1W1B1

Structure of bacillus subtilis pdaa with cadmium, a family 4 carbohydrate esterase.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
235
structure length
235
Chain Sequence
VPNEPINWGFKRSVNHQPPDAGKQLNSLIEKYDAFYLGNTKEKTIYLTFDNGYENGYTPKVLDVLKKHRVTGTFFVTGHFVKDQPQLIKRMSDEGHIIGNHSFHHPDLTTKTADQIQDELDSVNEEVYKITGKQDNLYLRPPRGVFSEYVLKETKRLGYQTVFWSVAFVDWKINNQKGKKYAYDHMIKQAHPGAIYLLHTVSRDNAEALDDAITDLKKQGYTFKSIDDLMFEKEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE POLYSACCHARIDE DEACETYLASE PDAA
publication title Structures of Bacillus subtilis PdaA, a family 4 carbohydrate esterase, and a complex with N-acetyl-glucosamine.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 90
structure length 235
sequence length 235
chains with identical sequence 2
ec nomenclature
pdb deposition date 2004-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF01522 Polysacc_deac_1 Polysaccharide deacetylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.370 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycoside hydrolase/deacetylase 1w1b100
2NLYA 4HD5A 4WCJA 4NYUA 4M1BA 1V6TA 4NZ1A 2I5IA 4NY2A 3WX7A 1W1B1 2DFAA 2Y8UA 4NYYA 2C79A 4NZ4A 5BU6A 3VUSA 2C1GA 2J13A 1W1A1 4F9DA 2QV5A 1W17A 1Z7AA 3CL7A 4V33A 2C71A 3CL8A 4U10A 3HFTA 3QBUA 4OUIA 4NZ5A 2E67A 4NZ3A 5JMUA 2W3ZA 3RXZA 2IW0A 3S6OA 2VYOA 1XW8A 3CL6A 4L1GA 4LY4A 4F9JA 2XU2A 1NY1A 2C1IA 2CC0A
chains in the Genus database with same CATH superfamily
3KBNA 3STCA 3BXWA 4JX5A 3ABOA 1EKOA 3MUIA 4YTRA 4PTDA 1LQ0A 4JQ4A 1V0LA 1KR0A 3HGOA 4LNYA 2GQ9A 1PUDA 1RPKA 4K39A 7A3HA 2QJGA 3H2OA 5LXEA 3H7UA 4DVOA 3JU2A 4PFMA 2LLEA 4XKYB 2DSZA 5CC3A 3V7PA 4UTKA 1W0MA 2V3FA 2YCLA 1TV8A 4BQ3A 4QJ4B 1MFUA 3UZZA 2E0PA 2FZ8A 1JZ4A 3BLIA 1JNEA 5A6TC 4KRUA 1UD3A 1NVMA 2ZX5A 3PWAA 3R11A 1LBLA 2XVPA 5CGMA 3DG7A 2NZLA 3R8HA 5DBTA 4U3CA 5AYBA 3IPWA 5DF0A 3TEVA 3R5EA 3DFOA 3GUGA 3LENA 3DFTA 2OWCA 2DSVA 2QJIA 4KCVA 3NTYA 4LYPA 3GQYA 3L68A 4WOQA 3IGHX 1CENA 3EB3A 3RHGA 5LIXX 2Y2WA 1UZ4A 3OA5A 1TREA 1R9YA 4DWDA 2GQ8A 3H23A 3G77A 3LTPA 4AFYA 3SSZA 2CLHA 3LPGA 1Q6FA 2W9MA 2IQTA 3RNDA 3PBMA 2Z0IA 4AD5A 2YL9A 4M8UA 4H8NA 2VEKA 1XLHA 2A6NA 1GTHA 2J7CA 1C3FA 2PDGA 1RQEA 4AD3A 3DYPA 4YVVA 1XQKA 4BI6A 3AMLA 3BJSA 1FWDC 1W91A 3T0TA 3B0UX 2OOGA 2ESCA 4PA8A 1B3WA 2E09A 3WQ6A 3GHRA 3S0CA 1MDLA 2B4GA 2WVUA 4NYYA 5DX7A 4FF7A 5PTDA 1TQJA 2V82A 3LOTA 4R53A 2WCAA 1MNZA 1OM0A 2QMJA 4ZOAA 2YB4A 3B8UA 5HPOA 5AN7A 4GABA 5CEWA 3UFYA 4FR6A 4CUCA 5AZ1A 1B1YA 1TV7A 3T4WA 3WLPA 1XLEA 1EO5A 2ZA1A 1I4NA 1PJ9A 4XG1A 2H6RA 1T0OA 4KWSA 2CBIA 1P48A 3VKKA 3ITVA 2QCEA 3H2EA 3BSGA 1U1JA 1S3TC 1RBOB 3IRDA 2JKAA 5HQMA 2IUZA 3N6HA 4NXSA 1F3XA 2WAGA 5E6YA 1OC7A 3E38A 3VX1A 1GVYA 1Y5VA 4XD3A 1E43A 4RXFA 3L4UA 3G1FA 2Q3RA 3WK0A 2Y85A 4PMXA 3GUWA 2VD9A 1UA3A 3QN3A 1DORA 4OFCA 3B4UA 4HCDA 2D0HA 1UP0A 4JTRA 1BGAA 3LHZA 4LC6A 2GDUA 3MA8A 5FESA 3E1F1 2WC7A 4KQNA 3W25A 3A3HA 1YADA 3B9AA 4LY4A 2IXUA 4GQRA 4UTTA 1KXTA 2OSYA 1TV5A 1QW9A 5M1TA 2QV4A 3LHYA 1XC4A 4DXVA 5G1YA 4RPQA 4TXEA 4OKDA 2DJLA 2HE8A 4LGXA 1FWFC 1B3OA 3MUCA 3C56A 1B0IA 2WC3A 4JYEA 2W62A 3LV5A 1T96A 2O56A 3BLFA 1UD4A 3EWZA 1M9HA 1DXIA 2CBUA 4NIRA 1HT6A 4RX0A 1V79A 5AYIA 3FSUA 1IF2A 3SEPA 1A0EA 4HPNA 1OGSA 2DSUA 7XIMA 4GYKA 3JZUA 3UVIA 2L5HA 1TJ2A 3O8AA 1C8XA 1MW2A 4AF0B 4AC1X 3Q94A 1IGSA 1KLZA 4V28A 4EANA 3ZWSA 1KKRA 1QI2A 1UUMA 1I6NA 3L4YA 4KGLA 5DLCA 3KTXA 3CYJA 3OO2A 1H2JA 2ZA2A 4L1GA 1D9EA 1QO5A 3VIKA 1LOLA 1TVPA 3PJTA 3SUVA 1EWEA 1ZL1A 3AWOA 1S3HA 1U2YA 2WHKA 4Z0JA 4AC7C 2O9OA 3WMSA 1HJVA 3HV8A 5JIPA 4KCWA 1I2NA 1KCZA 1RH9A 4MTVA 5LA1A 2CLOA 2JEQA 2WJDA 5F1VA 3WF1A 5IRPA 3EPOA 1XYFA 3NZQA 4PMJA 4MJ4A 4H9UA 1PDZA 4YCPA 4NJIA 4ZEPA 3ZLGA 2ZRXA 2H8XA 3DYOA 2J66A 2WM1A 4J27A 3PY2A 4RPPA 5G2WA 1AA1B 3QPEA 4MWAA 3ARSA 4MY9A 1QDSA 1VAHA 1K9DA 3RF9A 1LJYA 1XPGA 2W67A 1ELSA 2HK0A 2J13A 3K4WA 5KMYA 4BJHA 1KCLA 1XLCA 4M6QA 1VFLA 2ZXBA 2NUXA 1IWBA 2WK2A 4JYFA 3SB0A 4IQEA 3ANYA 2TMDA 4ZFCA 5A2BA 1QBAA 3EWXA 4C1KA 4NAFB 1WPCA 5HJLA 4O53A 4PRTA 1KFJA 1QI4A 4GY1A 3CGTA 4WIWA 4WOZA 1YXDA 1RJRA 3O9NA 3DFYA 3E5PA 4DBEA 2PDPA 3M5YA 4WKFA 4AUBA 4Q32A 1JCXA 5FEZA 1DJQA 5EBUA 3EOOA 4PEKA 3SCRA 2VFGA 4CNUA 3VNJA 3GC5A 4XBSA 2VI0A 1E70M 4B9ZA 5K9XA 3TYDA 4U5IA 5DCEA 5RUBA 3E2VA 1NFPA 5TIMA 3W88A 3O6AA 3DN5A 4Z0SA 1DXEA 4LCSA 4F0RA 2NQ9A 4MNKA 4OE7A 3G6LA 2XM2A 1UH4A 2X1SA 3H4GA 4AYGA 1TMLA 3AIUA 3SGUA 4C65A 4PYSA 4DAIA 