1W19A

Lumazine synthase from mycobacterium tuberculosis bound to 3-(1,3,7- trihydro-9-d-ribityl-2,6,8-purinetrione-7-yl)propane 1-phosphate
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
147
structure length
147
Chain Sequence
DASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSLDSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLRELRAHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Lumazine Synthase from Mycobacterium Tuberculosis as a Target for Rational Drug Design: Binding Mode of a New Class of Purinetrione Inhibitors(,)
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 6,7-DIMETHYL-8-RIBITYLLUMAZINE SYNTHASE
total genus 53
structure length 147
sequence length 147
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2004-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1w19A00
1T13A 2C9DA 1KZ9A 1W29A 2B99A 2A57A 2C9BA 5IM5A 1KYYA 1NQXA 2I0FA 2VI5A 1NQVA 2A59A 1NQWA 2C92A 3MK31 1KZ1A 1KYXA 2C97A 1W19A 2OBXA 1DI0A 4KQ6A 5IM4A 2F59A 4J07A 2C94A 1C2YA 3NQ41 1KZ6A 1RVV1 1ZISA 2A58A 1EJBA 1HQKA 2O6HA 1KZ4A 1C41A 2B98A 1NQUA 1XN1A 1KYVA 2JFBA
chains in the Genus database with same CATH superfamily
2I8CA 5FL3A 3BL5A 3W7VA 4E07A 2C8VA 4CCYB 4E70A 3U60B 3GT4A 1W29A 1YZFA 1C3OA 1L7MA 1V2HE 1WKBA 1TL7C 2H2FA 4WASA 2QTVA 1Z4NA 1USWA 3DT6A 5J2TA 2FDRA 4N3AA 4ZU6X 2FUG6 3KQSA 4Q01A 1UP7A 4QELA 4DREA 2X13A 3MW8A 1Z88A 1G7SA 4DNXA 1E20A 2ZQZA 4FMDB 1EEXB 3CZRA 3NT2A 4ER0A 3WMFA 1P77A 4NG5A 2BY4A 4QQ8A 1THTA 4FJ1A 4DA4A 4EF6A 4DGSA 3HQ4O 3LX6A 4QKQA 3GEEA 1XRSB 4OREX 1F5SA 3DVQX 1RJGA 1P1RA 2IODA 2QZJA 4Q05A 2OXTA 3ADCA 3ZVMA 1Y4UA 3FN4A 3QXHA 4YYEA 2V7GA 3ZR4B 4IOJA 5MHTA 2IQ5A 2FFBA 5CNKA 3UUEA 2P91A 5J5CA 4WBNA 3PD1A 3C7TA 2W42A 4AZ0A 3EPJA 4ZVQA 3WIDA 3P26A 3WMEA 3WLKX 5JT1A 1UFKA 4XJTA 1NUPA 1X1RA 3N75A 3OIWA 4D9JA 4CL2A 3LG2A 1KI4A 2HJVA 4OYHA 2WV9A 3L5KA 2WILA 3NBFA 4M0CA 5ARBA 5KTNA 3OWOA 4QXRA 1RIIA 2FUNB 5ED4A 1JG7A 3ZDZB 3JD1A 3KKMA 3KQTA 2F55A 4I66A 2NYUA 4M1TA 2CJWA 3CLTC 4BFLA 2GOYA 4HN2A 4M0PA 4NAVA 4YN3A 5K0SA 2O0HA 2VTBB 4DLWA 3TWOA 4KXMA 5IAGA 3ZQ6A 1DX9A 1KBZA 1JZSA 1P2SA 4JB0A 2EIXA 4FT4A 2QM7A 2XDQB 2J6IA 4U4AA 2WHYA 1QC5A 4UM8B 4MDHA 1NVGA 1V1RB 1L5LA 3MG9A 4G1MB 4IMPA 4KLZA 4KRYA 4DG8A 5BSGA 2BCEA 3IUBA 3ZS9A 1WAMA 4LQ4A 1CG6A 4UHDA 4IDFA 2HRQA 1P74A 1CUJA 1Z16A 2I7CA 1NZFA 4R01A 4TV9B 4W5QA 1INLA 5TGTA 3E9MA 4MUHA 2FKNA 1IN6A 4O4IF 1JFFA 4FU0A 4D5EA 2JVJA 3QXGA 2FI1A 3HA7A 3CUTA 2CLLB 3PC3A 1Y48E 4XYBA 1YRYE 5LQCA 1K8RA 3GFOA 4XWAA 5HOEA 1DKNA 1BO6A 1QTNA 2BFAA 2P1RA 2QMYA 3GN2A 4TMYA 5BSMA 1JEEA 3P9NA 2XADA 2COUA 3JQ9A 4GBGA 4EKEA 3PWKA 3FTFA 4AJ2A 5GWXA 2GF0A 1SCAA 1D1SA 4L5YA 4V0KA 1LDEA 2D06A 2ZE5A 1U7ZA 4N5HX 4CT5A 1USVA 3R74A 5LP6B 1CQIA 5JJLA 3V1YA 2G08A 4XJSA 2QU7A 2KB0A 3RK4A 1PHRA 4KYVA 3O74A 2GCOA 1G8YA 1ISSA 4MGKR 4NBVA 2OPHA 3WGZA 1ZN7A 2JGMA 3DPUA 2ENUA 1XTPA 2Y6UA 1DTEA 3D02A 4PR0A 2O2YA 2I78A 2A92A 3CJTA 1F2TA 1H4SA 4Y6LA 1GADO 2IYFA 3RYIB 4BWFB 2Q5HA 1A96A 2EU8A 3QFTA 3ZJ4A 4GPEA 3SZGA 4YV2A 3BDAA 2O7RA 4GOOD 5LOVA 2V74B 1ZCBA 4LF9B 4XA8A 3PFIA 4OI4A 1F2VA 2RAPA 3CB4A 2J7PA 5CFQA 1CLEA 1VGRA 3Q6NA 4J2TA 1UJ6A 5AUQA 5JY1A 3C8HA 2Z1DA 2O59A 3G5LA 1FFGA 2ZBPA 3CMCO 1V3UA 2EKQA 3T6KA 1VSVA 2WWXA 2NQ8A 3W7BA 2J3JA 3LKZA 3K1AB 3RTBA 4TSKA 2VSOA 1FDTA 3TL2A 4ZYZA 1G1MA 3IQDB 2GKSA 2VJNA 1ZSNA 3KAQA 2JC3A 1EJ2A 4U7GA 3K70B 3LK6A 1YTUA 3KQPA 2M6LA 8ADHA 1W4RA 5DEOA 4M1MA 4QGHA 2C82A 4EG4A 1I6MA 2NYRA 3U3ZA 1GPMA 5CM9C 4YT2A 1EK6A 2WINI 4CMHA 2PUDA 1A5TA 3CF2A 2OMEA 1N2SA 4BLSA 3N28A 3HA3A 5LQRA 1UDBA 2WVHA 1JFFB 2WLTA 2IPLA 1R0YA 2FRDA 1SWVA 1YR6A 1WCIA 4K6KA 2NTVA 5ICSA 4E46A 1EFKA 2CFRA 4GYKA 3USCS 2MSNA 2IHYA 1JXQA 1XP5A 4RPKA 4QYXA 5C5EA 1PFUA 2OCXA 5K09A 3G8YA 3ILXA 2CE7A 1EUCA 4HNGA 4NL4H 2D1SA 1P8AA 3LPMA 3GMDA 4HQOA 4KEAA 1CR2A 3QHQA 3IPXA 4Q9KA 3VISA 5BUCA 5JASA 1R6XA 2CT8A 3AW9A 3HEAA 5DKFA 5FWXB 2BP7B 4X20A 2PJRA 5CH5A 1C0PA 1E63A 1EGHA 2PXHA 1LPNA 4EO7A 3W5BA 2QU8A 2JVIA 4DEYA 3DPSA 4TMVA 1X2BA 5DASA 1M2OA 3HYLA 1C3EA 2EKZA 1SJ9A 4WBXC 4C0SA 1T36B 1XTRA 3S28A 1XWWA 2OCBA 2PGAA 3GDFA 1L7OA 4I6EA 2YVAA 1CY1A 1LS6A 4S35A 5ALGA 1YD7A 5CLIA 1ZP6A 2F64A 5EMNA 4BAZA 1LNSA 1ZU4A 3HO1A 2CMHA 1PL6A 4LVNA 2RHTA 3TEMA 2AFIE 3S2IA 3IP7A 2W2TA 3NWEA 3PFGA 3OEED 4EMTA 1VBNA 1TAQA 2H16A 4HX2A 1JU4A 1MT3A 1SRRA 4G67A 5HDBB 4ARBA 4EGAA 1BCSA 1KYQA 1HYQA 3ITEA 1MGOA 2OUIA 2GDJA 1ZUNB 2HJGA 4G81A 4Z9FA 5E6SB 3UJNA 1E4EA 5JPIA 3WQSB 4OHCA 2JKZA 1Y1QA 3ANSA 1QRUA 4QFMA 3W4KA 3CVYA 2VATA 4L8GA 2W90A 3MPOA 1AK1A 2R6R1 1G3UA 2WZDA 3GJ3A 4Q47A 3TLXA 3QF7A 5AW7A 4RJ2A 1YTLA 2HTFA 2V4UA 4L22A 3K6JA 4KIUA 4UAVA 3AFIA 1G21E 1Y5NA 2PE5A 4UVGA 3I9FA 1U8TA 1X7ZA 3ESRA 4GZMA 3S8MA 1RWXA 4K2HA 1L6RA 4HEA1 4NZYA 3OMWA 1T8WA 2N3ZA 2X2OA 5ESRA 1L4KA 4B40A 4FXPA 2PUAA 5F9HA 2FZVA 1NGSA 1ZS9A 1R0CA 1G63A 1EE9A 5TJ9A 2ZANA 3DOOA 4BCBA 1H5QA 1Y9AA 3NH6A 2LCQA 1TYDE 5L3SB 3E9DA 4G1EB 3EGIA 1TEZA 5LZ4A 1Z6ZA 4FOPA 3VOAA 2XF8A 4DR4B 1WCIB 3EYAA 2C42A 3GQBB 3ZWBA 1DO8A 5BN4B 1OXUA 5HFAA 1RHUA 2RAUA 1K86A 1DIAA 2R8OA 2X6QA 1P19A 4G07A 2G28A 2QGZA 