G1YA 5CILH 3L1OH 2DY2A 1RZ7L 3EDJA 4Y19D 3TS8A 5F6IB 1MI5A 4RMWA 3RRQA 5FK9A 1RSFA 3HG4A 1UGNA 4LSPL 1MY7A 3VGAC 5I71B 4NAQA 4Y4FA 1NBYA 5MENE 2WCGA 5AZUA 1WQVT 4PJ9A 1MRFL 2A9NL 1MHCB 2ZXEB 2A4ZA 1OTSC 5J3HC 3BEWB 4AYSA 4HKBA 3TN0D 1YEFL 2EDBA 1TZGH 3IWUA 3UTQB 5IHBA 4AGNA 2CO2A 4NZTL 2OSXA 2Z1PA 3BT2L 5ISZB 3P0VH 3HG1E 5AAWA 5J11C 4RMRA 4A04A 3T6QC 2Z93B 3EOAB 3IMRA 1DCLA 4MMXC 1A3QA 4Y19B 3MV7B 5D8JH 1SFD