1H1NA 3ZVHB 2DVUA 2WKGA 1DYSA 1TWWA 4PODA 3LGGA 4KEZA 4LUSB 1VBUA 1H7PA 4A22A 1I2QA 1D2KA 1PIFA 1U1HA 3BANA 4X2RA 1ZBWA 1V3HA 3AS2A 4H2CA 5LHFA 3L65A 1XLFA 3NZPA 7TAAA 4RZ5A 3NJ3A 4LVFA 5I09A 2ZZ1A 1G6CA 2I5QA 2FGBA 2QYGA 4UTIA 3AU2A 4Z2LA 2BG5A 1Z69A 2ZADA 4NZ1A 4DM1A 4H9XA 2QCLA 1X6LA 4FX6M 3WJXA 3W7QA 1GG1A 3BAWA 2WZMA 1N8WA 3W23A 1E4IA 1R47A 4JQ3A 1WZMA 1M04A 4E6MA 3HG2A 3GC2A 4U33A 1TA3B 3BG3A 4ZGYA 2WBGA 4ZB2A 2QUMA 3UEQA 3LHUA 3CM4A 2E4TA 3CV1A 3ARRA 4XZIA 3N4FA 4E4UA 1PYFA 1BF6A 3RK8A 3H26A 1NARA 2Z2UA 4QX4A 9CGTA 4ERIA 1H60A 3PVFA 1UWSA 4LUTA 3C3NA 4I9AA 4L4OA 3LA4A 4Q7NA 1ZFJA 4EKJA 3BARA 3L4WA 3EOUA 4PE8A 4KEVA 1X39A 3GDRA 4A05A 3WLOA 1DKWA 4A3UA 1JCLA 2V81A 4KF1A 3AXMA 3AIBA 2YKKA 1ISVA 3QOMA 5T8GA 2P3EA 3LBOA 4JS3A 1AVAA 2WM0A 1FXPA 2G3IA 4XO7A 3II1A 3L12A 3UCDA 1I2PA 4QS5A 3SSJA 2BV9A 3NL3A 3OGSA 4KRZA 3KLLA 3OVRA 1LWHA 3HMJG 1WE5A 1XWYA 3CQJA 4UTFA 4H00A 3WF0A 4L1XA 4O10A 3EXRA 1QATA 1XS2A 4LS1A 2X30A 4KPLA 1VR6A 5E09A 3HOJA 3VIHA 2FQIA 2VQTA 4QCEA 5CSUA 4R85A 4ICMA 3GDLA 2G3JA 2V5JA 2XZ7A 2GVJA 4E8CA 1F6PA 4GC3A 4FXSA 4ORMA 4IX2A 2BLEA 3BPWA 1RCXB 1UKOA 5D4YA 4D6HA 2OYKA 1LTDA 2YJQA 3GVGA 3AYSA 3OA3A 1C8QA 3M0JA 3RR1A 3OLEA 1QBBA 4HA1A 1OX6A 1JXJA 3QFEA 3B0YA 2VR4A 2OOFA 1FWSA 3OJGA 1D8CA 4ICCX 1PTGA 1GGOA 1L2UA 1EBHA 4QITA 1HJQA 4LEQA 4JN7A 5IXEA 1FWNA 4IISA 3BZJA 3W7JA 3AMKA 1G4EA 3IIXA 4HMDA 3T2QA 1OEPA 4YMZA 1GHSA 1PX4A 2XUCA 4FLQA 4J3WA 4CNPA 1GW9A 3ERPA 1A5SA 1PHWA 3M0YA 1V03A 1EPVA 1MMFA 1ZB5A 4W87A 3T2OA 1PL9A 4GFSA 3NQAA 1FQ0A 2G3MA 3NQ6A 3CUXA 2A1YA 1S2UA 4PUUA 3AJ7A 1NWSA 2I9UA 2IXVA 2QCNA 1A5MC 3KOXA 4L7ZA 3UJ2A 4AZCA 3T42A 3O6DA 4JX6A 4DI9A 4P8XA 2QS8A 3IJQA 3W81A 4H01A 1OC6A 2MNRA 2O9TA 4BQ4A 5AC5A 1EO7A 1F76A 2OZ0A 4UFJA 4H9MA 3NSNA 1H5YA 4BF9A 4HU3A 1V0NA 1CXKA 4GVFA 3F1QA 3GS6A 5E93A 4AD1A 3CQIA 4C6QA 3H70A 3C2RA 3KHJA 5AC4A 1I9CB 3VC6A 3UP8A 4LYKA 3QLLA 4JY9A 3W82A 1ICSA 2X41A 2J7DA 1A4LA 3E0LA 3VD5A 3V0SA 2AKZA 2O9PA 3TX9A 4AY1A 4Q8VA 4RV8A 3P74A 4IF2A 1WYIA 4CQCA 1LQAA 2ZZ5A 3BLKA 5FSDC 3PFMA 3H21A 3ONCA 4IH3A 4BQ5A 1PIIA 1WO2A 1KQZA 1IZKA 1ECEA 3CS2A 2ZE0A 1FP8A 1MZRA 4OECA 2GZXA 3S5NA 3QR0A 1TTIA 3L66A 1LT7A 3W87A 1UWIA 2F9RA 2DZWA 5E0KA 3P67A 4TMBA 1OX4B 2XVNA 3USZA 4HA4A 1QPOA 1XKYA 3OZOA 3ID7A 1W6TA 4J1OA 2XG9A 2BDQA 2GSHA 1YNYA 3EXTA 1F4AA 3RO8A 5F4WA 4ZTXA 4HU8A 4BZYA 5CPOA 4NF7A 4DHGA 5A3HA 1PYMA 2NXHA 3H24A 1T40A 4G6CA 5A6BD 3KOWA 2ACUA 3E2SA 3G3MA 2REQB 1SM9A 2ZZ6A 5F2LA 1JCYA 1V77A 4IMDA 4NI3A 3WLNA 3NL2A 4NASA 2HXUA 4QG8A 3GYCA 4GC4A 2ZZ7A 2BY2A 4W93A 1E0VA 2NQ5A 1M7XA 2I57A 3ARZA 3TN6A 3AZRA 4JTIA 1XSIA 1EYWA 4E3TA 4JOMA 3TA9A 4ECLA 1QCWA 3U6WA 1B3XA 3LGDA 4E8GA 1AD1A 3GVWA 4LQ1A 4XUGA 5BMXA 5HK4A 1H62A 1DOSA 2H8ZA 3TYAA 2QF7A 3ITXA 1AODA 2PSNA 1VFOA 1CXEA 1GOWA 3OHMB 1G4PA 5J5DA 3S4TA 3TTEA 3OLIA 1VCVA 8TIMA 1ONRA 3AFBA 4LYRA 4AD4A 4DJED 3QMSA 1D3HA 5JBFA 4RJEA 2C1IA 3DCPA 4D6JA 4LPCA 1UQYA 2BOEX 1DJIA 3GKFA 1XLAA 4HP5A 3I3EA 2VWTA 5T9CE 1JPKA 1XPYA 4CN1A 2WVSA 1YMYA 1ODUA 3BW4A 5FEWA 1FTXA 1VB9A 3MJMA 5U4NA 1UC4A 4NJHA 1GVRA 5CPQA 3UYCA 1FX6A 1I1XA 4URIA 4WY0B 3GG8A 2WQPA 3AIQA 1YDOA 4XKMA 4O0QA 2UWFA 1GKPA 1CW2A 1QNOA 1VC4A 3W0KA 3QJAA 4EP8C 1F7BA 2RHGA 1F3WA 2BHYA 2CETA 2V5LA 4NSBA 4DJDA 7REQB 2PAJA 4ZXLA 3ITOA 1QNSA 3PR2A 1H51A 4JNZA 1BYCA 2FGLA 4E2BA 3UXLA 3DBPA 2HS6A 2UY4A 4J35A 3MV11 4HSHA 1HJUA 2X7VA 4V33A 1VLIA 2VXNA 4MJZA 4QFUA 1U5HA 1YBQA 1PV8A 1JZ8A 1HTIA 3EX4A 3T4CA 4HOWA 1HJWA 2IKHA 3KOZA 1DWAM 4RKAA 1AL7A 2GLKA 2PDHA 4E4PA 3CB8A 3VNKA 4DF1A 1E6QM 4GZIA 4JFVA 2P0OA 4JY8A 4QAWA 4RE2A 2BOFX 3WLSA 3WUGA 1W2PA 5T26A 5DMYA 4JKMA 1GOKA 1F73A 4UTMA 4GQ0A 1G9HA 7TIMA 4S3JA 4UTJA 3GTIA 1K8YA 3DU0A 4P7LA 5I6SA 3MMDA 1FOBA 3EYPA 3DEQA 2WWDA 3NQMA 3ZOAA 4E38A 4LB3A 4EWND 3SADA 5REQB 4L6HA 1VKFA 1XRSA 2J8TA 5HAOA 2J88A 4YIWA 3L0GA 3WQ8A 4IGMA 1G67A 3AU6A 2WLYA 4PC8A 1A0CA 1VLWA 4JKKA 1PXGA 1POJA 1EX1A 1EC7A 4E4FA 4W8AA 4S3BA 3VOIA 4HPGA 4Q4QA 3W2NA 1E6SM 5KZMA 1VHNA 1E5JA 4RNHA 4N0RA 1BEUA 1CGVA 3IACA 4LW7A 4XZLX 2PUZA 1DHPA 1OIMA 3N6JA 4O13A 3L0KA 4DBUA 2H3DA 2FB2A 3RGTA 4HMNA 4MYAA 1V6WA 3PZNA 2YDRA 4O0ZA 4AX6A 3EDKA 1TX0A 3CIVA 3IV8A 1GQKA 4I7UA 3VZYA 1S2TA 1P1XA 3SCVA 4B16A 2YLAA 5A1AA 1SSDA 2PWEA 2J25A 1KFCA 3WQWA 2B7PA 5DCDA 3DGBA 5C2GA 1OYCA 3ZLFA 1VJSA 2AMXA 4PBFA 1CB2A 5E9XA 3F4VA 3KS5A 3CO4A 3WIJA 3FK4A 4YYFA 4MZ8A 3CQ0A 1SO3A 4JFSA 5IBXC 1QI5A 2DY3A 3W2LA 4Z08A 4DEFA 