1L3IA 2Q27A 3CKYA 3DAOA 4BAGA 1WCXA 3C1AA 4GNKA 4DIOA 3ENQA 1OAAA 1UQUA 5CEEA 2HN9A 3DO8A 1ZU5A 3T7TA 2QRVA 3GLGA 1D8AA 1ORIA 1OBHA 3LTEA 1MO2A 3HN6A 3EA0A 1E2QA 2OV6A 4QPDA 2DUWA 3DNPA 3GIWA 4QUHA 5LYJB 4EHAA 4NBSA 4BWVA 3NTXA 1R15A 4CODB 1Q0ZA 2GD1O 4ZDWA 4BO0A 3BCHA 1LVGA 2OCYC 4GLLA 3MINB 1M67A 4KXQA 4UUBA 1Q2UA 5EXTA 1U9IC 4C78A 2HHHB 5J3JA 3CONA 3O8OB 4G9EA 3HGTA 2WMNB 2B6HA 3DDNA 2FG7C 3KFXA 1KSFX 3A2LA 3KVVA 1T5LA 1XZKA 2WE7A 5HZKA 1T8PA 3DBRB 5JALA 4Z4IA 4NV1A 1JHOA 4YB8A 2YIDA 4ZJZA 3EXG2 3KB1A 5JZOA 5ALUA 2K7FA 1G17A 1NUTA 2C2OA 2C59A 1KVUA 3DDZX 1XXHE 4PPNA 1SGWA 2AI2A 1L4MA 3RS9A 1P2FA 1CR4A 3FYUA 1LZKA 3ER6A 3F6CA 2PMFA 3CNNA 4TMFA 2DR3A 2NO1A 2G04A 2GN1A 3DAYA 3RKSA 3UQZA 4CN9A 3GEDA 2DQZA 1K66A 1NW5A 3K5IA 3UXEA 3B3JA 2FE4A 3RVMA 2ZJAA 2ZJFA 5JS6A 3M6LA 2R5FA 2Z6AA 3QMMA 4AKIA 1NSYA 1EFPB 3EZ7A 3H2BA 2ZI3A 1T2UA 4P53A 5DT2A 1KGSA 3LOQA 4RVOA 2WMYA 3B7WA 3SLKA 4O4HF 2V0NA 3KELA 1R9JA 5CLJA 1J8DA 3Q7EA 3PR1A 2VQDA 2YVLA 3HCPA 4XUGB 3N86A 3V33A 3WXBA 5JD3A 3KUCA 1RMYA 4NE2A 5L3ZA 1A9RA 3RUAA 4RXTA 5J2UF 3QPUA 3NM5A 1REQA 1AKVA 3ZG6A 2WAMA 3R2JA 4C20A 1A7KA 3SQNA 4XRGA 1JILA 1JBQA 1Y1LA 1OX6A 2J6HA 1BEUB 2QJOA 1G6OA 3BTOA 3CPJB 4W6ZA 1W2HA 4IH9A 4CCSA 2Q45A 3GFRA 2PJZA 2X8BA 4RW0A 1YI0A 3DOIA 3I2YX 2Q7OE 3FTCA 5K8JB 3EEBA 2AG8A 2GVZC 4IL5A 3WK6A 4K1LA 3LOUA 2ZCJA 2BISA 2VJMA 1XF9A 3PQ2A 4INAA 1YC5A 4MGZR 5AHXA 5AJUA 4NTZA 4H4DA 4RXMA 4R71A 3P9IA 4PYOA 2F90A 1FSZA 3A36A 5ADUS 5JI2E 4MITA 4FGUA 2J33A 1R0BA 2W2VA 3F8WA 5GZ6A 3I83A 1IN8A 1WCYA 1G2IA 1G98A 2EIHA 2NQTA 3P0FA 4MGHA 3UGQA 1PD1A 3ERCA 1HE1C 1DUIA 1OW3B 1TZKA 3EEFA 2NO9A 3PHCA 4KXXA 1LBSA 4YRIA 4JI1B 2OZVA 1I5OA 2ZB3A 5CNMA 5BNIA 1UC4B 3BXGA 2ODWA 4RXUA 5K0NA 1Q7TA 2ZYSA 1EFVB 3M1AA 3WLPA 1KMHA 2BHNA 3KLMX 4EEKA 3DBRA 4MRRA 3U9TA 5K7SA 2REQB 1F8XA 4X7MA 1V4VA 4A2WA 2FVYA 3L6OO 4BQEA 3NGXA 1M34A 4O2BB 3TQTA 1VG1A 4U7PB 4Q21A 3QY9A 5CTJA 2HU2A 4REOA 3JQDA 5KVAA 4FM9A 4L0CA 4KV7A 4AZ3B 4ND1A 3KL4A 1H4TA 1BVHA 1EK0A 3LWZA 2ZTLA 5F1KA 5J5VA 5TPWB 3CUUA 1NJ2A 4C0KA 5BYKA 3FZYA 2HV8A 4FC7A 5CDSA 4PO9A 4RDXA 4PAOA 4OHPA 3AFHA 4W99A 3LPAA 4HH0A 1X94A 1BXRB 2PZAA 1JQBA 3LDGA 4W5HA 1YA6A 2FMHA 3GL9A 3KLBA 2OZLB 2WJPA 5LWHA 1UDWA 1VRVA 2RI1A 3WLTA 5AJZA 1M73E 1QTQA 4AZTA 3HYTA 4TRRA 3KXPA 3W6OA 1C29B 2IXEA 2RC5A 3G5AA 4YJFA 4MWGA 4MCAA 4WCDA 1BA3A 3ORHA 3D8NA 1KJWA 2ZS8A 4N4AA 2LKDA 2XQVA 4LXUA 3K0SA 3EE6A 4NATA 1F14A 3I2IA 5AQEA 2A5DA 3SFVA 1FPQA 1QKJA 4JYMA 2ZIZA 1V1MB 3G8CA 4EI8A 3H1TA 2JDIA 1JG3A 5DU2A 4JC4A 5CD1A 4HQRA 3PNSA 4MRVA 4KHPB 2O6LA 1FMFA 3OCZA 4ZI2A 2X2FA 4PAMA 5CFLA 4WZAE 3GO4A 4ZYTA 1SG9A 4FCWA 2WF8A 1T1IA 3ZV5A 4F3NA 1FLDA 5I9TA 3SU8A 3DF9A 1JSZA 1DIRA 2VEDA 3EX7C 4RTQA 1RACA 2F43B 3T1QA 3UCEA 2I9KA 4KUGA 3L1KA 1O9GA 1YJBA 3HBAA 2Y1OA 3SIXA 2HOQA 1QJCA 2HU7A 4HRAA 4BOYA 1G1AA 1KERA 3CRNA 1QKIA 1EK1A 3AHHA 5JO0A 4LGCA 3EFOA 1T3HA 1EFAA 1OXSC 3WAGA 2RH9B 2RG1A 5FADA 1P61B 2YMLA 2JATA 5HUQA 1Z33A 2V7TA 4I3GA 4PS1A 4YP9A 3HK2A 2Y99A 4JOSA 2O2GA 1UP6A 5D8DA 2EDCA 4ZVSA 1N6LA 1I3LA 3O8NA 1QH0A 3WLIA 5KTTA 4OHYA 4DIMA 4JVOA 4PBTA 1EDEA 3RTEA 1ST2A 3U39A 2DSNA 2WYIA 1TM5E 2GN9A 2QYHA 3VDQA 4F9TA 3U4IA 3LKBA 2CXSA 4UE6A 1TO2E 4Y7DA 3UPTA 4IM7A 3UNXA 2R2AA 4BV2A 1VHTA 3OJOA 5EUMA 1TUEA 3Q6MA 1P62B 1Z0UA 1GXSB 3DBLA 3KOXA 3WNQA 1SZPA 1VXOA 1PR4A 2X0KA 2YRXA 3IT0A 4QXMA 3S1AB 3BWXA 5A5FA 1IUPA 1SXGA 2SCUA 5CB6A 2FRXA 2OILA 4IZHA 3HPQA 4TQUS 2RJNA 2IYUA 4JQOA 3TOCA 4UREA 1JZTA 1ZUD1 2H5LA 4LYAA 4B0PA 1T9GR 2B2CA 4Y2SA 4JYPA 4WE3A 4UVIA 4GWGA 2BFEB 4AS2A 3VNAA 5LIRA 4GKJB 4INJA 1JWAB 3MRSA 4MYHA 5EPUA 3VVCA 4BO4A 4AMGA 3RK0A 5AVZA 1M75A 1CP3A 3L1VA 2XMRA 4KOEC 5JAPA 1R16A 3N59A 1QOPB 4I9HA 3B6ZA 3C1OA 2F8SA 2RBGA 5ENVA 4NPHA 5ED0A 4M3NA 4C30A 2V5AA 1XA3A 1JLKA 1E3EA 1EUCB 2VP9A 3TTYA 2C4TA 3Q0IA 4HLUC 1RWKA 4YIHA 3OQ6A 3IBFA 4UHFA 4HQ0A 4BNDB 4ONEA 2V4MA 3DE3X 1HDZA 1JX6A 3Q3VA 3B3AA 1KSHA 1SCDA 2FN7A 3KOUA 3KXLA 5HBGA 1XTTA 1KR2A 2C4NA 5EI5A 2Q5FA 1VKJA 4GO1A 2PUJA 1RC8A 3M2TA 3UJ7A 4UZSA 3RC1A 5DN9A 4BU0A 3WWYA 2Y27A 2X58A 3CX4A 3E2PA 5LBIA 3EFOB 3VAAA 2X19A 1Z6QA 3KT0A 3NCHA 4MKFA 1ZOPA 4RHEA 3TSZA 4HAIA 1KF0A 2IEGA 1WDLA 1C2YA 3AUFA 1DIBA 1G3IA 4ENTA 4YX9A 3ROZA 1JPUA 1X7WA 2Y66A 2PWYA 1Y8ZA 1EI9A 4B74A 1SIUA 2VYVD 1QGYA 1GAEO 4JT4A 4WZBB 3MAJA 5IWAB 1K6EA 3L1HA 1VA5A 1TW2A 1IUNA 1O03A 4ALKA 5AVSA 1Q0RA 1QGAA 5FBVB 4UOEA 1TRKA 2AFIA 1KEEA 4DV7B 2PSJA 4GI3A 2ACKA 1ISJA 2B6NA 3A25A 4UZFA 5JAQA 2ZT5A 4OJYA 2QYSA 3AVXA 2GM5A 1PJCA 2RJ3A 1TZJA 2R6JA 1QGUA 1C8BA 3DJYA 4DYDA 1X7ZB 2WFZA 3U16A 4FQ8A 2JIBA 1UPAA 3AZQA 3UJ3X 5FT9A 1C81A 1FDOA 3EVEA 1QF6A 4C0QC 3BAFA 3P0EA 3VKFA 3ZKWB 5CB4A 3MS2A 2QRMA 1X0VA 1HDCA 1A5SB 4GPAA 1I2CA 3I3OA 3UYLA 4B6RA 4QULA 1NC1A 1QCDA 1KQPA 1EUZA 2G3YA 4KE6A 1XTSA 2B1IA 3RUEA 3WKEA 3HCBA 4M98A 1WS6A 4FZ5A 1RLMA 1VXRA 1U8AA 2G8LA 4QOIA 5EUBA 1GPNA 3N7AA 2CNLA 1UADA 3K0FA 4B46A 1PP4A 3OPQA 4DV1B 3R3ZA 1CQXA 2G88A 1ZMTA 2QVGA 4YRMA 4K9DA 2DUNA 4OSOA 3H19A 2ZAOA 4YMWA 3HE3A 2Q6LA 1XJQA 2F4NA 4CEHB 1H2ZA 1L1QA 3WA6A 3L8HA 4DWJA 2ISQA 3DFUA 1AA6A 4PY2A 3PQCA 4YONB 4ZEMA 3GARA 