3QH2A 2VUYA 3WK3A 4WUIA 3CJPA 3DECA 3T1GA 3DC0A 3QEZA 4AW7A 4G5DA 3HQNA 3A13A 1M1BA 2CERA 3CAQA 3BQ6A 2XIMA 3V5OA 3AXIA 5AHLA 5DY3A 2ZUTA 5BROA 1ZQ5A 1VHCA 3VM7A 5B7ZA 2DZBA 1PCWA 5C71A 4S3AA 3B9NA 3AQUA 3NYZA 4YTSA 1KTCA 2GGHA 1KM5A 3T0DA 4R5EA 1B4EA 4JD4A 3ZJ6A 4O1DA 3U4FA 2XTKA 1FDZA 3KVLA 4FB7A 3NQGA 1RA5A 1NOWA 4PTMA 5K2ZA 3G0XA 2C15A 6PTDA 4HPHA 3LK6A 4DJEC 5C9RA 5EKYA 4LFYA 4IZGA 2HSAA 3W7RA 2PS2A 1U30A 5FSEC 1TFVA 1VFTA 1DWJM 1LLOA 4JXCA 1K6WA 1O4UA 2RDUA 1YNQA 1FVPA 3C8FA 4R7WA 4FA3A 3I7SA 3CIXA 1J2WA 3TTYA 3W75A 4A2RA 2PI6A 1R30A 3U4AA 1Z48A 1R7OA 2YCKX 1ADSA 3P2VA 2BNJA 2OFJA 2AKMA 3K46A 4X3ZA 1T8QA 5CBIA 2XIOA 1QPRA 5ECVA 5LKYA 4J7RA 3WFLA 3GR7A 1F6YA 4HVXA 3W02A 5BCAA 4JHOA 5DMNA 3P0WA 1WZLA 4Q8NA 3N2OA 2PWGA 1YW1A 3EMCA 3FVMA 1XIEA 3A9BA 3WLIA 3UWQA 2XPKA 1EQPA 1QNRA 5K3VA 1O7AA 1C9WA 2Q6ZA 1KBKA 1G7VA 3SCPA 1RXOB 3E0IA 4MZ1A 5AOUA 3EXSA 3VIJA 3E9AA 1S5TA 5C70A 2EHHA 2GQAA 4PUDA 3PF3A 5A2CA 1V02E 4PB3A 5HWMA 2JKEA 4DX3A 1EIXA 4DQWA 1NOUA 3GTXA 4M7SA 1RP9A 2UBPC 4BEUA 3TJLA 2V5CA 2W6RA 2FIQA 3PJUA 1UWTA 1SR0A 4NY2A 2DVTA 2R1PA 2ZDSA 1HZYA 1S5VA 3IIPA 1AQMA 3VC5A 2GUUA 2GJXB 3OVGA 3A4XA 4MB1A 5DXXA 2PGWA 1EUAA 1R3TA 5M03A 4P2VA 4WDWA 5ABFA 3LMYA 2CKRA 2GK1A 1XGDA 2CZEA 4PFHA 3CHDA 3MWAA 4LCRA 2RFGA 4Q4RA 4G7FA 1ENUA 4LH8A 4PL2A 2OELA 4LS2A 3VFLA 3W28A 3TZFA 4MGGA 2POTA 3LPPA 3R2GA 4B15A 4Y6GA 3O05A 3POCA 1XL9A 5LGXA 3ZM8A 3T40A 1E4LA 3MP3A 3DIPA 4MM1A 3C2FA 4JTLA 4HMCA 1KRAC 4HSNA 2PCQA 5CC7A 3EX2A 3N4AA 3AC0A 2IKGA 3SECA 1ZCCA 3WY1A 3CTTA 4H1ZA 1QWGA 3KS6A 3OHIA 3W76A 2PPGA 3AXHA 2CHOA 3K8MA 1AJZA 2GWGA 4H9YA 2WSRA 4MY1A 3ELFA 4HK7A 4ACZA 2BVWA 3IIVA 4YN5A 5CJNA 4A29A 2Q02A 1MW1A 1QRQA 5A94A 1A49A 1W9XA 3K4AA 2WMKA 1XIGA 2C91A 4CN6A 2HDJA 2KZHA 2OCZA 4J2PA 3GU1A 3AUOA 2JEPA 4YHEA 4A6GA 1DIDA 2V69A 5TNVA 3TAOA 2INEA 2W3ZA 1W8SA 1UP2A 2ISDA 3N18A 2C0AA 3VDGA 4GI6A 5IOBA 5F4SA 1RCQA 3C52A 3VNZA 1RK6A 1A3XA 2J8FA 1UR3M 1FWIC 3V1HA 4UBPC 1VBRA 1B3ZA 2ABAA 4D6GA 1JULA 1J0YA 1BTMA 1K9FA 2EG7A 4GCXA 1VBJA 1EEXA 2HROA 4NT0A 9XIMA 4JTAA 3GW0A 3LQGA 4AD0A 1W1TA 3D3AA 3UR8A 3W53A 3GR8A 1J9YA 4H2HA 4Y9NA 3CPGA 2PBGA 3ME3A 3GB6A 3V18A 2FPTA 2PTXA 3P6LA 2IW0A 4I7WA 3I6EA 3QR3A 5A6JA 3M6DA 1JFHA 2YFNA 2ZTJA 3B4YA 4BK9A 4Q7IA 3EB2A 5I78A 1UOKA 5EYWA 3B8TA 4GYPA 2CLPA 4WKAA 1WKYA 4WGHA 4DBDA 1RQBA 3QBUA 2Q71A 1CT5A 4I7VA 4HNCA 3MI2A 3ARPA 2Z26A 4BEQA 2PWVA 2J24A 2VRJA 1EH9A 1WDPA 3NO1A 1K7FA 3BG5A 4IM4A 1B3YA 3REQB 1F61A 3TTQA 1ZAJA 2DIJA 1CX9A 1PZ3A 3TQPA 3AYRA 5AVHA 4DYEA 4PRRA 1WDQA 4PTXA 3W6YA 2Y5EA 3GHTA 4BKNA 4GJJA 4YVXA 1M01A 3Q45A 3BG9A 1RBAA 4LS0A 4WCJA 1XUUA 4UQCA 4Q8MA 1JCTA 3B8WA 1UMYA 1Q65A 5A8GA 4JIRA 1CBGA 4IICA 1UPMB 3VD7A 2E5BA 5LNVA 3UVAA 3KBJA 2GVYA 4JBRA 2DSWA 2KAUC 5D8WA 3O07A 1EIBA 3WQPA 2P76A 5GNZA 4KWWA 3EAUA 3FA5A 4DXKA 2CWXA 3E96A 4K7VA 3UWUA 1SFJA 4OOZA 2FJUB 3HPAA 3MY9A 5JBDA 1IXOA 2PFHA 1UMLA 5KZ6A 4XSLA 4Z42C 3KWSA 1JD9A 2C1HA 1TIWA 4GJ1A 3VDBA 5DT5A 5GNXA 4PH6A 1W1A1 2AOSA 1SFLA 2WANA 4LCQA 3CMJA 3LN3A 3VE9A 3G1SA 4UOZA 4D6DA 1KGUA 5TAOA 1KBIA 2QW5A 1F9CA 1SJCA 3GVQA 4PBEA 2VL4A 2QF8A 3T05A 1W3JA 2BSLA 3GIYA 3H4XA 5E0CA 2GVGA 1SW0A 3B04A 1YKWA 2OGYA 4L9ZA 3GTNA 4HN8A 2RDWA 3B40A 1NFGA 3AOFA 1QT1A 3PPHA 2WCSA 2YL8A 3MQTA 4CD4A 2Y89A 1T6MA 1A5BA 1TWZA 3P61A 4S23A 3VYLA 5D33A 1MFVA 1FH9A 2R82A 4AWEA 1F3TA 3Q65A 1YQ2A 1R3SA 4UCGA 5G1MA 2V9DA 4QNEA 1TR1A 1IZCA 1W31A 3BGAA 3OZMA 2NQHA 4GO8A 3LU2A 5BXPA 3K1GA 3CUJA 3U5YA 1T5AA 3RMJA 4ADUA 1DBTA 2B81A 3RU8X 4B5VA 4Z1BA 1E3XA 4CD7A 4Z2KA 4HTBA 4NAEA 4PMZA 5DELA 4HB7A 2VURA 4XZMX 1NU5A 2VC6A 2BY1A 4S2BA 1TTPA 1XDMA 1X38A 3WX7A 5FEPA 1QI3A 4D6CA 4WJ8A 3RX3A 3C0JA 4O1AA 3G8RA 4W88A 2HMCA 1MNSA 3CQKA 3IUDA 3N3MA 1E1CB 4YJ5A 4US6A 5DANA 1W56A 2DQWA 2Y61A 1E4MM 3FXGA 3UR2A 1RALA 3QMRA 3FYYA 2PODA 3FEMA 2QPUA 1XLKA 2H9AB 1ZJIA 2ZTKA 4P8UA 4HCLA 2PWHA 4DM2A 4FLRA 1KO0A 1P7TA 4ACYA 4PMUA 3TNBA 3HGRA 1BVWA 3PC0A 5A6KA 5IFPA 4OBTA 5D05A 4TX8A 3WENA 2Z27A 3W9ZA 1W2VA 3IEBA 4ZQPA 2E6FA 4PMVA 1V8EA 3LZ3A 4NUWA 5H8PA 4JIPA 2J27A 1OK6A 3WYZA 2CZ5A 2I5IA 2E1WA 1TRIA 1OFAA 4GJIA 4LVDA 1ZLPA 3EWCA 2MUCA 2DUXA 4TV6A 2CLLA 2EGZA 4PUEA 3GZ3A 3GFYA 2ZUNA 3MANA 4GYFA 3LQLA 1AUSL 4HOZA 1LL6A 1Q7QA 1UKQA 9RUBA 2XFYA 3F4WA 2P53A 3ITGA 1MXGA 4O12A 4BFAA 3W27A 4D6IA 1Q2SA 2X1RA 3MZ2A 5TF0A 1SR9A 1SVDA 4GZ7A 4IMCA 1OIFA 4K36A 1O1ZA 5M17A 4PCPA 4HZ8A 2OVLA 3PN8A 3MI3A 3FVDA 3SRHA 1K6AA 1Q8AA 