1IM2A 2V8BA 4ZICA 4KN5A 1TA9A 2NZUG 2FW6A 2IX9A 3DMTC 2QN2A 5E7QA 3FOWA 4BHTA 4PPGA 5HE8A 4C2TA 1JG1A 2I4OA 3H11A 4ZEWA 3K3PA 3LVQE 3KJNA 1C4KA 1ZAYA 1TQ4A 3A1DA 1LSSA 1Z5GA 4HAVA 3ACBA 3FR7A 4RK7A 1Z5ZA 2PRKA 3OTIA 4XWWA 3FZNA 3PQ4A 1B6SA 1M2FA 5E9AA 3NATA 2BEVA 5A9TA 3WRVA 4C0WA 4M76B 2WKQA 3QXJA 4FHGA 4IIEA 3ZY2A 2HJRA 4WECA 5DTQA 5EJ9A 4LJSA 5EIEA 5CCXA 1ZC4A 3RODA 1LDMA 3F4KA 4HDAA 2R6AA 4J4BA 3BGIA 1UBMS 4FHFA 2C3UA 1O0SA 1U1IA 2X23A 1HGXA 2Y1GA 4RV9A 1N2CE 1EVKA 4NZZA 3ZLBA 1DUVG 3IL2A 1QO9A 4ZZIA 5IUJC 3EPLA 2P4UA 4J29A 2Z57A 1QF7A 5GPBA 2YBEA 2BFNA 3ZTTA 4DPMA 3MTBA 3UCXA 3PEWA 4NULA 4X1KA 4FR0A 1G8HA 3OQJA 4KE7A 3OWXA 4A8JC 1VHDA 3AKZA 4P6VF 3DBVO 3D4IA 4MRPA 1PWZA 3IIKA 3MOSA 5DSTA 4D9NA 3AYXB 3QX7A 5KJFA 1N36B 2B3TA 1P4JA 3LRXA 3MJFA 3E1GA 3CX6A 3DXYA 1ODLA 4ZAFA 3GLHA 2D7CA 2VUSA 3RI3A 4P31A 3I1JA 3O0TA 3VH3A 5DGHA 2OD9A 3D6HA 3O82A 4LY6A 2RONA 1G5QA 3M82A 1M1UA 2BMDA 4UW9A 3SAJA 3V4PB 4D4KA 4EFLA 1RQ2A 4YUYA 4UMVA 3UK7A 3I53A 4N5NA 4GMXA 3FROA 1BIFA 2AC2A 5ECGC 3FWHA 1HT1E 3A3NA 3I76A 2MYTA 5E1BA 4A6DA 1IN1A 2CFOA 5TQ2B 1ZCJA 2FFHA 1HYGA 1SCQA 3MJCA 4UUMA 2NXEA 2WTNA 4RMIA 1L7QA 2BM9A 3MB5A 3OFKA 4QGSA 2RGEA 4AQDA 3NKFA 3EC7A 1C3OB 1WZEA 3PA6A 4G8BA 5DNEA 5JZVA 3FGOA 4YAUA 6PFKA 4RTNA 2JLZA 5JCZA 3PICA 3UVEA 4HGQA 5DZSA 1Y8QB 1ZJWA 4O6VA 1L4HA 4AMYA 2J9ZB 2QKYA 4MIOA 5JAZA 3F2VA 1ISPA 3KSAC 2BH2A 1G41A 1ZEJA 3E7XA 4IH1A 4RTOA 3G23A 2G06A 2A9FA 1TXGA 4TXHA 2R48A 3T4PA 1KMQA 4P54A 5BP7A 1Z0FA 2CXQA 1RQRA 4ENQA 4Y6SA 4GRIA 3CSUA 1EVJA 2XNHA 1DJOA 4EA8A 1LA2A 1POXA 4ND7A 2GXSA 4YQEA 1KIAA 3T7JA 3ET5A 2W2QA 2WM8A 3BG5A 2ZXUA 3QFFA 4QJ5A 1J20A 3DBHA 4K46A 5ERYA 2IWRA 4DQVA 4CEIB 1YIAA 1E1NA 3BL8A 3E03A 3AR6A 5T67A 1XPUA 1VSTA 1KJ9A 3OKAA 1HYHA 2RDMA 4L57A 2X3YA 4BGEA 5KYTA 1H5UA 2JIMA 2AG5A 3H5VA 3R20A 3VKWA 1LZLA 4YHHB 3LCCA 1CLUA 1EVZA 4QNMA 2BKEA 5CVDA 2H0RA 4BKRA 1PNRA 4KXVA 4UU8A 4GPTA 4DCOA 3ETNA 2DY0A 2YIJA 3C45A 4CU5A 3I0MA 4D9KA 1UT5A 1JR4A 5CPFA 4AJNA 2WKPA 2VJYA 4K1XA 4QJ3A 4GKKB 5HPYB 4P33A 2OAGA 3PQ6A 2ODQA 5CIWA 1T24A 4AJ9A 1E6EA 2PUWA 4J1SA 1PWEA 3O2NA 4TTQA 4BN5A 4C29A 1TZ2A 1EBFA 1G8JA 5DLYA 2QQ0A 3TLCA 1PKEA 1RVV1 4TV9A 3OT1A 1BX1A 2M9MA 2WUVA 1R0SA 1MA0A 3UFXB 4YFVA 1KA9H 1YIDA 1O5IA 1J7JA 3MTAA 1M6YA 2GO7A 5FNVB 2R8BA 5BW5A 3GPLA 4BQFA 3C3WA 2EARA 4OD0A 4FCCA 1KO5A 1N25A 2O8EA 1O7JA 3ZE9A 1FQKA 1PFYA 2ZR9A 1RSZA 3CCBA 3HB9A 4RCYA 4DE5A 1L7XA 1ENOA 4FP9A 4L4ZA 1EP3B 3OSUA 4R05A 1CD5A 2CUTA 2F9FA 3PGMA 4TLEA 5DP2A 3ZWMA 4BIIA 4REQA 3IEVA 1DKQA 4X97A 3FVVA 4GZ5A 2QD3A 1KDTA 2QS9A 1W8DA 2ZVDA 3G2IA 5IN5A 3VGJA 5C18A 1SIOA 4OLJA 1D4FA 1C1XA 5HCNA 5TXGA 4F5WA 5L6LB 3E1SA 3O31A 2DUJA 1H9BA 3IH5A 4P2GA 4XM1A 3HL4A 1E2KA 1R5NA 5A6SB 1PNQA 4G0OA 3TNDA 3K9HA 3WJ7A 1XZPA 3GJ6A 4ER7A 3CKMA 3DVAB 2IBMA 3ICOA 3ZWPA 2AE1A 4QIHA 1JMVA 1GQ2A 3EDRA 4KLCA 4UVEA 3KV3O 5DN6D 3W05A 5FUMA 1CF4A 1UUFA 2XMCA 1JLLA 1MO3A 4LJKA 2D5IA 1L1EA 1Y37A 3UK0A 3EWIA 1UKBA 1U94A 2BGJA 1NI4A 4FNGA 4KAAA 3O1IC 5EIBD 4RQBA 2NUTA 3KUKA 2HHAA 3R7NA 4PG8A 4X7PA 4RC9A 4XVQA 4ZCLA 5HSGA 3NBUA 5JI3E 1X9HA 1PV2A 2GZ2A 2J0EA 5CA0B 3BBPA 3EPRA 4WCFB 2JRCA 2IIPA 2PH7A 1RWMA 5EFOA 1YIOA 4IP0A 2JH9A 4YMHA 5AHKA 5DNWA 4RVSA 5AKYA 5E8RA 5C52B 1XHLA 4EFNA 1NVAA 3MCAA 5K6RA 2BLNA 3HLYA 4JHXA 1W88B 5CXXA 4ENUA 4LFBB 3EUFA 2PL5A 2Y1FA 3JVVA 3EIWA 4H3KB 4TT8A 4I4LA 4BATA 3I9JA 4G09A 3RS5A 5JADA 2KS6A 1BGXT 3KWFA 1O8CA 3MCVA 1W44A 3AJAA 1FUYB 3FUWA 5IFKA 3RREA 3IVMA 4MEAA 2ILTA 3ZOZA 1YRAA 5E38A 5EN4A 1GTG1 5GY7A 2D8AA 1TIBA 1ZKMA 2ZS9A 4YJFB 4F5YA 4EG3A 1XRJA 2DG2A 4UCFA 3SZOA 1JB1A 2FSVA 4KO4S 4RPHA 4FB4A 4DDMA 2Z6UA 2OK8A 1TU4A 3IAEA 1QBGA 3PIIA 3R3WA 3ZE8A 1P4RA 2Q6TA 1H66A 2CMKA 3T4EA 5KBYA 4BVFA 4ZREA 3NRJA 1QHHB 2JFBA 3QPWA 4AL4A 4CR6A 2CMFA 1UBFA 2RC6A 2ZRNA 3E82A 4HH4A 1NNI1 2UZ4A 1D0SA 4MWBA 2LCFA 3SBEA 3LBFA 3QU2A 4DCCA 2GVDC 3EVCA 2GK6A 1YBAA 2J87A 4DJJA 4ZHSA 2POQX 4DY4A 4CNQA 2QRQA 3NNNA 5FWNA 3UHJA 2CJFA 1DKRA 4MUIA 2PRYA 1L3BA 1JHZA 3X44A 3FIUA 4BNGA 4ZI5A 2BGLA 4QUAA 4XD7D 3I23A 3B2NA 1MVOA 1ONSA 1P6XA 1ZJ4A 1X8XA 4I9UA 4LMPA 5JSKA 3I2KA 4UEKA 2PIDA 2XOKD 3KJFA 1EPUA 4HWSA 1QIGA 3SX2A 1NVMB 3AG5A 4MCHA 4R2WA 4JI5B 1WUHS 3HR7A 3NLLA 3BIOA 4E30A 4X3CA 5FI1B 3OO0A 3B2QA 1KXZA 2JGDB 4LISA 1B76A 3WQQA 1U0HC 5IKXA 1BKSB 2PKQP 5ARDA 4LDNA 1IXSB 3ORSA 1KK2A 1L8QA 3BT7A 5IF9A 3Q1LA 1MO6A 3FCEA 4HGRA 3KKZA 4JXZA 1UXKA 1SU6A 5IJAA 5IVKA 4L2IA 3OQBA 2V54A 2YVUA 3OCWA 2WVGA 3LVRE 2AIRA 1Y6JA 3W06A 5A4IS 3E6AA 1CY2A 1BAPA 1BVUA 4MW1A 4JP8A 2QUJA 4PFKA 4TWIA 4ZAWA 3REOA 4MPJA 1S7GA 4I46A 3RIGA 5FWYA 4G5RA 2MSEB 4CKBA 2ZDGA 4CXMA 1JSRA 4W8HA 2WFAA 5DN6A 1D9ZA 1CKEA 1Z2DA 4BJHB 5JCOC 3L7JA 4M1WA 1EWRA 2A30A 5E2AA 4B5LA 4TKUB 3AF3A 5KI6A 1YKFA 2GSWA 1AKEA 2PWPA 3QP9A 4B8ZA 1GAXA 4QRIA 2YZMA 1UBNA 4RORA 4XB6B 4X61A 1G2OA 4WXEA 1RZVA 3JYHA 4OKNA 3IBTA 4GL4A 2XCQA 5EJ4A 1VCNA 3U2QA 2V7XA 1L7PA 4KSYA 2ZBGA 2Z2ZA 4ZGBA 1P4HA 4U2EA 2H7XA 3FPSA 3L0CA 4GI1A 1T2FA 4IQ4A 4NMXB 2VJPA 1CQIB 2L0XA 1V7PC 2CE2X 2HDOA 2PKEA 3S6JA 4RPIA 3C5VA 4IV5A 5JXGA 3MJTA 3N2NA 2PLWA 4DLRA 1ML4A 1E1CA 2DKNA 2W2MA 4BFVA 5CP8A 3S44A 3TAUA 1UQTA 2ORIA 1ZK2A 3IUYA 5SZKB 2Q5LA 4XUEA 4R2KA 3V1UA 3CO5A 3Q8WA 4ER6A 2YYZA 4L50A 4JGBA 2ZIXA 4XD2A 3H0CA 1QWSA 5J43A 1GTZA 1NN3A 3H2SA 2YFYA 1WSDA 3NEJA 3GCWA 1KVTA 2XYGA 2WHPA 2GPWA 4GEKA 2HRDA 4CV1A 4YV7A 4KXYA 1XVUA 2PX0A 1M34E 4E14A 5FAKA 3U4CA 4XTRA 2VDRB 4A0FA 4NWIA 2HKIA 4LVOA 1JKJA 1LDYA 5KYVA 1W6RA 1MGPA 2O6HA 3C6MA 3MMXA 4AN0A 3LS2A 2PVPA 4IF4A 1II8A 1E8DA 3ZE6A 4EUKA 2KM1A 4MR7B 2O8FA 3PQ3A 1GTRA 3NB0A 1KVRA 2IF2A 3P9ZA 3I72A 3D3QA 3JWIA 2I62A 3EA5A 3GCXA 2GFHA 3IUQA 1VGQA 2QWXA 3FJYA 2P5YA 4L0MA 5D87A 4TSFD 3V32A 1BWPA 1WO8A 2O7NA 4IG4A 3ZX5A 4F1WA 5B4TA 4MHOA 4MQFA 3PDJA 4XGIA 1X87A 1YZLA 3MBIA 3OLYA 3IOBA 4KI7A 4QBHA 5FP0A 2IYQA 1DOAA 2W8ZA 5EEGA 1L5KA 2HIHA 3QUCA 3A9WA 4ZEXA 2J8ZA 1E96A 1I1QB 1CQJA 2PT9A 1V2GA 3VR5A 4X8LA 4YUVA 2YV4A 4V0RA 3A31A 4Y1FA 1IZ7A 4ZPJA 2EJTA 3DVSX 3ZGLA 1LQTA 1JG6A 2LDXA 4OHOA 3TQOA 3ZLTA 4ZOLA 4CR8A 3H1FA 1ZMRA 5F3RA 1I2DA 5HRCA 5MF6A 5KKNB 1YDHA 1WTCA 1W1WA 4XUDA 1MX9A 3AILA 2WTXA 2H4FA 4ZVNA 1KAEA 2ETVA 3SR3A 4XZ3A 4HLNA 1EKXA 4KREA 3H2ZA 4JWKA 1OWOA 1FP4B 2XTZA 3ZHYA 3LUHA 3F6BX 2OGWA 1V25A 1AUXA 3JD3A 3BIWA 3VO2A 5DYIA 2E4WA 1M1NA 1TPZA 4R8VA 4LF5B 4UBNA 1NJSA 2JCXA 1QHIA 4ZAVA 3LCVB 2IHKA 4EB6A 1XTQA 2QXYA 1IQ0A 5U1PA 1BE1A 1OT5A 2QW8A 4TS3A 5K20A 4ROSA 4NAHA 2DR0A 2R6ZA 1MW9X 4KK4A 4KBYA 1IBMB 2G1KA 1B6TA 1TK2A 2NGRA 3IPLA 4XIFA 3CCCA 5DM1A 3RVQA 4HZGA 4GS5A 4UTOA 4D9GA 5EJ6A 1TM7E 2P8JA 3SHWA 4PAQA 5EWJB 1W94A 3PE6A 5T4EA 1ES9A 1QIJA 3G0HA 3NTUA 5JSHA 2UXDB 3ELUA 1Y8RB 3F6SA 1FYFA 1WKCA 3DMTA 4FFBB 2AVNA 4PO3X 3T1YB 3F71A 1M34B 4OO3A 1KDVA 4U7HA 3H6HA 2REOA 5DHQA 5BYAA 3X1ZA 3BMQA 5DLPA 1BCSB 4WN9B 1KP2A 2F4VB 4IJ5A 2I33A 1PR5A 1XK6A 4YVFA 3TLJA 3HUTA 3KDSE 3ICPA 3LO5A 2VNAA 2YZKA 5AOCA 4ALJA 4NBUA 5LN1A 2IL1A 1UAAA 3EQ8A 1H1TA 4CUZA 2J0UA 3T7IA 1H6DA 4KB5A 4M6WA 1GEEA 4Q19A 5B1DA 3AFNA 2BJVA 4R6WA 4I2VA 3IODA 4RPJA 2YV5A 2R8XA 3TW8A 2R6HA 2ZAGA 3KSBC 1YGPA 3P2YA 2H4JA 2JCBA 4FDVA 1QTRA 1XJWA 3L01A 4GR9A 4DMFA 2HV9A 3MJEA 1NNEA 1QGED 1RYFA 2C1EA 3KPJA 4DLPA 1EE2A 3QF4A 4DBLC 4MQ6A 4RLQA 3ROTA 4AQYB 3H17A 3OFJA 2X7HA 3PPXA 9GPBA 1J0AA 2UZ1A 3P9RA 4IOLA 4WWHA 3E3MA 4QHYA 1ZD2P 1Z2NX 3ZVRA 2HSJA 3AX6A 2GHQA 4ZFNA 1N33B 3EODA 3GJRA 1Z0KA 4NSNA 3W1EA 2RKWA 1JNXX 3H8SA 3TLAA 1EINA 1R74A 1P0IA 2H1SA 1JRLA 2QX8A 1RYNA 3D4LA 2VDVE 4KRXA 1QO0D 2OGTA 3ZHSA 4E51A 2V6GA 1DOZA 3IUSA 1KJYA 1UOQA 4KBFA 2OMKA 3LUBA 1VG9B 3ZDDA 2X9GA 5F7JA 2AMYA 4KH1A 1I9CA 2HWXA 4LJLA 3SDSA 1QFMA 1ZIDA 2Q62A 1JEOA 3IUPA 1JEAA 4NV3A 1C0KA 2IYZA 4TS9A 3TSOA 1KJZA 1AHNA 1MABA 2ZRHA 1BOOA 3S27A 1NA5A 4JB8A 3EF1A 3HN2A 3U9LA 1PUXA 1BH2A 5EWMB 2GI4A 4R0MA 2C9BA 5JNTA 3O26A 2LXNA 4IOKA 1IB0A 4OATA 1E3MA 3L9WA 2A8YA 2I6GA 4IHJA 4CHGA 2XT0A 4DR5B 3EXHA 2QJFA 4ZWNA 1YS4A 1XG5A 2OCPA 4TXMA 1DZ3A 1JLLB 4FFDA 1B14A 1G7RA 2HQSA 3B6JA 1W5SA 1B93A 4MKHA 4N0DA 4I55B 5EINA 1GKYA 5KUTA 2D2EA 5KTPA 1UAGA 5F9MA 1CK4A 2ZE8A 2DTEA 4A8HA 3IJ5A 2J3LA 2I91A 2W2XA 1YR7A 4LXIA 3MXOA 2ZRPA 5NULA 3KD3A 4U02A 4YUWA 3FBTA 5BXQC 1MP0A 5I7HA 2BEKA 2CLDX 4AKEA 5CFZA 3IMEA 1YL6A 1JDBC 3RK1A 3KPWA 2GYVA 2AOTA 2Q3HA 3N6XA 3MQ2A 3QE2A 3OUTA 4FW9A 4L8LA 4EHIA 3PPWA 4G6ZA 5AIAA 2Q28A 2VTBA 3MGAA 2C0QA 1U2GA 1QFXA 2TS1A 9MHTA 1FU8A 5EZYA 2A33A 2W9XA 1O96B 3T3GA 3FCAA 1XLVA 3FETA 3G7NA 1WLSA 1P9OA 4MCIA 2QB5A 4BO2A 1RPJA 3WKAA 4F86A 4HNVA 3COJA 5GV7A 3NVDA 3L3BA 3P9CA 1H8HD 3EFHA 3FVQA 3HS3A 1ECJA 1OPXA 1ONPA 3TOXA 1JQDA 3AGPA 2XT6A 1ADJA 4DSNA 3AR7A 1WR8A 1U3TA 1Z0SA 1GTJ1 3IV9A 1DC5A 1P7CA 2HLHA 1RJWA 2VP6A 3M2PA 3Q85A 4WLVA 5CLGA 1T91A 2MIIA 5IASA 3ZX4A 1RKQA 2O4CA 1ZSYA 4B2LA 5JS7A 3TRJA 3LXUX 3OAAA 4LZJA 4HPXB 2OXCA 1UPCA 1U1CA 5IDVA 4US2R 3WS7A 5ILOA 3WLFA 2ZSUA 3EXFB 4D4HA 1SU7A 2EKLA 5ETJA 3TIGA 2C04A 3NYIA 4FD2A 5DM2A 4D80A 5BOVA 2W71A 1DC3A 1NVDA 1SCIA 3UTCA 3S81A 2J32A 3HTXA 2HDNB 1P2TA 1BSVA 1QKKA 1MC4A 2Z2KA 3I61A 2MSLA 3IXQA 4KN8A 5BVGA 1W2WB 3LBIA 1Q1GA 2GBCA 1GSOA 4PZAA 3ROGA 4GP9A 1FS5A 4C7BA 2IZOA 1XMJA 3K70D 1BJKA 3A6GA 2VC2B 2R5WA 4OQXA 5CD9A 1S2GA 1RU3A 1E2UA 1KEKA 3C15C 4XKJA 4DIUA 5J2TF 2O5RA 3VOBA 3GJ7A 4DQXA 4EA9A 2VT7A 2H9AA 4DM7A 4DMMA 3KT6A 3U44A 4COKA 1TTQB 1DDIA 4EJ0A 3PPYA 1C30B 1EXDA 4PU0A 2VWGA 3VNQA 4FGLA 4BLOA 3JQAA 1GYQA 5ICMA 4RM3A 5AK4A 3NT4A 3PFFA 1KY3A 3EGEA 4CV0A 2LIVA 1TKBA 5BYBA 1H9AA 1N5DA 2R68A 1SVSA 3EXIA 1XQ6A 2E48A 4EJSC 5LPNA 3DH0A 4LJ8A 1WM1A 3EIHA 1EJ6A 1TKAA 3IVCA 4RD2A 1X15A 4MGIR 3LL7A 1H4QA 4QDUA 5AW0A 4UHBA 2CEAA 5DE3A 1Z73A 1SC6A 3IAM1 4Z1MA 4NJEA 4OHUA 5FTKA 5KSYA 4OM7A 3ISVA 4AF8A 3EGDB 2CVOA 1SVWA 3OOYA 1ULZA 4YREA 3QLJA 3SOPA 1J33A 2Z8YM 4NMMA 2VHJA 1CF2O 4I1PA 3OOHA 4LYEA 3I4CA 2XI4A 2GZRA 1LUAA 3DA8A 4MYRA 5KQGA 2PJDA 1IOVA 3NYQA 4LQLA 5B1HA 2GK4A 5DXAA 4P38A 5TEWA 3T0IA 1FSPA 1XQ9A 4QEDA 2XCTB 4RE5A 4V38A 3IB6A 2C3PA 3MWYW 1PUIA 4A82A 3PTZA 1G5FA 1DVRA 2JEZA 1X7YB 2AI3A 4IDCA 1NE2A 4XYMA 4AUMA 4JP1A 1ISFA 3EQZA 2IS1A 2E7ZA 5C3UA 3QKIA 4KTVE 1Y7TA 3N2IA 1VPDA 3L84A 3RRNA 3FLMA 1PR2A 3EUAA 1J49A 1RRFA 4O4IA 4TXJA 4QO7A 3TZCA 3R6DA 5DM0A 4S2UA 3B85A 4GYWA 4LHZA 3U0VA 3AM5A 1AUPA 2AGVA 1QM5A 3Q2OA 4JUFA 5HIMA 