1V3LA 1XSJA 2VFFA 1UASA 2BZNA 3AUJA 3W7EA 5EL1A 5IDIA 4A8IA 3F2CA 3TC3A 1F05A 2FTPA 3VOGA 1S1RA 3TN5A 6ALDA 4NG3A 2F6XA 2DZTA 1TX2A 5LHEA 3VKJA 4DN1A 1NP0A 1ZGDA 1G1YA 3C3UA 1EBGA 3WQOA 4EXBA 3H2FA 1MEIA 4XZHA 2OXNA 1IYXA 2FZ9A 1K02A 3ZVIA 1VIWA 1TV3A 3HU7A 3S5ZA 3R25A 4J3SA 4GXPA 3A22A 1ZRQA 1BKSA 5HWNA 2GYIA 3A4JA 1R3WA 2VDGA 1A5CA 5HQEA 1NY1A 3AMDA 4KFOA 2YBTA 3NO5A 2PMQA 2O9RA 3SY5A 5CPSA 1KM2A 3AIEA 2IPJA 4FLSA 4KWUA 1HKWA 3CLWA 4US5D 4ZMGA 1VPQA 5AC6A 2FJKA 5FJOA 1UD8A 3W7PA 1MWOA 1LBFA 2VQUA 4C6PA 3EX3A 4AF0A 1RVGA 1KM3A 3L4XA 1XF0A 2BWGA 1EP1A 1WKEA 1IR2A 2O4MA 4LVAA 1PS9A 4LV4A 3SM0A 1Q63A 3WD3A 4KESA 1LORA 2E5DA 3VIMA 4Q8UA 6XIAA 4LXFA 1R46A 3VNIA 1W3KA 1BQGA 2E3ZA 4QAIA 1DWFM 4NP7A 1NP2A 1T7LA 4M6VA 4DUXA 3G1DA 2ZUWA 1EGMA 3M16A 4YCOA 4IXXA 2YFOA 4QE5A 3NNTA 1V0KA 1UBSA 2RJGA 2FPYA 2VRKA 4GFIA 4V2XA 3HJEA 1KFBA 4GRSA 2HVMA 3SRFA 2C79A 1XH2A 3TUUA 2VEPA 3MS8A 2ISWA 4F0HA 2QDEA 5I07A 1E55A 1Q2RA 2A2IA 1W1YA 1UR4A 1JRBA 1JZ6A 4GH1A 1E3ZA 1F8MA 3W4RA 4UC5A 3DGRA 3GAYA 3FCPA 4IHCA 1KV8A 3T08A 3W2MA 4ADSA 5D2YA 1W32A 1A53A 2E1DA 2TODA 4FO4A 3S9IA 3CEPA 4AMCA 2XVKA 2NX9A 2VWSA 4CNNA 1ZSXA 1DEDA 1O12A 3TC6A 3EX6A 3S2NA 3FDGA 1TVLA 1S46A 3M0VA 3URQA 1PDYA 2PZ0A 3PNUA 3NEHA 3CZEA 3BJTA 1ADOA 3NQEA 3P62A 4RV3A 3SUSA 6A3HA 4EE9A 3QC0A 4I6VA 1EC9A 1MXDA 2C14A 5IDZA 2QCFA 1W9DM 2YW3A 3NG3A 1FDYA 4F48A 4TVCA 4D2JA 3LCLA 2E5CA 5D9PA 2DQXA 3DX5A 1QHPA 2QGHA 1G5AA 3KBVA 2QEZA 2J7HA 1CECA 1NSJA 4GY0A 4MDPA 4DI8A 3HPSA 4Z1DA 2WPGA 2PGFA 1WAWA 1NDZA 4I9TA 3WBEA 3P93A 3VX0A 3ZVHA 3A3WA 2QV5A 3IWPA 1WDDA 3STGA 4CQAA 1LROA 1R3RA 3CUFA 1UR0A 1SGJA 3O7UA 3WH5A 2XSXA 4Q6JA 1JF5A 3WJSA 1SZNA 4S3FA 1V6XA 4F4RA 1Z7AA 3OLDA 3PZ9A 3S9YA 2Y8KA 3UG3A 4B5SA 2AL2B 1UZDA 4NXKA 3VOFA 1DL3A 1FA2A 2YCEA 2ZWYA 4D8ZA 4IQDA 3ZXWA 5BWFA 2HS8A 2F2KA 1FCQA 4C6KA 1FWTA 3TJIA 2CLKA 2PF0A 1E71M 1JGMA 3WMLA 4HA3A 5FJPA 3MBFA 3BAYA 2ODOA 1JEZA 1OC5A 3QHNA 1Z89A 1H0IA 3WG6A 3AS0A 4QRNA 1Q45A 4MNJA 3OW1A 4EF8A 5FJIA 1JPMA 3R1ZA 2VZSA 3IV3A 4Y9PA 4GUIA 2VELA 5HR6A 1V51A 1S5NA 4B91A 1DWGM 3CUHA 5LA2A 3TJ4A 3NM1A 1CGXA 3WQVA 4FXRA 3PZMA 4A3HA 1KM1A 1H3GA 4DWSD 3TP4A 1A5AA 4XD4A 2VC7A 2WMGA 2VDIA 1YHTA 3COTA 4AEEA 1K8XA 1IEXA 2BGQA 2NSXA 1QAPA 2V68A 4GACA 4MB5A 3IAPA 5HJYA 3WD2A 3QHOA 1R3YA 1UWUA 4GBDA 3MPGA 1CB7B 1O1HA 5CCZA 3PTMA 1J5TA 4AXNA 5JU6A 3GAKA 5FEXA 4XV0A 4G2DA 1YLVA 3HGJA 5JBEA 5I02A 2WVVA 4MJ2A 4M24A 5EMMA 3DYMA 3H12A 2D2JA 4IX0A 3SR7A 1CYGA 3H54A 4U28A 2ALDA 4K1WA 2HJPA 3HIJA 4PMOA 5E0FA 1O60A 2OEMA 1PKNA 8RUCA 2CZDA 3CT7A 3ONBA 2OWWA 3NAVA 1C8VA 3ECQA 5DY2A 1WUEA 4Z2HA 1A5UA 1GVQA 2ZC1A 1JZ2A 1F07A 1J6PA 3VILA 2ZX8A 3SCQA 4DBSA 1IXNA 2YA1A 4LAKA 4QLKA 4C6FA 3DZ1A 3FAWA 3CK5A 5F4XA 3NSMA 1OYAA 3D0CA 4ATDA 3FXYA 2BTMA 1SO6A 5HNTA 1X1OA 4KGJA 3B03A 1OCQA 2TSYA 3MZNA 1IIGA 1OG0A 4C91A 3MI6A 2BMBA 4ILSA 4N6FA 2G4JA 3M9YA 4C5YA 2ASHA 2D73A 5D03A 2GGGA 4JZ5A 4FPSA 2PURA 4B4HA 2YL6A 5A95A 3DHUA 2DH2A 3JRKA 4TV5A 9XIAA 1A5LC 3CB3A 4UOQA 1I2OA 1H61A 1GTEA 1EOMA 1V4YA 3N2BA 3OG2A 3AIRA 4XAZA 1VJZA 3FOKA 1BVNP 1E0XA 2CFFA 3VNDA 5M2FX 3BGGA 3EZ4A 3E3HA 2ZX9A 4LF2A 4C6DA 4H9VA 2J8GA 1BTCA 1KGWA 3B0PA 2OT0A 4IIGA 1J0HA 2A85A 1QPKA 3SAZA 3WNLA 1QJWA 2VO5A 3W7MA 4MFEA 3APYA 3GDTA 4OGZA 3QLDA 2A3CA 1A5KC 1IHIA 3THDA 2FZBA 2ZZ3A 1DQXA 4GQBA 3UWWA 1LRNA 3WQ4A 3QV7A 1DE5A 1BFNA 3URAA 3UERA 3N9RA 1XLDA 3NVDA 1CXHA 1LWIA 3BC9A 5HANA 4Z17A 1RJPA 4M19A 1P0KA 4UB9A 3UA4A 3OB8A 1WDSA 2QMKA 4FX7A 1F3EA 3KXQA 3BO9A 5K9DA 1TZ7A 1QNVA 3STEA 1TO3A 4WY0F 3HMCA 1YXCA 2XGIA 2YXXA 3G3DA 3MKCA 1MEWA 3AMCA 1VFUA 3BURA 5TBOA 4IIEA 3MP4A 3RM9A 3TH6A 5I79A 3EEZA 5JQ9A 4ZTYA 3W7CA 2ZRWA 3N73A 3R8GA 3IIOA 3QY8A 1GT8A 1IXQA 5IHSA 1KM0A 3C2VA 4NQ1A 1L6FA 3H4WA 1TWSA 4HZ6A 5EFFA 3VOHA 2DPEA 5LSMA 1JL8A 2H90A 5BRQA 2DT0A 3HFYA 1H49A 1JNDA 3CH0A 1YXYA 5E9AA 3HM7A 2Z1SA 3APTA 4ZXOA 1GYLA 2P5NA 4YU1A 2PWDA 4PEEA 4RNIA 3DOPA 1ZAHA 2HWGA 1BG9A 2VCAA 5D02A 3H2MA 2QCDB 3W1QA 3MO7A 2R14A 2CZFA 3PBWA 5EY5A 3KM8A 1ZNNA 5LNSA 4PUJA 1OHLA 5H8MA 3NQCA 4L9XA 3ZR5A 1XYLA 4IJRA 1SZGA 3HTWA 3WH6A 4DWSC 5G4WA 4E0CA 1GQJA 8A3HA 2GJLA 4R27A 2ISSA 1HKJA 4IPLA 1DJWA 1QNPA 2Z1BA 3QTGA 2XIIA 3BLLA 1QXLA 2BXZA 3OTRA 3JR2A 4H9ZA 4RK8A 5DFAA 3DHFA 3MMWA 1I2RA 2P88A 3WUFA 3H7RA 3MMUA 5HJXA 1DJGA 3WLJA 3PZOA 2OZ3A 1TJRA 1ZS2A 4LRTA 4PL1A 5LIWX 5BZAA 2CNCA 2G3FA 4R88A 3AXKA 2JFEX 2YL5A 3E2QA 1ITQA 3KOFA 3RDKA 3GH4A 3GHSA 1TELA 1I0DA 