4URXR 5K0ZA 1RS0A 1W76A 4LTMA 3C6BA 2I4TA 5JJCA 4CPDA 3KJXA 2M1XA 3PXEA 2WKSA 4Z7NB 2HY7A 4OOEA 4KWIA 1V3TA 4H31A 4MW5A 4BMXA 2EFYA 1GD1O 2NV2B 3CVOA 1FQJA 1JDTA 1Z7EA 3U6BA 3PQ8A 2HJSA 4DUGD 3WISA 1RHRA 1WABA 2MYNA 5CH8A 3S5UA 4PCLA 2X8LA 3FOFC 4MS3A 4HAWA 1DFGA 1N75A 2ZYUX 1Q16A 2GKOA 3FXAA 3RTCA 3G1UA 4FUQA 1EH5A 1JXMA 1WPRA 1I4WA 2WHPB 2QAGB 3E81A 1TOAA 2C1ZA 4OLFA 2PU5A 4RLSA 4J2OA 3PD0A 4HNRA 2BR4A 5EHNA 1KQFA 1RBZA 2Z1NA 1DT3A 2BIFA 3EWNA 2R86A 3VDNB 3N0RA 2AWOA 4OOFA 1E0DA 2IHVA 2JGIA 4NJEB 2HNBA 2OENG 4AC9A 4LYGA 4UDYX 5FA5A 1OA1A 5F4BA 2V3VA 3C7KA 4EHLA 1NVVR 3I2GA 2I1WA 3EGDA 1G9SA 4R51A 1CNEA 1I30A 2QX7A 4I9FA 4NHOA 4GEGA 3LPNA 1KE1A 5I9NA 3N2KB 3CT4A 3JZDA 4OUKX 3RSGA 1J5XA 3S2EA 1JXOA 2BF7A 4CDRA 3NT5A 5DGTA 1FSFA 4P92A 4HNUA 3W5AA 5KTKA 4HDKA 2P2CA 2WIJA 4Q1BA 5DEIA 3JWEA 5H3CA 1BRTA 1ZY2A 3PZBA 3VHLB 2O07A 3OLWA 2V3CC 3C5WP 4H59A 4MR8B 4JEMA 3LWDA 4I8IA 1EQAA 5E3IA 5H68A 3WR5A 3W3AD 3EPKA 5A3QA 3BFXA 2OXIA 2ZSJA 5M04A 3TCXB 1BS2A 4LNAA 2B25A 2BEWA 3ET4A 4Q4CA 1HT2E 4LHXA 5BV8A 1J0EA 1X8LA 2VUIB 4URZR 3KEGA 4YAIA 4E94A 4PLZA 1QZZA 4AY3A 1LV8A 2HO5A 2VP4A 3PWSA 2W4QA 3QUQA 2BUAA 1Y80A 1NPYA 4MO2A 4EO4A 2QN7A 4FGWA 4DPKA 5AUOB 2IXDA 2M1ZA 2WJWA 4P36A 3HPRA 1VCOA 5KTYA 4YRLA 2PMCA 4RZHA 1NXOA 1JBEA 3DBIA 5LA6A 5CCDA 2PXAA 3SBDA 1UKEA 4MI3A 2QRGA 5BRJA 3KQHA 1H6CA 3KWJA 3SD7A 1WDWB 2FQXA 2K87A 1R10A 2DULA 4ILEA 4JXKA 4Y7CA 1BROA 3OZAA 1GPAA 4AX8A 1GCIA 1V71A 2ODEA 3BN3A 3ETGA 3F97A 4HZUA 1NZJA 4RNCA 5CPBA 4Z7QB 4JODA 4Q1CA 2OCGA 4QDJA 4QQKA 4OMDA 4HGZA 4O0LA 2XUHA 4ZO9A 5FQNA 1RQ7A 2GFQA 4ROTA 4GYYA 4QTUB 5I5EA 3G2NA 2QROA 4BKPA 2P4EA 1F6WA 3Q3CA 3RSZA 2G17A 1L6IA 4GX0A 4J6FA 3OQVA 3V3KA 5HZHA 1IIBA 5ALNA 2IBSA 2QX9A 1WPGA 3IAS6 1M6EX 1WA5A 4G1VA 3QEOA 3PC8A 4JUBA 3A8TA 1PZMA 3L1IA 5ER6A 3OKFA 5HNKA 5AVQA 3ONWA 2MINB 4KNWA 4X3OA 1RRCA 1R27A 5CUQA 2G77B 2LV8A 4B32A 4FONA 2D59A 3DOHA 3H1AA 3IUJA 2RCNA 4Y0NA 3R6LA 3QVKA 2HXGA 3LNTA 3VC1A 3SMVA 3GA7A 5CB4B 2WJHA 5C46F 5WRFA 2H1CA 4O3FA 4M1OA 3K0CA 4Q3NA 1KJIA 1OBCA 1I1OA 2PUHA 3C3DA 4MCJA 4RD4A 5DBHX 5K0LA 3T5AA 3TTVA 2J09A 1GT6A 2BDTA 2PGXA 1VKNA 2OSBA 4AUKA 3QVGB 2IHTA 1E59A 2VJOA 3L0OA 4YJ3F 2GZDA 3LVBA 1E8MA 1XZEA 3OF5A 4Y9DA 3AVQA 4ARZB 3II6X 2I6TA 5FX2A 2OPBA 3F7MA 2DJ5A 3AUAA 3AWIA 4EOGA 1JWLA 1QFSA 3VMMA 1OZFA 3C6YA 3BXOA 3LUKA 3NZEA 3RSQA 3WYBA 2EZ4A 3AUJB 3K30A 4KQWA 3DWEX 2QVBA 4GKVA 5ELXA 1EA5A 3I6YA 1YZVA 3LY9A 5IDXA 2PCJA 3BWVA 2NUPA 3FB1A 3PCXA 1KI9A 3E7PA 3N0TA 3R7LA 3SVZA 4NABA 1R5JA 2VYND 4N48A 1H1DA 1H65A 2CMGA 3ES9A 2HTEA 1NRJB 1LH0A 2H5JA 4XB1A 2MMGA 4CIAA 4HOYA 1AS2A 1RRKA 2CBXA 3H11B 4LYDA 4CF3A 3ZHTA 3I9MA 4BGIA 2MSDB 1N6OA 2ZW9A 2X7XA 2HWYA 3PPVA 3ZJTA 1EFVA 4WH0A 5JCXA 2G9NA 1HI9A 4KRFA 1JPNA 2WICA 1FE8A 1CCWA 4PLVA 1H6AA 2X8AA 1EP9A 3EIFA 4EKDA 4QVIA 1UDCA 2WPDA 4LK2A 3X1JA 4DNOA 2QNBA 1GCOA 3HCDA 2JCGA 4EB6B 4GPIB 5JNLA 3DVAA 3Q1KA 4TWJA 3IDAA 1KYXA 1WB4A 3A4IA 4MVJM 2I6QA 2PG3A 1JH8A 3REQA 1JDUA 4JT2A 2BV3A 1A9QA 2ZFUA 1K3TA 5D01A 1YZ3A 4I55F 4DTCA 2YZ2A 3COZA 1ZUHA 5AVOA 2IZ1A 2O20A 2DQKA 2GXAA 2C5LA 3A7EA 4HADA 4KO8A 5G1PA 4AM8A 3JQ7A 4FHZA 3VPCA 1SEVA 2NO4A 3F2IA 5GVRA 4B4WA 3LAWA 3FY4A 4J1TA 4BRZA 2CUNA 4N6OA 2CZQA 4HWKA 1PWXA 2OCDA 1K6XA 3ZW7A 4FYVA 1MAWA 3UT5B 3BHMA 1NQVA 3KP1A 3KG2A 3PNQA 1NNLA 1TA4A 2W2OA 1Z3CA 3R5XA 5H8WA 2N9UA 3VPXA 5AK6A 2HCBA 2YJNA 5I7FA 1RXWA 2GEBA 4RPCA 4XPIB 3PC2A 3V1TC 5JFTA 4JYBA 3TBFA 3WDKA 5GMOA 4Y6QA 1PFWA 1B15A 4EJFA 3GA0A 1HT3A 4P3KA 4R81A 3EGOA 2I4MA 2BKAA 3CGGA 5H5JA 2I5PO 2X0FA 4CKWA 3HI6A 5EIWA 1A4RA 4G4GA 3I1YA 1RM0A 3E53A 1QPGA 3E61A 5I01A 4RGYA 2C9DA 2TMYA 4DR7B 3AY7A 1WXEA 3KOMA 4FX2A 3UM9A 3LUFA 1QLHA 2EFDB 4IWXA 4IJUA 1W4AA 4WNAA 4ZOQI 2BGGA 1XTUA 2M32A 3B36A 4YRKA 3JAMA 2F3PA 4IVNA 2NUAB 2H0AA 3K32A 4DYVA 3N39C 1U3CA 1FDWA 2QI9F 2YC2C 4M87A 2C54A 2O0LA 3LHDA 1SVIA 1S2OA 2QYOA 4WADA 5D51S 2BI7A 2ZUEA 2X5JO 1BDMA 4FDUA 3CEJA 2SICE 3ZWOA 1D2AA 3GJ4A 4QGBA 1NJGA 1OFGA 1CR1A 4GP6A 4TTRA 1NOJA 4C3VA 3E9CA 1J8FA 2HWKA 4WX2B 4DT1A 3SG0A 2JAWA 1FP2A 5LNK6 1CUAA 3J7AC 4LV5B 1EP1B 1V8OA 2ACEA 4RJIA 3A3PA 3AR2A 1SVMA 2ZYVX 3WYGA 5KWEA 3INRA 1GRQA 4G3XA 3FVRA 2QDKA 3T7KA 4MVWA 1KQ3A 4TROA 3UAZA 3TGPA 3GVXA 1EUDA 1ZR4A 2RBEA 3ASYA 1AQ6A 1I7DA 1YDMA 4BFUA 3KQNA 5EPEA 4M55A 1D09A 1SC3A 1TJ3A 3HZRA 1NBOA 4LCBA 4QXQA 4XGQA 1XGKA 3QJ5A 1Z6AA 4I1YA 4AMUA 1OXBB 1G5PA 1E0KA 1P7YA 3MJVA 1M8KA 3PXAA 4F2HA 3PP8A 2PQMA 1RBQA 4NBRA 4DLNA 2DHQA 4QM6A 4E0BA 1JHDA 1PJAA 4RH1A 3KEMA 3NHWA 4GMHA 3SYLA 3U40A 3KPUA 4MOWA 2EJVA 1F0YA 1L4NA 3T0GA 4CJXA 4MHSA 3G85A 5L4SA 1FRVA 1L5YA 3ZQKA 5B12A 4LFAB 3QMVA 1XC7A 5B6IA 1M2JA 5KNDA 5AMXA 4YRFA 3QVXA 2LR0A 3CF4G 2GILA 2TYSB 3CUKA 2XB9A 2Z58A 2RIRA 3JQGB 1Q0LA 3THWB 1D6JA 2WIAA 3KEOA 4J8PA 2FETA 1IXRC 1JSCA 1KPGA 4J9VA 4WBSA 3T7EA 1RYHA 1KO8A 3QX8A 2IFTA 2WIFA 2OLEA 1KAHA 1UXIA 2E6UX 2H1RA 3FJOA 3O2QB 4OHKA 3N0WA 4DBLE 3K2IA 1B74A 2JH3A 1YJ5A 1E62A 2OQIA 5DLEA 3UXHA 2ZWVA 5C3MA 5I3CA 4PGMA 1R9MA 4PLHA 1I3NA 1NV9A 1MQAA 2CBGA 3RVOA 2AYXA 5CDTA 4GU5A 4AP9A 4IJKA 4LRXA 3KL2A 2HL6A 5BVGB 1E6MA 3BE4A 3PVZA 1H2HA 1CJUC 2MYUA 1BS1A 4WD3A 4Q24A 3V7FA 2HBYA 3GX1A 2BMAA 3L4BA 3O3NB 3V7WA 3QVMA 1EWTA 3DFIA 5DHFA 3RTDA 4JJEA 3DEIA 1NFRA 2PX3A 4MKZA 3ORYA 1OLSA 3WWDA 4CI0B 3STTA 2WAAA 1UPUA 2PUGA 1ECLA 1M2KA 5EMLA 5DX0A 4CN8A 4HVLA 3OZSA 2IEBA 4ITRC 1ZPDA 1B2RA 1R18A 5LDGA 4BMYA 4HQNA 2OG2A 2WUEA 5ALEA 1NMSA 4LS3A 5DIFA 1AO3A 4Q1EA 4BZZA 4HNHA 4AO7A 1R4NB 2A5GA 1FSSA 4KHZA 4Z8YA 2J3QA 2ZBEA 1EUDB 2PH5A 3MCWA 1L8XA 4YCSA 4JLPA 4YLEA 5A2QA 5I3ZA 3DBOB 3KYDA 2BOVA 5JVDA 3P97A 2P2DA 2RGRA 3DOJA 4UZEA 3KB8A 1KJNA 4Q15A 1E0AA 1DLJA 8AT1A 4DV6B 3TMAA 2YQZA 1DCMA 3I6BA 2G7MC 2W2LD 1TTTA 3GH3A 3HBNA 4QXPA 1MD9A 2JHCA 3KKEA 1FLAA 2V7PA 4X1IA 1WX1A 1PJLA 4Q16A 2IJGX 1KO1A 2CNOA 4B17A 2B21A 2HUNA 3PVSA 1MJGA 3D4PA 4DUYB 3D6FA 3SJAA 3IXMA 4HDSA 4MPDA 2HEIA 4LBWA 1ZA1A 2D5AA 2VLIA 4XR4A 1C41A 2Z4RA 3LVFO 2DCUA 3KKOA 3R77A 5FRDA 3UK6A 5FA6A 4JXXA 5AOBA 3TR5A 5E7JA 4PQYA 3A6LA 2ZIWB 4N0PA 3VAYA 4HRXA 3PUIA 4NVRA 4B48A 2IYWA 2VYCA 1YL5A 2ZUDA 3RPEA 4ZYYA 5B4VA 4HQLA 4LA4A 1W4ZA 4UASA 4YS6A 1GGMA 4G0UA 1O94A 2VHTA 4NENB 1CUZA 4Q1FA 4ZIRA 5IN4A 3PUZA 1V16B 2JIRA 3AW8A 2B35A 1IDN1 1WVIA 2AH5A 2YTZA 3IUMA 3QBDA 2QGFA 4H6VA 4PNZA 5BO5A 5AFSA 4INPA 3G5TA 2RB5A 3E35A 3ZV4A 1EVQA 2B92A 3ESDA 1XQXA 1SQ0A 2ZQYA 3GBSA 3JAWB 1FMLA 4R83A 1OYWA 3GQVA 3DOCA 4MARA 4R1MA 4L6CA 5BNWA 3OT5A 4EJSA 1ZM3A 2X42A 2A9JA 3KDPA 1ZOSA 1HKUA 1VE9A 2VK8A 1IBSA 3ONEA 2HPAA 2JIZA 2NACA 1S96A 3D6TB 3DVRX 3MB8A 3NHPA 3KB2A 2PS1A 3PNOA 1RKVA 4RYDA 1SC1A 4GDFA 3U4DA 2QJWA 3JQ8B 4ZQFA 4B09A 4DQKA 1KTIA 3IFSA 3R75A 1C2TA 5HTOA 3BMOB 3PHJA 1KO7A 3GLIE 2XB6A 3O3MB 1XROA 4HVTA 1SULA 1NYLA 2CVPA 1Y7PA 2PFGA 3PS9A 5HCUA 4EG6A 1EWQA 2VXOA 4OXRA 2DKOA 2D74A 3JD0A 1XX6A 3GEGA 1XOIA 3E9NA 3FFTA 3GF4A 4JLKA 4Y8VA 1BG6A 4AMZA 4M6WB 2SKDA 3JRWA 5ENDA 3ZJUA 4JYCA 2W70A 3TW8B 3WWPA 3CH4B 4UDNA 1J42A 3ABQB 5CRIA 2XIQA 3DZCA 2FY8A 1L7BA 1SZJG 1UF9A 4BCCA 5E6RA 1G8SA 1A2BA 1UC9A 3ESBA 1C7ZA 1CRWG 3CVJA 2XIJA 4TV8A 1Q17A 4RL4A 5HM6A 5IKMA 2VHCA 1M2HA 1VKZA 3COPA 3ONVA 4O4LA 4Q3EA 1S5PA 3AGQA 4C9BA 4CKBB 1L8OA 2QYTA 3GGDA 3PQ7A 3TRFA 1FZTA 2QE7A 2PGNA 1UPFA 1BXKA 4A26A 4UBOA 2UYCA 3BTUA 1HDOA 1LBTA 3CRMA 2G80A 1HM5A 4N39A 1ECFA 3O4JA 4YMSA 4D5GA 2VH1A 3VC2A 1R4AA 4BPBA 4HLQB 1K8QA 2VRNA 2A84A 2FN9A 4L3WA 4W8GA 4Z9AA 1N5IA 1WL8A 1AC5A 2WU3A 3Q12A 5DLDA 3HNRA 3W7AA 3W6UA 1Q6YA 1JWBB 2JK0A 2BD0A 2Q46A 3LZ6A 3RARA 4DA9A 1TJ4A 5BV1A 2IH2A 5A9SA 4AB1A 1OYOA 1ZVJA 4KGXA 3KUXA 5SY4A 4YUAA 2AR9A 5A7GA 4NQRA 4WXRA 2YJTD 3VI4B 5IXJA 5LKRA 1T9GS 1KMNA 4K9MA 4JELA 2JNWA 3H4VA 5EKDA 3SLRA 2CNWD 2HNAA 3EZ6A 2P6RA 4FSHA 4BTEA 5HW0A 2WUGA 4F85A 3IVRA 3U7GA 1JDSA 2A0KA 2HA7A 2XD4A 3EXHB 2JD2A 4JLVA 3TIIA 3KQVA 4NOKA 5LKAA 3JQRA 3L6UA 4R2XA 4F9GA 2ATXA 1RAFA 5EKSA 2V6IA 1W5AA 5FTLA 1LRLA 5EIHA 2J85A 5JFOA 3DOUA 3KEQA 3JQ8A 3NOOA 1FJXA 3PHLA 1FX1A 2WD7B 4HWPA 2EBHX 1E5LA 2CLOB 3OM8A 2FQQA 3VX3A 5IUNC 3ZXIA 5HZGA 5IRCD 1CETA 3GOHA 3VJRA 3FMIA 3MERA 2G76A 2YFQA 2XKKA 3G0CA 1R8QA 1IHDA 1Z0IA 2HQ1A 1PZEA 2YWGA 5D3MB 3RM3A 1OFHA 2JBHA 2R6GA 1E4EB 2AW5A 5SYMA 3GZNA 3VH1A 1W8IA 1JFRA 3PGJA 4QLAA 3VR3A 1N2CA 1NMQA 4Q1AA 3VR2D 2PZEA 4JITA 3EZFA 1I13A 3G5UA 3VU9A 4DUPA 3OQPA 3O9VA 3V2IA 3LXRA 3H05A 3LX4A 4DVGA 3ZVNA 2YOGA 2ZROA 3G2QA 4R6XA 1UAYA 3SKXA 3VO1A 3ZIAD 4B4UA 2V7BA 4Y98A 1P1BA 2WAYA 3AETB 1HLFA 5HFNA 4LOHA 3UFXA 4D9EA 3OTQA 1UZLA 4MGEA 1XZBA 5G40A 4LDQA 5I8PA 1DRWA 2VKTA 3MIIA 3TRIA 2H2GA 2BW0A 2ZYIA 5SZIA 4OLAA 1YUMA 2VPWA 3C24A 5IJ0A 3V1LA 4R8SA 4PZ9A 4G86A 1BVYF 1DI0A 1XU7A 4BQNA 5EMKA 3BTSA 4G8JA 2GQ0A 2IU4A 4AIRA 1QF9A 2J4DA 5MGNA 4YMUA 1NBAA 3S0JA 2AYZA 1XL1A 3EEOA 3AKDA 1J0XO 1PS9A 3K0HA 4XWKA 2O23A 1ZZGA 1EWKA 3Q3JB 1GEGA 1WTAA 2ZT8A 1UIRA 4YAKA 4IINA 1I2ZA 2XCLA 3G17A 3OEHA 4TOIA 2IYPA 5FTMA 2OYSA 1FUEA 3GRRA 1HT0A 3JASA 1F4PA 1D3AA 1H6BA 1T0BA 4FYHA 3FGPA 3OJLA 1GNVA 1A9XA 5AOAA 1OH7A 3O4FA 4MMYB 3SIWA 5EKTA 1FEZA 1F17A 2Q0QA 4KLAA 4E1VA 4EELA 4IYJA 4DIKA 4XSVA 2HT6A 1VJRA 5TVGA 2PXXA 4L78A 1A9YA 1D5CA 2B5VA 2C2ZA 4IJVA 4WBNB 3JWJA 1IUKA 1JHMA 1JYEA 4M86A 5CEJA 1DCTA 5I9BA 2QRPA 1X7XB 1TD9A 4YAJA 4NICA 1M7BA 4MV4A 4OGGA 3HJCA 1H2YA 1B8OA 2OECA 3ZV7A 2P90A 1US8B 1AUOA 4L3OA 4UARA 2W6MA 1OXVA 1Y42X 1P5FA 2JHFA 1E1MA 1Y8AA 1D6SA 2Z5LA 5CA0A 4C6TB 4CEIA 5G0WA 1PVOA 2XAUA 3OD5A 5E4TA 4KX5A 3AM1A 4ZO8A 2FMUA 4CHTA 1P33A 3DQQA 2PUBA 3LECA 4PHTA 3DEYX 4GZ6A 3E23A 2REBA 2Z09A 4MJ7A 1J6UA 1KKUA 4RTJA 1U2RA 4IYRA 4AY6A 1QP7A 2O5CA 1W88A 3KT8A 4XDGA 1NIJA 2AC4A 3IEKA 1NY6A 1Z7BA 2VP3A 3FFWA 3L7BA 3MS4A 2PMBA 4YRQA 1QMPA 1UK7A 4IAOA 1EDOA 4M0UA 3U4GA 2N47A 1E0SA 2PTGA 2COKA 4DRYA 5F64A 1PQPA 1HETA 2Z1MA 4RFLA 5T57A 1P29A 3E3OA 4FIZA 4MVJD 1ZGBA 1VCHA 1VYTA 3QF4B 2DRIA 3TX6A 5J40A 1SHZA 1GNTA 3NNDA 3KJIA 1N1GA 1Q1AA 3REFA 5LP6A 4PX2A 4HQKA 1AKUA 1PQYA 2H4XA 4EITA 3DEHA 2ZM6B 2QXTA 2NU8A 1EX6A 3B82A 1HY3A 1ODIA 2QLNA 1N77A 1U1FA 3AHDA 2XTNA 3RT1A 4BDTA 1I0IA 2IHNA 3WYCA 3IJRA 4PE5B 4D46A 2B34A 1OSNA 1TB4A 4LC9A 1LTKA 2M6RA 2IBTA 5IZCC 5B6JA 3RYIA 1IZZA 1QHHA 3AZPA 3QUSA 2B36A 2NSYA 3MD0A 3U3KA 3LQKA 2H85A 3WBJA 3RAJA 5SICE 4EX7A 1K3UB 2P9YA 2IY7A 4ZALA 3GR6A 2WU0A 1J23A 3T7DA 4NZNA 