2PWUA 2Y8VA 2NX3A 4HKPA 1ESWA 4CQ9A 4Q8QA 4FX8A 4B2DD 3N17A 3TFCA 4CCCA 1XICA 1EQCA 1X1NA 4XZ9A 4XZNX 2BHUA 2Y7EA 4AY8A 3PK7A 4IQLA 1MUMA 4LJ3A 1HKVA 3BCJA 4W4QA 3WNOA 5HATA 4XAGA 2XM1A 3MSRA 4W7VA 3UD6A 1AH4A 2P3ZA 4R3UA 3B05A 3BCDA 1MQQA 5IBXA 3TKFA 4Z1AA 1AW1A 2A0NA 3M5VA 2QJNA 2Y7FA 1MQPA 4JTQA 5ABTA 3RJXA 1R2RA 2PWFA 1I8JA 4JR5A 3FX4A 5A6AA 4K8EA 1HVQA 2OZ8A 5C54A 4MADA 3C2YA 3QRHA 4CQBA 3KX6A 5CJMA 4XX6A 4MF4A 1XRTA 4JKLA 4BI7A 3MTWA 4E3VA 3EA2A 1XUZA 4O52A 4HBKA 4FIRA 3SRKA 1FFRA 1E40A 3AYTA 1TYGA 2IPFA 3CBWA 1LYXA 3W7IA 4O1CA 1E9IA 5AC7A 1OGBA 3K5XA 3WLTA 1WOAA 1VYRA 4ROPA 4MWAB 3RJYA 2GOUA 1FBAA 3CMFA 1NF7A 3KRUA 4PSPA 4HTYA 3AO0A 3OU8A 3TDFA 1IT7A 2DT1A 3CWOX 4DJEA 4QDWA 5J8LA 5D9NA 4PTWA 3CO8A 3RO6A 3P3BA 3O6CA 3N04A 4MKNA 3ENLA 3L21A 3WF3A 1RLDA 5K9CA 3ZSTA 4CU8A 1VP5A 4PZVA 4GO9A 4GZEA 4ZOEA 4IPNB 1GOIA 1L8PA 4HZMA 1CXIA 1H7XA 1REQA 5AYXA 1CIUA 1S2CA 3UWVA 1XKJA 4RZ6A 5EMYA 5EA9A 3ITTA 2GGIA 2PDNA 2Z4GA 1TQXA 2DSKA 3D46A 5CZ0A 4F9JA 4LBSA 3SQSA 4LY8A 2J7FA 3PUOA 3N4EA 3PAJA 4Z2JA 1GZJA 3RFAA 4YWIA 1BVZA 2G5WA 3THAA 3FGCA 1LUCA 4O1EA 2FB3A 1J5SA 2VYOA 4AHPA 3MSYA 4QTGA 1ISYA 3GTFA 2E7FA 3NL6A 3EWDA 1HVXA 5IM51 4QNWA 3CZGA 4PMYA 2E25A 4H6RA 3AHXA 5H6HA 2FLIA 2VT0A 4IP5A 3S83A 1OFRA 4HNTA 4TUFA 4LAUA 2NLIA 4O14A 2XH2A 4GI9A 3W7HA 1VYPX 4LVBA 1HP4A 1YTKA 3ABRA 1K9TA 3TR2A 4ENLA 2GFTA 3GYEA 2WMJA 3VO0A 2GUYA 2Y88A 4AZIA 4Q22A 3T8QA 4L65A 3AHYA 4Q8PA 2J74A 1IZJA 2VHLA 4MUPA 4KCTA 2X42A 4MMWA 1DJXA 2V5DA 2I17A 1KWGA 4MLRA 3ZT6A 1LL4A 3RRAA 3WNPA 4WKHA 2ZFAA 2QCHA 3PJWA 2V6AA 5CPTA 4F3HA 2A21A 3WH9A 4QLJA 2OR2A 1J12A 4C6EA 5KZDA 3CHCA 1TRDA 3BLOA 4N02A 3ITLA 1JAKA 3S5YA 4IPPA 1AQHA 3TSMA 5MKGA 1VZWA 1ZBKA 4QDPA 3LY0A 2EBNA 1OK4A 3ZT7A 3W85A 2GOKA 4XTIA 1BGGA 4RUBA 1XLMA 4LUTB 1KFKA 1UP3A 2XHYA 3O3RA 3UXDA 1E5NA 3ZJ7A 2IQ0A 4OQVA 3TE9A 2AMGA 3FJNA 3WDIA 5BOOA 3P84A 1ITUA 1XYMA 5FCZA 2HRWA 4FZIA 4WXZA 3U2OA 1MYRA 3QF0A 3UJEA 3BL3A 3OGVA 1R3VA 3PBVA 1VRDA 3DI0A 3S1UA 4YHGA 2NQJA 1LRQA 4GYPC 1ZHAA 3N12A 1K7XA 4JNMA 1YPIA 4DNMA 1LL7A 1RY0A 4Q4MA 2OSXA 2XGBA 1H0GA 1CI1A 2J4GA 2EPKX 4L9YA 1JVNA 2ZC8A 3MV01 3HA1A 3S5SA 2E6AA 4MOZA 1KRBC 3IJDA 4L4LA 5CQ1A 1PZ1A 2IPGA 1DE6A 4JGDA 4G7EA 4KMQA 5CC5A 2QIWA 1EJ7L 1PEZA 3C8NA 3VGGA 4P7OA 3VD4A 3NR0A 4IG2A 1J4EA 5BWAA 4NZCA 1Q6GA 3URBA 1YDVA 4E8DA 1EXPA 3VAVA 4I8YA 3TLQA 1RVKA 3WNNA 3LNMA 5CG7A 1M3UA 4UFMA 1W1IE 4QDMA 6TIMA 1SW7A 2WMHA 2ZIDA 3BMVA 1MXSA 5B7YA 1V0MA 2D3LA 5DT7A 1NWRA 1HGYA 3W84A 1RSCA 3B9OA 2OTDA 2HVNA 3FSTA 1HKKA 2E9MA 2GJXA 3FNDA 1N82A 3TA6A 1UZHA 3FAXA 1ISWA 1RPXA 1GK8A 1X8CA 5GNYA 3NQ2A 5G4HC 1QNQA 2XH7A 2XVGA 2W63A 3KRSA 5H1WA 1GVIA 1W9VA 1XJBA 3BSMA 3M0KA 4XAPA 2PBOA 2ADAA 3C4UA 3GFZA 4KRTA 2YXGA 3WD1A 4KETA 1M65A 4F2UA 1IIHA 4AZCB 4BA0A 4QBXA 2CKSA 3VZXA 3C2OA 3KBMA 3WJZA 4DUWA 3IK2A 2Q3OA 4D8AA 3OBEA 3SW6A 1QVBA 3WJYA 3PZVA 5I23A 3PZGA 2FYMA 1VFMA 3QM3A 3GXDA 4NNBA 2E9BA 3G1HA 4PMQA 2HTMA 1XFCA 1TKKA 4JPGA 1LF1A 5E70A 2Q8LA 3A47A 3VFCA 3V3WA 4ZZ9A 4JTFA 3V75A 1EHNA 1FWEC 2CZVA 3ANVA 3A21A 1FCVA 4ZQCA 2V5BA 3PG8A 4IGSA 3W29A 3ZMRA 2QDHA 2OO0A 2AQVA 2VMFA 1EA0A 1JDDA 5A8MA 5FF4A 2J47A 4BR1A 3GO2A 4D9PA 5D9OA 3KDOA 3ABZA 1SFTA 1NDVA 4J3VA 3PPGA 4MG4A 1XLIA 4UMCA 2GWNA 3TC7A 4IPIA 4UCFA 2VGFA 3UW6A 2GVEA 1NAL1 5CAHA 5C5YA 3F5KA 5F2MA 2YW4A 4ZODA 3F4NA 4HNLA 1JFXA 1G4SA 4AVFA 1W1ZA 1HGWA 4OWGA 3VDAA 4MYXA 1KM6A 5FF0A 2R1MA 1OADA 4G8TA 4C6JA 3GVVA 2XVLA 4HCHA 1HG3A 4RL3A 4C6IA 3BLPX 4GGBA 3OQEA 3QZAA 4JIHA 2D24A 4E2OA 3EKZA 4GXWA 4QR6A 4AH7A 1B9BA 3V0UA 4ZR8A 3VIPA 3ABSA 4J3XA 1S39A 3N9KA 4OVXA 3T44A 4L1WA 3T07A 3ATZA 2ZZ4A 1TIMA 3CL6A 3PZTA 4L56A 1JG9A 3QPZA 3VIGA 3OVPA 2Y62A 3E74A 3LNPA 4DF0A 3GHUA 4JNYA 5KSWA 4UQBA 1R86A 3M5XA 3M64A 3ALGA 1O5RA 1B2YA 5JUVA 1XYCA 2EJAA 2O55A 3O6YX 2XIQA 2VFDA 4IIFA 3DHPA 3TN3A 2DDXA 3BSHA 3O06A 4JCMA 4WLCA 5CZSA 5A8OA 4C6OA 2R9RA 2PDCA 1T99A 1QO2A 1DVJA 2I1OA 1JZ5A 4KIEA 3BUVA 4H41A 4JN6A 1W3LA 5CPMA 3RR4A 4REQA 4QXIA 4J2MA 4UZSA 3UXKA 2OLAA 2F61A 2E77A 4TVDA 4JQAA 3GDMA 1XINA 3LMZA 2DW7A 3PSWA 2BY0A 2WJFA 1JCMP 1HXJA 4XAFA 3XINA 4GVGA 4PMRA 3G1YA 2QIIA 1WDRA 3WNKA 1THFD 3AMGA 1ZUAX 1Q66A 2G97A 3WCZA 4AQLA 4BS0A 5M5DA 3UZYA 3RXZA 4D6FA 1EZWA 3NDZA 3SN0A 1V3MA 3CQHA 1K03A 1TTJA 1VENA 4UQ9A 3VI2A 1NQKA 3DERA 5D38A 2J6XA 1YBQB 3OZPA 4IGNA 4WR3A 2V0TA 3OODA 1G01A 1LDCA 4INFA 2RUSA 3M41A 1UBPC 2X7WA 4L4PA 1UKTA 3VGEA 4AVOA 2CEQA 2ZCGA 2Z1VA 3GWQA 5HMDA 2G8ZA 3SUUA 4N9BA 4H8HA 3PB0A 1UIOA 3F03K 3V5FA 3N13A 3ABXA 2ABBA 2NQZA 2WSPA 1UH2A 4IGHA 4MHBA 3T78A 3HBLA 4UFLA 4K37A 1E0TA 4GE8A 4MAVA 3I4EA 3CZJA 1J11A 4NX5A 4GXMA 1JQVA 1LCOA 2AAAA 4D72A 4KT2A 5EMKA 2GVLA 3CC1A 1JYXA 4ML9A 2B7QA 1M41A 1OWQA 4GVHA 3TYUA 1AK5A 1JPDX 5LXXA 1B57A 1PKMA 1Q8JA 4C7GA 1U5VA 4PTVA 2BGSA 4JAWA 2PRMA 3LGEA 3MJYA 2VC9A 5TD4A 1ZPTA 3N2TA 3DFPA 3GVRA 3L7RA 5D9MA 2WC4A 1IT0A 4Q8WA 4RW5A 3GNPA 1AD4A 1SW3A 3ZIZA 2QAPA 2JQXA 3CZKA 2QCGA 2YZ5A 4AZBA 3MO4A 3N2XA 5L9FA 2PLJA 1SJBA 1NELA 5EB8A 1QPNA 3RPTA 1SSGA 1KR1A 3K1DA 2CCRA 2EQDA 4IJCA 1N55A 1GWJA 1GJWA 1GYNA 3SCTA 4FI4A 1QOQA 1V02A 2E40A 3B97A 1ALDA 1F2JA 5AECA 3AXXA 2OLSA 4LUJA 3LG3A 2A7PA 2CLIA 4KW2A 4RZBA 5CXPA 3E6EA 2WHLA 4Q3MA 2VX7A 1SZEA 3K13A 3OIXA 3SY1A 1IV8A 1RLCL 3MC5A 1XD0A 2YB1A 3ZT5A 3I7QA 4P5UA 2ZA3A 3QQWA 4HNUA 3W37A 2CLMA 3W7LA 3C6CA 1VPXA 2GPTA 3CZ8A 2A79A 1NEYA 3MKVA 3APGA 3G1VA 1R9ZA 4Q4OA 5BYWA 3W7OA 2CWNA 4O19A 3R13A 2JIWA 3FJLA 2FGZA 2R8WA 4G1NA 3DFNA 5C7HA 1IEIA 4J3ZA 3KTCA 4QISA 5FF7A 4DO5A 5FJTA 4EAYA 2NV1A 2QCCA 3CH9A 1WXJA 3UU0A 4WZHA 1Z8AA 2WJZA 4ZQRA 1W1PA 2VGGA 1BWVA 4ORIA 3TK7A 4GHRA 3NEVA 1XGEA 4C6NA 3I68A 2BGNE 3IJ9A 4Q8OA 2VD8A 4WVXA 3SURA 2FHCA 3RYSA 2VR5A 4N9CA 1X7IA 3JZEA 3GK0A 1JDCA 2DIKA 1XYAA 3S1XA 3V16A 4AMAA 3C0LA 3MUY1 3UF9A 4W8BA 1TPUA 4QEHA 2V67A 3I6RA 3LLFA 4UTWC 1WKFA 3NQDA 1QHOA 3NZGA 4K7YA 4U5KA 3H2NA 1EDGA 1XFBA 4CCDA 3VKBA 2OT1A 5HUOA 3EPMA 1I1WA 3GD6A 1RJQA 5DO8A 3RU6A 4QG9A 6REQA 3VTRA 1JZ7A 3CAKA 3O0FA 5D04C 3ITCA 4B5TA 3BOXA 3EKGA 3V1PA 2BOGX 4JTUA 4WD0A 2ACRA 2D2OA 2PP3A 2Y70A 1ZBCA 3WLLA 1ZAIA 3CASA 3UXAA 2F8QA 3HZ3A 2UZ9A 3KVMA 3B06A 4IMEA 4LAOA 4XWUA 2VEIA 2VOTA 2HNHA 3T0CA 4JHMA 4RLIA 5GJPA 2G96A 1RY8A 4O15A 4LBRA 2PU0A 3P14A 3CHFA 2XH4A 3FV9A 2F7FA 3AIWA 1CPUA 4AU0A 1R6WA 1BLIA 2ATMA 2WSYA 3C2EA 1EP3A 1Q4WA 4O11A 3A23A 3BW2A 2R1KA 4HMEA 3DFHA 3I7RA 1G0CA 4B4FA 1XQLA 2QZRA 1NIUA 4NJGA 3GDKA 3NGFA 1X7FA 1B54A 4S39A 3MDWA 3QGAC 3HV9A 4S38A 3S42A 2VJXA 3ARXA 1V93A 4AIOA 1M03A 2PLKA 2HVOA 5ABFB 1H7WA 1C7SA 2GK1B 5I77A 3U0HA 4H83A 4NL1A 4LUIA 1W5QA 1PTAA 2BVDA 1H63A 1A4MA 3VGBA 3O15A 3ZYZA 3W6LA 4DNHA 3URNA 5HQLA 2O7SA 1XDJA 1YPXA 1NH6A 3M6YA 3IS4A 1W37A 4X61A 3G1XA 4UQAA 3S5OA 4YTQA 3NUKA 4PUWA 4DRSA 3FEQA 4S3CA 4XUYA 5CBBA 2Z6JA 3BW3A 2FTWA 3CXOA 4Q4KA 2GUBA 4AZ7A 1MRQA 4W86A 3T81A 3NCOA 2HISA 1TSIA 4DJFD 1NWTA 1W8GA 3BTNA 3K4DA 2YYUA 3GIQA 2NT1A 1WUFA 1UC5A 2DVXA 3GU9A 5AYYA 1P0EA 3KHDA 4US5A 4K8HA 4YL2A 3TCSA 2A7RA 4WSHA 1EDQA 3SIMA 2RJHA 3Q2DA 4HSOA 3VKAA 4EAMA 2OO6A 4ACZB 4EOUA 4FF5A 3LD5A 2TAAA 4D8LA 4GGHA 4WK9A 4HJFA 4QSHA 1S5MA 3FLUA 2Z28A 4M56A 4GUGA 2J62A 1X8FA 4O28A 3MB9A 1CGWA 3M7WA 4CEXC 5C7VA 3SCSA 3VK5A 2PEVA 5A2AA 1EGZA 1XLBA 4WXYA 4A2SA 2BBFA 4ERAA 2IMRA 4HK6A 4CN4A 4U4MA 4DUVA 3UG4A 1EJVC 1V6VA 4LAZA 4AIUA 4XSMA 2YA2A 1H41A 1X96A 2YYTA 4P7NA 3ZLHA 3WH8A 2BB0A 1WZKA 5JXQA 3NSXA 2FZDA 3H8AA 5CBJA 2EPLX 3RCNA 3GKAA 3PP7A 2GJRA 3WZ0E 3M0IA 4ZO7A 1EZ2A 1GYMA 4I3GA 3W01A 2VEGA 2YA0A 1F5ZA 1QTWA 4LTSA 4MDOA 3M07A 3SCOA 3GM8A 3OPSA 5IFTA 1YEYA 2ISFA 4O18A 3H22A 4NZJA 4L4MA 4JFUA 2DT3A 3USBA 2CXEA 1GEHA 2VX4A 4MY8A 3BK0A 4KIRA 3DI1A 4FSAA 2FVKA 2D1ZA 3GU2A 2DJXA 3M5ZA 4Q4PA 2FVLA 1CGYA 3I3BA 4HJWA 1ZBVA 3L5AA 4QJ1A 5HWJA 2DEPA 4IMGA 4DAFA 2VCCA 3SQMA 1A0DA 4LB4A 4FNPA 2NXIA 8CGTA 4AG0A 1XI3A 4ATWA 5KETA 3S2JA 4TTGA 3LM3A 3P8JA 1XV8A 2X2YA 3OZYA 4PSRA 2DZVA 3N1AA 3CAWA 3CV2A 3GTHA 1WXYA 2EKCA 1BQCA 1H4PA 5GJMA 3SY8A 1BYAA 4JEJA 2ZBTA 2QVHA 2B0MA 1Q6EA 2UY3A 3MVIA 2WKLA 5EFDA 1FHLA 3UZJA 3HN3A 3W1UA 1JZ3A 1GVOA 5MF5A 1FY6A 3ARTA 1GKQA 1KRCC 3O0KA 2V2CA 2YGYA 3CPRA 3KZSA 4AZ5A 5G1TA 4UNLA 1HO4A 4ZO9A 2CESA 5G2IA 2PLCA 2ZUSA 1AJ2A 2VTFA 1X98A 4E2DA 1PWMA 1WX0A 1SMAA 1HL2A 4X9SA 4HGXA 2VX5A 3R0DA 2FDMA 1HIZA 2C18A 1W3IA 1HF6A 4JYDA 3UR5A 2QUUA 2GGJA 1E56A 4CVUA 3AYVA 4KS0A 2QVNA 3WDRA 2P0IA 3TMQA 3P8IA 1UG6A 2Z2BA 1OF8A 3K2GA 1W54A 2DZUA 1Q6CA 2TPSA 1WZAA 3BOLA 5L6UA 4MLJA 1PBGA 1DV7A 4IQJA 1EP2A 1FCBA 3GXFA 4IP4A 3JW7A 2Z1KA 3EWUA 3S2MA 4I5UA 3KRBA 2FH6A 2IQDA 4BWLC 4Y96A 1FWWA 4W7WA 4ZCWA 4GZJA 3MW7A 1UH3A 3CNYA 3BDKA 1HN1A 1N7KA 3SCWA 4DWSA 3M46A 3B9EA 1BYBA 4FNRA 4NZ3A 1XSKA 3ARYA 3HJZA 2FMNA 4DJFC 4JICA 1DJYA 1RUSA 4RE3A 3DH7A 2PRLA 3CHEA 5DQPA 4MAZA 3GC4A 4X60A 3NVTA 4W5UA 4QHRA 4AWSA 1D3CA 3Q58A 1H1YA 2YCJA 2PTZA 5I7GA 3I65A 2QHAA 3AALA 1ZENA 3NQ8A 4CD5A 3GXMA 1BWKA 2VC5A 5KTLA 3C5QA 