4B87A 2FZCA 2YMQA 3UWDA 2E4YA 2ILVA 3SHOA 2GNAA 2VDUE 2XR1A 4JSTA 4V1CA 3WMRA 4M46A 5ECWA 5FV7A 1WB9A 4PN3A 3ZBPA 2ZYHA 1F2TB 2WTEA 221PA 2Q9CA 4LV8B 1CXZA 4Q3KA 1HLPA 2IUYA 2LDBA 4PONA 4K8OA 4LRYA 2FPXA 1U98A 2XHEA 2UYGA 4LWPA 3OZBA 1EP2B 2AN9A 4P8RA 4RVNA 3B7GA 3X1KA 3GA5A 5EZ6B 4LOLA 4Z99A 1EFTA 1NRWA 4L51A 1NR5A 4PG7A 1JU9A 2G1AA 4IKEA 3QNWA 4IMJB 1S2IA 1IEQA 4F71A 3G0DA 1KZYC 4N1AA 3HCOA 4H7FA 3QYAA 4DV0B 1J24A 2ANBA 3WV5A 3UMCA 5JDIC 10MHA 5DWDA 5FUWA 1Z0JA 4J07A 3K1AA 4RANA 4EI7A 2I2DA 4EGSA 1TLFA 2QL9A 3ZEAA 1MAUA 1NVXQ 5K3FB 3VR4A 2R751 1Z25A 1U2QA 3ITNA 2JAXA 3RIMA 3T9BA 1U3VA 2FF7A 3E9ZA 3MQ4A 2XMDA 2I7VA 5ESDA 5LQKA 1T5IA 4D98A 4URFA 3OLCX 3BYZA 3V97A 4EKNB 2WSMA 1V7CA 4QECA 4CUJA 2AKAB 2WD8A 3IPCA 5J9FA 3QPBA 5DJ5A 4F3CA 3N0VA 2IV3A 2DFNA 4CMIA 1FS6A 4ER5A 1ORVA 1U7HA 4I6JA 1HK7A 2EFEB 1WXFA 4YCLA 1UWCA 1C9NA 1AHIA 1V11B 2CNKA 1EK5A 2ZIAA 5F35A 2BKUA 1H2RS 3GPCA 4G97A 3PGLA 1MG5A 3PR3A 3D4NA 3W6NA 1LDGA 1BTOA 1RI4A 1LSUA 1T2NA 1TMOA 3QU5A 1E9DA 4LRSB 4UD2A 3P71T 1DKOA 3EVAA 4FWBA 1ZSVA 4FKBA 1LQUA 4HRYA 5C1IA 2QUKA 4BLTA 4ZYWA 3RFUA 4AY4A 1RAIA 3BZUA 5A4AA 1MFPA 4LVUA 3P2OA 5DHTA 3C4QA 1IYZA 3ZY4A 2O3JA 4ZYXA 4G25A 3AF0A 2GX6A 2IPNA 4KR6A 1XJ0A 1OAOC 1WW8A 2IYSA 3DZDA 4YJ3B 1HF3A 4CM8A 1WHTB 1ODSA 2C29D 1O6BA 3GLSA 3I64A 4FHDA 4GLFA 4N18A 2VF4X 1EGMB 2QTAA 2IYAA 2EX1A 3SBOA 5E0KB 3T54A 1BZYA 4EFMA 3KLNA 4OX9Y 2HMSA 3ETEA 4BNFA 4H16A 4PX3A 1FX0A 2ZE6A 2BZ0A 4EUEA 2P7HA 4U9IS 3TI9A 4DPLA 2ZSAA 2BFMA 4J0GA 4ZT2A 3HCWA 2MR5A 1RD4A 3P19A 3OP1A 1JE0A 3VZCA 1X13A 3EH1A 3SYNA 3HB7A 1K5HA 4GYJA 3P2JA 2J5KA 4RCVA 2Q6VA 2ZUUA 3G0IA 3ODGA 4BFSA 1NUQA 2Q5EA 5CW1A 5YASA 1FQOA 1IQPA 1V3VA 4Q6BA 5LA6F 3V8MA 4UUQA 2IDJA 4TQGA 3EXAA 3LUDA 4A15A 4RQAA 2HFKA 1VKHA 1IPFA 1Y7IA 1YMVA 2YMMA 4Q3CA 5EXXA 1WU8A 4ISBA 4E12A 1V8DA 3IIMA 4LY9A 3W5DA 2WFMA 3IKJA 4NEHB 2VUTA 4QFDA 1QFYA 3CRRA 4NDNE 5K3FA 3KVOA 4FNAA 5EA2A 5KSWB 3AR4A 1AX9A 2A1UB 121PA 1ILEA 4K5QA 3R76A 3D5TA 2UZ0A 1BXZA 3VBCA 4LXXA 1ZJ5A 4C7MA 2IXBA 3W9SA 4M9XA 1UBGA 2H1VA 4PYMA 4NYMR 5HS4A 5I47A 1N57A 3NHSA 1D9XA 1SG6A 2NTYC 1IPEA 2BFEA 3X2SA 5JJKA 5JVDB 1U8CB 1ORHA 4P3YA 1XUOA 3KQMA 3L92A 4MW7A 3ZHUA 4OM8A 4J6EA 2HPVA 3GP5A 4DMGA 5CA0F 5U4XA 2C8KA 4QYWA 1AGXA 1WU7A 3QYPA 1QR6A 1P7ZA 3MXTA 4JP5A 3VR6H 5K8TA 4FYIA 3TNLA 4MB0A 4UQLA 4A92A 2QV7A 3GFFA 2GKGA 2IYRA 4XUCA 1X1CA 4IFTA 5BT8A 2G09A 2FPWA 3KKLA 3WGHA 2IU0A 4PYNA 4D74A 4EVSA 4HB3A 1VB3A 2PZLA 1QCZA 5MFZA 2KI5A 4I4IA 1XAJA 2ZK7A 4PWZA 4B0OA 5JDIA 2VPXA 3EBPA 3ZI7A 1V96A 4JKIA 3GVCA 1NUUA 2P69A 2XRFA 1SQGA 4W5WA 1QU3A 2QVCA 1RR6A 3IERA 2R7KA 2QTBA 2LKCA 3ZWKA 4D3YA 1OH5A 4U7WA 3UMVA 1Z5WA 2D7DA 4Z53A 2AMJA 4DCGA 2AOUB 2ZWMA 3TLBA 3PLNA 3D7MA 1PZGA 1B0ZA 1IULA 2FEXA 1PJSA 2C2BA 1Q3TA 2ZB7A 3SM9A 4COOA 4DSOA 2OORC 4QOFA 2DJIA 2NT4A 2X40A 4NU6A 3VR6D 5KX5B 3SF0A 1DG1G 5J4YA 4UNRA 3LP6A 4DV5B 2YZNA 1K7FB 1PZFA 2OXRA 2ZRAA 1OBFO 3DD5A 2CDRA 2YZGA 1S1CA 3NBAA 5AOVA 1ODKA 1A7AA 2WSSA 4MS1B 3C43A 1GU1A 1NU8A 4HXYA 4OYRA 4BQOA 4QQRA 2GJ9A 2RHWA 2G5TA 1K4MA 1VSQA 2PS3A 3K5WA 5CMLA 1L9XA 5TMPA 3HV2A 5LM3A 3LP5A 4C22A 1E79D 4ND3A 4G85A 4OF4A 3MSXA 1FFEA 3Q9LA 5AKZA 3W8FA 2ZSKA 3IP3A 4D8VA 4I5IA 1KDRA 3RGGA 2E4UA 2IELA 5EHQA 2ISCA 2B20A 5A4DA 1Q0HA 1TC1A 5ES3A 1HFJA 2HBRA 1W9HA 2B5OA 2AMVA 1R12A 2EBFX 2QZZA 3E8SA 1IL0A 1TO1E 1X19A 2VXYA 4O4JF 1YJCA 1W36C 1ZH6A 2VJMB 2AD1A 1YRBA 4TQAA 4U2BA 1REQB 5KDLA 4ENVA 1H05A 2VH5R 5C8YF 4MTCA 2AUNA 1WWKA 3GGSA 2ONZA 1F0NA 2B98A 1EM6A 2A0WA 2FWBA 4RGVA 4NMWA 1ZITA 4UCQA 4FYJA 3EPPA 1TE2A 2IOFK 1W36B 5FOTA 2NVUA 3D0RA 1GGVA 4QICA 4EUFA 1CY7A 2A6PA 3CSSA 1Z4OA 2OGSA 3BRSA 3H8WA 3HSKA 2FMKA 3PD7A 3P0JA 3R7WA 5I9IA 4QG3A 1FRQA 9ABPA 1GTSA 2DVMA 4EG0A 1PEKE 1YFZA 1NVKA 5CJ2A 3R0QA 1PIWA 1VB5A 4BEVA 2C94A 2FWJA 4JIGA 3CJQA 1XZDA 2XOXA 4HTAA 2GPSA 4FDLA 4PBSA 2JLBA 1H0KA 3C98A 4IXNA 1GAWA 4RULA 3FYDA 1BHO1 5LDHA 3HJBA 3CTPA 3R8XA 5K8CA 2RHRA 2QIOA 1KSGA 1DQSA 1E69A 2REQA 2P40A 3B13B 1KE2A 3GRAA 3SYTA 1RFLA 5LB2A 2G0TA 3L1JA 4C5CA 5JMWA 4PXSA 4AYXA 2GM3A 3ADOA 1ORWA 5KS2A 3S3TA 3B20A 3N53A 4V0ME 3D5QA 3RJ9A 1U9YA 3HVJA 1IOZA 1H2FA 3C85A 4BNLA 1TVMA 1TGVA 4GQAA 1J8VA 4H1HA 4QNNA 1Z38A 4AO6A 3AUTA 5DB4A 3V8EA 1XRRA 4U00A 1PLLA 1IEVA 1PW5A 3D6NB 1I2AA 2PZGA 2OHIA 3WL6A 3P2MA 4C87A 2JEOA 4ODIA 4Z4FA 1L7RA 2WAOA 1L4YA 3B1WA 4BGUA 4LZOA 2WD7A 4P3NA 3U56A 1KZ4A 2EYQA 3E2IA 3OCVA 4IZ6A 3OZRA 4BRSA 3VYUB 3AV0B 3GPDG 4V39A 4JD5A 1DWQA 1O6CA 3U3XA 4MSUA 1KNXA 2PA3A 2VR1A 3PGXA 3EC2A 4KV9A 4QL3A 2IC5A 4KFTA 3VKVA 4J0QA 4EPXA 3HR8A 4Q4AB 3JPYA 3ZCSA 3AH8A 1J07A 3O5AA 5DTIA 5G02A 4DBVO 1E66A 1URPA 2CWWA 2PR2A 3NTRA 3H9BA 3VVBA 1VL0A 4DABA 4DMUB 5BWCA 3T3OA 2E85A 4HDOB 2QORA 3VU9B 3BZWA 3QIAA 3WLNA 2FA9A 2V59A 3CLKA 3IVGA 3DTVD 1AQLA 3JQEA 2WJJA 3A6HA 5G0UA 1T4MA 4WNIA 3RHSA 4QPZA 3V2HA 3ZN2A 1VOTA 2QAGC 4TMXA 5HKKD 4OQFA 4MWDA 3RFFA 1F6DA 3IOMA 3R6TA 2QTNA 3KXKA 2ESRA 1H9CA 2GCEA 2ID4A 3U3MA 2I54A 3GRZA 3STUA 1DBPA 3GFBA 2D3TA 3V7UA 3WGKA 5B7PA 1JHXA 3LNCA 4QJBA 3KYBA 5LXTF 4E03A 4URUR 3T99A 1NXQA 1XDBA 3FLBA 2YWFA 4NF2A 1AOXA 1E1DA 2B7CA 3DZKA 3X1DA 4YJGA 3BCRA 1JE1A 2OCKA 5BQPA 4AJLA 1YS1X 3KR9A 1Z0AA 2C2MA 3MOIA 1ZHFA 3GVIA 1U28C 2IEAA 3KC2A 3Q15C 2WKRA 3Q7IA 4BQQA 2YFHA 1U7XA 4X54A 5CM2Z 3HJAA 1UJ2A 1EJ0A 3MGGA 4BO1A 4D1YA 4UFPA 3C8ZA 1X86B 5A4JA 5TDHA 1RHJA 3PQ5A 4DM4A 2E18A 3CLRD 4UEJA 4Q9LA 3EMBA 3PT5A 3TPCA 5HQJA 1PUJA 2P0AA 1AVTA 4XWOA 4R7TA 1R8XA 4I9NA 3OOJA 1QHYA 3VTKA 3V6MA 3QM1A 3NWOA 4UXIA 1FYVA 3E4DA 1DBVO 4BKUA 4BZWA 3DVLA 3L4BC 1ZI8A 3V4OA 1F8UA 4KZKA 1X42A 3SVTA 2C3MA 3GLFB 1OU4A 3D1VA 3IEUA 4EPRA 4EA7A 1GUDA 1P1IA 1SCJA 3EGXB 3KHSA 1MB9A 2B61A 4P32A 1GR1A 1HE5A 3R5KA 1VJDA 3HU1A 3E2MA 2JIPA 3I8OA 3BJIC 4LX0A 3VYSB 2XH8A 4GL2A 1A5BB 2GASA 2FYTA 3V34A 2GN8A 4EW2A 1ESMA 2QTTA 2WI8A 3MS7A 4EVQA 3Q7PA 1A2OA 4OK6A 3OCXA 4B44A 3W79A 5LXTB 3HKCA 4Q4AA 5IAOA 2YJ5A 4OH1A 2C0PA 4NJOA 4CGYA 3QWFA 3AR9A 2B1JA 3NHUA 2GS9A 2G7ZA 1IN5A 4D7AA 4LYFA 3OOSA 3OY7A 4IKPA 3U9SA 4AKHA 1DEXA 2P4QA 1ZIYA 1H0HA 2VYVA 4C4TA 3FHOA 1E9VA 4OQZA 2VTKA 4QEKA 3WSVA 3RADC 3DUFA 3JSXA 2A59A 5B7NA 4AWBA 5GZ3A 3PE4A 1ACLA 3TO5A 3OUUA 3QSGA 2O52A 4BRUA 2C3YA 3RRBA 1THGA 1P31A 3ETHA 3BILA 3NEYA 3UJHA 1NRIA 1UCFA 4HX9A 1GZ7A 1D2MA 4HFRA 4PHFA 5EAIA 421PA 3RS7A 1U90A 1ZISA 3R23A 1Q7GA 4BVGA 1XZJA 1JTVA 3HL0A 4KDCA 3GD5A 4L76A 3RASA 3CZQA 4BUCA 7REQA 3L07A 4C2UA 3H2KA 4JSRA 3VU0A 1PEDA 4GLOA 1MOZA 4LPKA 1WW2A 3RH0A 1BWRA 3QEJA 5JQGA 2X22A 4BKMA 5AW8A 4JENA 2X9QA 4DY6A 3H5TA 1NAHA 1QGUB 2O9JA 3CG4A 2UUAB 4XFDA 3MBKA 1L5HB 2JL1A 2M6SA 3CF6R 1B7GO 4TYMA 5EJAA 3ZWDA 3LF1A 3G6WA 4QUIA 4XW2A 2F2TA 3GJQA 2QQ5A 4KQCA 1X0XA 2P5SA 3AB7A 4IICA 4OG2A 5K3CA 3R3XA 5FQOA 2OLJA 1H4VB 3E05A 4YECA 3BB4A 3SC4A 4TTJA 1Y1RA 1T8UA 4KCGA 1WP4A 3E22B 4F4CA 3MWJA 3WWZA 5JSUA 3SK0A 2PSSA 2XNSA 2G1UA 1N2JA 3G49A 3MWLA 5FPTA 1QUFA 4UU1A 4CLEA 1I80A 1A50B 3FDZA 1IUOA 1VMDA 3GEPA 1N32B 1R4ZA 3NDJA 2P78A 1Z45A 3CINA 4TX1A 1XCMA 5H59A 4TRMA 3A1NA 2TECE 1XHFA 3LQYA 4LF7B 5D00A 1XQYA 3H3JA 3HY4A 1JLRA 1XVVA 1M76A 1U0SY 3ZWCA 4BX3A 5BWNA 3AG6A 2I6SA 7MDHA 3VU1A 2RCYA 2NO5A 2QP9X 2R4UA 5GONF 1HNZB 4WOCA 4A0SA 2OWEA 4HSGA 2XUGA 3VPGA 5LU9A 2VAPA 1D7OA 4HAXA 1XT6A 4UNIA 1QX4A 2G5CA 4AG3A 3GOQA 1QFZA 4R69A 2ZJ0A 3N8NA 3DHVA 4M9SA 1AKQA 4Q6WA 4XQ9A 5LYYA 4MVJA 4JR1A 1ZOIA 1VJCA 3CS3A 2V6BA 4DM3A 1NSTA 5BUSA 1WOYA 1ODTC 4B6JA 1QH8B 4RVUA 3GJYA 2ZU6A 4PGGA 3HCCA 2IVFA 1XDDA 2OP0A 4CEHA 2N0SA 3PL1A 1BH6A 1SC9A 4LRUA 1LBQA 1HE3A 1X3LA 1UZMA 3H8VA 2G36A 4ZGWA 4BMPB 1MXFA 4GVPA 4QX6A 3AR3A 2VH2A 4S1VA 1G0OA 2LNDA 4JT8A 2QN3A 2ZG6A 2O19A 3O75A 2ZCUA 5DOVA 2C5AA 1JKXA 2QVYX 3NUGA 4YMTA 4H0NA 2ZM5A 3IALA 5L45A 1J2EA 3O94A 4MWEA 1PS8A 2H5EA 3H2IA 4WLFA 3AUKA 3RJMA 1JPVA 1KY5A 1WZCA 2YNMC 3D59A 2Q4DA 1OFTA 4MAAA 2VHUA 3W2FA 2AWNA 1KK3A 2FU5C 3QFHA 4LHWA 3TTWA 3I5MA 5GOZA 1M2NA 1X8KA 2Y0CA 1U7WA 1TZCA 4MQMA 5H83A 3BXZA 1I4TD 4A6PA 1WG8A 2A5LA 4OB6A 2OZEA 4BV8A 2QF7A 1T43A 3G88A 1I4DD 4EENA 3V80A 3AIKA 2NIPA 3DTYA 3OX3A 4L73A 4CT0A 5HFJA 3HJGA 3LKVA 4D4JA 1F48A 2BZSA 5JXWA 4YR9A 5ALOA 2ZB4A 2CLSA 2NU9A 2DFLA 3E22A 4UUPA 1FP7A 2FW1A 2Q8PA 4NCXA 4YPVA 4UPDA 3HKBB 1L4GA 5K3EA 5BN3A 1ZJYA 2IXTA 3BD8A 2O1SA 4HLDA 5A1JA 1AIPA 3NJRA 1MB3A 1OAKA 1R4NA 1UM8A 1V8PA 1N8SA 2J3KA 3VDXA 5B58C 3S1SA 4ML3A 1P9WA 3I0ZA 5B2FA 1GNQA 2CXUA 4JJ8A 4HDNA 5J58A 1T9DA 2DWUA 4PWYA 4A2PA 1WBDA 1E2EA 2NU6B 4BJ1A 4BKQA 4D3DA 4YH1A 1ZW1A 1BYIA 4TLMB 1KBQA 3RTGA 5DF1A 1NDUA 5JRZA 2HF2A 1CZOA 1SXQA 3IELA 1WZ2A 4MIKA 4C88A 1Q57A 2C5FA 2DWPA 3PGVA 4TGLA 1E92A 1E4OA 3TAHA 4RJJA 3KTDA 5FOWA 3AERA 5G3ZA 1TM3E 3ID6C 4UBMA 2BMWA 1MJNA 1G4UR 4AYTA 4H60A 4YROA 4TLLB 3CVXA 2R44A 2WTBA 3SC2A 3OFVA 1V37A 2J3MA 3GD7A 2P9EA 1PFGA 4I4CA 2RH4A 4KWCA 3WNDA 3DDHA 2B30A 2Z6VA 3PJDA 1U9ZA 4E21A 4O2BF 2ADFA 4BP9A 4UTPA 5IJ0B 5JSFA 3DAHA 2YHSA 5LSAA 1X1AA 4FHCA 3SNKA 3T06B 2JI6A 4RY2A 1WD7A 1XMPA 4QOHA 3UKDA 3DMHA 2FHPA 3P4XA 1SWWA 2WQZA 3I01M 1JIXA 2ZIUB 5ERGB 1TCUA 1X7GA 5TX7A 2CHEA 3HNPA 1HFWA 1RABA 1CR0A 3UJBA 5AJYA 3VYTB 4N6GA 3DDOA 4QU8A 4DLYA 4DUGA 4F6RA 3FSGA 3QE9Y 5DI3A 1N5RA 3D54D 4DILA 1GYPA 2X8WA 3JAWA 4IEFB 2J30A 4IUCS 4ZARA 4BFXA 3ENZA 1E1CB 1MB4A 4B7ZA 5ER9A 2BF4A 4PZUA 1X7DA 1K88A 2VTVA 1O54A 5KEIA 4CQLB 2FUKA 1Z6XA 3UWOA 2OHFA 1BRMA 4MMXB 4PC7A 3RJ5A 5L9AA 1TYBE 4LTDA 2YV3A 1WV0A 4WA7A 3RVDA 1CY6A 4HBZA 3M1LA 1ESEA 1FUKA 3UAYA 2ZTSA 3AVVA 5DYNA 3DOFA 3ZH9B 2F17A 4TRNA 4UXJA 4UJ5A 3EIXA 1DP4A 1OFIA 1WMAA 5JD4A 4DDHA 5CDGA 4WZ6A 1L7AA 3EXG1 1T9BA 2DMRA 3SCZA 5EIBC 4WA8A 1JKJB 3GLIB 4XVCA 5L51A 1RLIA 1OE0A 1YE3A 2ZUTA 3WBFA 1XVAA 5C8ZA 5THXA 2R8YA 3QWHA 1C7QA 1K98A 3VZSA 3HDQA 3SC6A 4LF6B 4HLUA 4NP6A 4AN4A 3LPCA 4P82A 3OBBA 1IEXA 2AVDA 2Q2WA 3C7DB 4DQLA 1E2PA 4X66B 3BL6A 3UKJA 4J16A 4F11A 4ZOAA 4O33A 2AXQA 5KMGB 1SVNA 3HYRA 4XOUA 4B3BA 4CKZA 2FUEA 3H99A 3V7YA 3EZXA 1YRLA 4P98A 2QTVB 1N0VC 2OFPA 1SC4A 3ETLA 3IHKA 3L6CA 3AVOA 4WMLA 3ZCTA 3ZBUA 1B8UA 5FNVA 2I3AA 2P9HA 1KFCB 2PX8A 4UUNA 1OROA 2XQKA 3I6MA 4W5JA 2ECQA 3UKOA 5A5DA 2CCGA 4L4UA 2H1OA 3GJXC 1K89A 1BQEA 4JQYA 5JARA 1YA8A 2L18A 4HPJB 4LE0A 3LJKA 4F45A 3L0SA 2QNIA 4R5HA 2FQYA 2PQ6A 5JATA 3EC1A 3LHFA 4U6NA 4RX1A 1OR8A 2QMEA 2REXB 3ESXA 3IP9A 4H0FA 1EU1A 3FYCA 1CB0A 3SEQA