3LPFA 3BAIA 1A3WA 2J9XA 8XIMA 3R4IA 3VMOA 4NAEB 5DBUA 1XDLA 3H6OA 1S5WA 1K7EA 3QKZA 3M0MA 3TOPA 2I14A 2GJNA 3HF3A 3TMLA 1W5MA 4O1BA 3M4HA 1P1MA 3R12A 3QY6A 3EMQA 4RZ4A 3FS2A 3H7VA 3MYPA 8XIAA 2G3NA 1OFQA 3TW9A 2HZGA 4RNJA 4C6LA 4PUKA 1EFZA 5HNUA 1R8LA 2WNQA 3HG3A 4UR9A 3SI9A 4V15A 1TJ0A 2RDXA 4OBRA 3F2BA 1JIBA 2EF9A 3LCWA 1TMHA 1DIOA 2B7OA 3MCNA 3RM8A 1P7TB 3WH7A 1DIKA 1LLZA 1FWRA 3KBWA 1AQ0A 2ACQA 3SRDA 5FD0A 1ONEA 3W70A 2EEXA 3QQ1A 5CGTA 3SGZA 3W7NA 2XN0A 5HULA 1EJUC 5KZEA 3NQBA 1OGGA 4J3UA 3SQLA 1MDRA 3PULA 5FF2A 3W2JA 3VCCA 4PUMA 4Z2GA 3KUMA 5CJ5A 4AHOA 1PZ0A 2VZUA 4XIMA 4CNTA 4OJYA 2P10A 5FJRA 1UIPA 1CDGA 1L6SA 4NILA 1PIGA 1N2VA 4Y9MA 3U2CA 3WD4A 4PUNA 3LTYA 3VIIA 5A8PA 3VD3A 3ZJ8A 3ISIX 3TSDA 4I9MA 4G56A 5E5CA 1UJQA 1JI2A 4XK2A 3A9IA 2QPSA 3GNDA 2WMIA 5BOFA 4IIBA 5HBFA 4FMVA 5G5IA 2Z2AA 1UWQA 3TU9A 1Z32X 1OG6A 3CIWA 4BF5A 4UTLA 3GG1A 1OY0A 4L61A 5IHRA 2X1TA 1JQXA 3DENA 1NJJA 2YDAA 3I4KA 1VCFA 1V5XA 5GVJA 4TR9A 1IGWA 1MI3A 1R3QA 2QCDA 3AICA 4NZFA 3FA4A 4N4QA 4Q8TA 4UOJA 2ATSA 4XBJA 1SUXA 4GIEA 4UZUA 2V63A 5DEZA 2W27A 1VEPA 3SN4A 1DJNA 5EU9A 3WK2A 5F2GA 1TPEA 1N8FA 1GVFA 3P5YA 1PTDA 5EMLA 3N19B 1XRVA 1M68A 1XYZA 1BSIA 3GNRA 4GIAA 3BICA 3NL5A 4NJKA 2B7NA 4TX6A 2QGYA 4FNTA 2A3EA 5D09A 4ZSTA 5C9ZA 4AZHA 1RAKA 3GH7A 4LF1A 5DMMA 3P81A 1Z6KA 4HHPA 2UY2A 4AEOA 1E9LA 3S6OA 4XO6A 1JCJA 3FDKA 1QW7A 4Q33A 5FL1A 4PBGA 1CGUA 1TPH1 3KVKA 2EPOA 3RLUA 1UROA 1GPFA 1VCGA 3VGDA 2CBVA 2PA6A 4S1FA 2OX4A 1G94A 4LWWA 4MB3A 4RDZA 2VGIA 5HINA 4JFWA 3P7YA 2CU0A 1YX1A 4LT9A 2CW6A 3SGGA 3WLRA 4QG6A 1S2AA 3W1NA 1R0MA 2PCEA 4N7QA 1J0JA 2D2GA 1LQ2A 5LYRA 1L0PA 4H8UA 4DELA 2Z7KA 3W71A 3VGFA 3OGRA 3AZSA 1WQ5A 4EPEC 3W73A 3WEMA 4MFDA 3BCFA 3NFUA 2ZXAA 5A6MA 2ACSA 2OU4A 3LHVA 1CCWB 1FH7A 3DESA 1FXQA 3RX2A 1A5OC 2XWEA 3LXCA 3QTPA 5AHNA 3BOFA 4OOUA 2ZUMA 4YNGA 5C8BB 4JN8A 2V3EA 3H2AA 4L5ZA 2PDFA 4UFIA 7ODCA 5BW6A 4UQEA 1Q6RA 2DT2A 2C13A 3S1VA 2PDBA 4IFKA 1HP5A 2BVYA 1VBGA 1TZ9A 2QCMA 1GQIA 4FNSA 1FWBC 3SN1A 1TCDA 1TJPA 3WQCA 4B2DA 2A3HA 2CBJA 3F4CA 2Z7GA 3EMZA 2JGYA 2P8CA 2WZHA 1TPFA 3LEPA 4OTKA 2V3GA 2JGQA 5AHFA 2E9LA 4M6UA 1I45A 1JPIA 3N6QA 4DZAA 3W3OA 4GQQA 3NYDA 4Q4SA 4IFOA 3TQVA 3UPWA 4A8LA 3TAKA 3G5EA 2J78A 1XIDA 4GPNA 2OKOA 2PU1A 3QPYA 3G2GA 1WXZA 2UY5A 2PDQA 4F2TA 1GUVA 5F7UA 4RDWA 1SPQA 1LG1A 1FCUA 4N6EA 1XIJA 3L9CA 1MSSA 3VNLA 1FHDA 4NRRA 3SJNA 3ANUA 3E2RA 4X9YA 3UY7A 1MRAA 2C7FA 3OLGA 1CZ1A 2F6KA 3R58A 4HYVA 4EPBC 2E8YA 4FR1A 1TUXA 4H7ZA 2WVTA 1EYEA 2XIBA 5EPDA 1PKYA 4QEEA 2JIEA 3TYBA 4AHQA 1UUQA 4FS9A 1K9EA 4I8DA 4LALA 3U8GA 4WDUA 3ZJKA 1V6UA 1ZALA 2F6UA 4IUOA 1O5QA 1W5NA 3IGSA 1QI0A 1P6BA 1V6TA 4W8LA 1BF2A 5MHBA 4IWWA 2YOCA 3TTOA 1IEVA 5HA7A 1U5JA 4XZBA 3LERA 4LBUA 3CYVA 4L80A 3AS1A 1YNPA 5LIKX 4FP1A 4WGXA 4M1BA 2DUZA 1OFOA 3S2LA 3W7GA 1WP6A 4Q7BA 4FALA 3CHVA 2CHRA 1KXVA 1Y65A 2E68A 4MKVA 3WSUA 4GINA 1US2A 3QOKA 2BHZA 2X05A 2Z24A 1AW5A 3LHWA 2QQ6A 3T6CA 4EWJA 5H8UA 3KE0A 3LI0A 4MKSA 4A3RA 2XDFA 2P1FA 4CQ8A 1GONA 4DYJA 4C1NA 5FJJA 4DB7A 1JXKA 3WEZA 2HXTA 3G18A 2V8ZA 2CPUA 3QZEA 2AGKA 2NX1A 1ZJBA 4D1IA 4GNVA 1O68A 4L64A 2CLFA 4KCUA 4R7JA 5C0QA 4GA8A 1HX0A 3N14A 2WJEA 3NDOA 4RCXA 3GBDA 5AFDA 1FWAC 1JUKA 4ZQMA 4H6QA 1SJDA 2XFFA 4K38A 5FA5A 2EJ1A 3VA8A 1M7JA 3WO8A 3BVJA 1ZCOA 4YYCA 4M29A 3KZPA 1LM1A 3IVSA 5D2WA 1FDJA 5HR7A 2VOMA 2V3DA 3KLKA 1ONWA 2EG8A 2RAGA 4LSBA 3IJ7A 4QQUA 1BAGA 2B31A 2YBVA 4JDYA 1ZZMA 4O0KA 1FRBA 2Z00A 3WDPP 1DQWA 4IMAA 4UUIA 3VPLA 1Z42A 3CU2A 1D7FA 1H50A 5KITA 4XKYA 5I00A 1GZGA 1XIHA 2ALRA 2ZDRA 4OZOA 2X16A 4HHLA 1NOFA 1GQNA 2WVVB 3LB0A 1Y0EA 4KWOA 4LYQA 2WV8A 4GNKB 1Q5MA 3EDEA 4MPKA 4HOXA 4NNAA 3CL7A 4JX4A 1PSCA 4KWVA 1X1ZA 2BXYA 3TXZA 1DJHA 2Z6IA 4O4VA 3MYOA 4IIDA 3WQDA 3IK4A 1V6YA 4GD0A 3PS7A 3LXBA 1C7TA 1UR1A 4B5NA 3JUGA 3SFKA 3WF2A 1KM4A 3LUTA 2NQLA 4HQVA 3WJWA 1DWHM 3WDQA 5T91A 1J6OA 2BY3A 2RGMA 5A69A 1JUBA 2GSJA 1M5WA 2D0FA 3L2MA 1GHRA 3NPVA 1JI1A 3C61A 1OF6A 1XM3A 1SZRA 1HNYA 5LGZA 1PWLA 3NXFA 3LI1A 3RX4A 3UT0A 3AZTA 2J9YA 3DFSA 3OYXA 1FWGC 4N9EA 4RXGA 2XN1A 1UQZA 2YIHA 3D3FA 3BMXA 3PNZA 4E2VA 2WZTA 3B9DA 4GNJA 3MUAA 1QUMA 2NW0A 5CZJA 4IP7A 3TIMA 4TU1A 4A4AA 1WV2A 4NZ5A 4O50A 3CT2A 2AL1A 3RG6A 2WKJA 1RD6A 2ISVA 2C6QA 3VMPA 2YR1A 3ZWTA 1WAUA 3WK1A 1A80A 5HNRA 1IWPA 1EXBA 3BLEA 4U2YA 3W2UA 2J6VA 3GXIA 2W0UA 1KB3A 2HPMA 1HL8A 3L4TA 4IIHA 1Q3NA 3W1PA 2RDTA 4S3DA 2P50A 4MB4A 1CWYA 1W5PA 1JYWA 4PN2A 1AJ0A 4HK5A 2VENA 2PE4A 3KFTA 2FKPA 2VM8A 4JTCA 5I2UA 4R9OA 1W9UA 3UJRA 5SWUA 3W26A 3BJFA 3CEUA 2FHBA 2W79A 3IJLA 2DZXA 3LCFA 3VKDA 1IEQA 4HU0A 4LUYA 4NX0A 3U2ZA 1NTHA 3WF4A 4FAMA 4J4KA 2VCBA 3ZQ9A 1J0ZA 6ENLA 4QCFA 1XYBA 4GOAA 3MU7A 2I5GA 1TR9A 1KXHA 3DDMA 3KCLA 1VGAA 2A3BA 3UJSA 5LIUX 1BKHA 4M1RA 1XR2A 2IS7A 3KL3A 4WX2A 3VNYA 5CZTA 4GX9A 3TWAA 3HQ1A 1W5OA 1TV4A 1GQLA 2PDXA 3QSRA 2OEKA 3TYZA 2G41A 2PTWA 4HT3A 5A6LA 1MVYA 3SZ8A 2G37A 2X1IA 4ZE5A 1ITXA 1KV5A 1QPQA 5A8QA 2A5HA 2PDLA 3LXAA 4RE0A 5I5RA 3THCA 3GY1A 2Z25A 3NWRA 4UTUA 2ZVRA 4ATLA 4Y9OA 1EJRC 1H7RA 3ARWA 1EWDA 1EJWC 3CTLA 1A3HA 2QXWA 2VFHA 1DJZA 1RQHA 4OHQA 5FOOA 2INFA 2VVNA 3R79A 4F0MA 4XVDA 1P6WA 2XIJA 1FP9A 4QQ3A 3C0QA 4ZENA 1V3JA 2EG6A 3W2KA 2V30A 2WZIA 4PMDA 1VIZA 2JF6A 3VABA 4H04A 5J04A 3NM3A 4H4IA 3H2CA 4DIAA 1S2VA 1Q6LA 3ZZ1A 3TLLA 3QV9A 4TMCA 1FKWA 1BXCA 4XVEA 2D0GA 3HG5A 5FAGA 2DH3A 3NURA 1ICQA 4F40A 4FNUA 3V4BA 4QE4A 1XLJA 2VKZG 4QIUA 4H3DA 1I60A 1XGZA 5H2ZA 4U3AA 1PAMA 3LX9A 3LBMA 1TJ1A 2R91A 4P61A 3WN6A 3BGJA 1CLVA 2YX0A 3UZXA 1AZ2A 3K8KA 2QLYA 4M51A 1KTBA 4WDXA 3T7VA 2FZMA 3B8VA 2ZRZA 2E28A 2HV5A 2VR2A 3LM7A 2OG9A 3JS3A 1N8IA 3MCMA 4C6BA 1FWCC 5I3IA 4V27A 1B4KA 1P0DA 3TW6A 4AAJA 1Q7MA 1K1DA 4GI4A 4J9JA 3TTSA 1KFLA 4ZE4A 2DZSA 2DFAA 3R43A 1OX5A 3BWWA 3IJIA 1EUNA 1UPPA 3PFRA 3NPWA 3WDJA 3KEHA 3IVUA 1BXBA 4KEMA 2XFRA 3WFAA 4UFHA 2QJJA 5A6SA 1TPVA 1YE6A 4H8VA 2X2GA 3Q67A 4CNSA 1L6YA 2G50A 3LRKA 5EGRA 5LNRA 3VIFA 2D69A 3BAKA 2A7NA 2QT3A 5C55A 3T8LA 5A8NA 3TYCA 4ERGA 2X0HA 2VNCA 3MT1A 3E49A 4NAFA 3WLKX 5JIWA 1RA0A 3RILA 1QMLA 1OYBA 4AXKA 4KH2A 1HJXA 4CCEA 4JDBA 4JTDA 3GR4A 4NHVA 3MUXA 4F0LA 2PF8A 1OQFA 4U2ZA 2FDSA 2GQ3A 4LAMA 3PANA 4CD8A 4H7CA 4FOJA 3ES7A 4GLEA 3B8DA 3R7MA 2XU2A 3OOQA 3PZUA 3AHZA 2BASA 3E12A 3UWZA 2NVCA 4V1XA 3J7HA 2Y24A 4YXGA 2YXOA 5D32A 3EOEA 1MZHA 3FA3A 1QW8A 3OBKA 3V5CA 4DLMA 4WF7A 5FL0A 4O16A 6CGTA 3D47A 5I3JA 3PZIA 3RAOA 1GVSA 1GCYA 4X0VA 3LRLA 1TUFA 2ZRYA 3IGXA 4OIFA 3RLVA 5LZLA 2GDQA 2J7GA 1QHZA 1R38A 5ENLA 2OYMA 1RR2A 1IWAA 4JIEA 4M6PA 1B90A 4LUSA 2EAWA 1YYAA 4JFTA 1AH3A 4PB4A 3M1ZA 1YDNA 4P7RA 3S1WA 4DY1A 2R1NA 2WHJA 1OZMA 1BRLB 1XCXA 4UTWA 1P0NA 4PULA 1WDWA 1REQB 4MVAA 4GK8A 4ROQA 1DWIM 3CV7A 1JCNA 1E6PA 3UESA 1TWDA 3R8RA 4LOCA 1E1FA 2INZA 2J77A 2QKFA 4A8RA 3Q37A 1W3HA 3W1AA 1OD8A 4N42A 1XH1A 1LZOA 3G0UA 1TA3A 4C6MA 2NSOA 1ITCA 3BE7A 4XD5A 4MWAE 1D7KA 3FGCB 2YDSA 1LUCB 3LV6A 4D1JA 2D20A 1UR2A 1J96A 3THQA 3N29A 3PSVA 4ZB0A 3SBFA 1ME7A 1J2BA 1FWHC 4UTHA 4EK7A 3KP0A 1K4GA 1RZMA 1UKPA 3QV8A 1O6IA 3QGKC 1DHKA 1Z3NA 3K8LA 2NWRA 2NXGA 3LCIA 2R94A 5G4EA 2ZYFA 5DCBA 5I3KA 3RCMA 4HPXA 1B9ZA 1OVDA 1VPYA 2WW5A 1SJAA 1KD0A 4ZQNA 1GW1A 2FTYA 2ZQ0A 2PDMA 3MHUA 7CGTA 2PDIA 5FJUA 4A3QA 4JL1A 3TQKA 1NQ6A 4ZO6A 3D5HA 4KKXA 3WLHA 3MKKA 1US0A 4AIEA 5U7SA 2Y4SA 4AY7A 4RR4A 1TPDA 5D8ZA 1K8CA 3TNOA 3QMTA 5AZ0A 3O63A 4JQ2A 1XRFA 5AYZA 2G95A 3AIVA 1H5VA 1SFSA 2W5FA 3UJFA 3B8SA 2F38A 3PHAA 2WPBA 3F2DA 1IE7C 1BSLA 4JTHA 5ABEA 1OINA 4JCLA 3G8EA 1QK0A 3H55A 1UUOA 2PLMA 5CKSA 1LLWA 3I3DA 3LRMA 5MKGB 2Y5JA 2NVAA 4OUEA 5I06A 1E72M 4Y2WA 1U22A 1GOXA 4J28A 3ICJA 1XIMA 3VINA 1KA9F 3EDFA 1C91A 3IARA 4QE1A 4LNCA 2JKPA 1DTUA 1BXNA 1DTNA 3PTQA 1FWJC 3ZFHA 1IQ8A 1QR7A 1C92A 2DP3A 3R10A 1E0WA 2J7EA 2YCLB 1NFBA 4IJBA 2A4AA 4XZWA 4GX8A 1OT1A 1W17A 2FHFA 2EPMX 3YPIA 1TV2A 5C6MA 5HMSA 3AAMA 4Y8EA 4ONVA 4XQ6A 2GSEA 2Y7GA 4S3GA 3EKLA 3OQ8A 1V7YA 3FY1A 1GZ1A 1RD5A 4I5XA 4XIAA 3UBPC 4FEZA 2ZXQA 3W7DA 1PCKA 1PVNA 1R9XA 4ES4A 3A4WA 1JYVA 2OJPA 2DU2A 2CC0A 2X0SA 4EF9A 5CZKA 5BMWA 2JK2A 4M3PA 4G7EB 3TZNA 1UD6A 1YTDA 2FZNA 4NI8A 1SMDA 3K30A 4IG2B 1HJSA 2XGZA 5AVNA 3WBXA 3Q4DA 1EJTC 3KL0A 4HHHA 1XHGA 3EA3A 2E8ZA 5HUPA 4LANA 1W1B1 1IT8A 3WL1A 3ALFA 5EBAA 1RHCA 3MHGA 4NRSA 4CU7A 3MWCA 4I5RA 5CPNA 2QAFA 2Y7DA 4ZBCA 1CTNA 1PX8A 2PB1A 2QUNA 1E51A 1CGTA 4OV9A 1KFEA 2PRHA 1WKDA 4QGCA 1BPLB 3N9SA 1Q85A 3R0KA 2GJPA 3ES8A 4N4PA 1ZP4A 3WQFA 3M43A 3S3GA 3W07A 3AJXA 1POKA 2AQOA 4HIBA 3KCOA 2EO7A 4DO7A 1EEPA 3E02A 3TV8A 1TWIA 2V2HA 2PP1A 1OBAA 3CUIA 2DUAA 5KEZA 4BY3A 4HYRA 1A47A 4QSFA 1OX4A 1NDWA 3C86A 3TN4A 3CUZA 2CLEA 4HYWA 1UZ1A 1EB3A 4GKLA 1IR1A 1TCMA 5G2HA 2G0WA 3LZ5A 1E4NA 3PPCA 1B30A 4F79A 3WELA 4CD6A 4GQGA 4PCSA 2KX9A 2VZVA 2XH0A 4CEUC 3UCCA 2W91A 1FH8A 1UD2A 2O92A 5FAJA 5K4XA 3CAVA 1VFHA 1EX5A 3N34A 4K68A 4IMFA 2REQA 4LX4A 5C2CA 4CVWA 1SYTA 3BLDA 1CLKA 3T9PA 3GZAA 3U7VA 2XFWA 4O17A 3EOLA 1WOBA 3GDBA 1R87A 3NQ7A 1V3KA 1OFEA 2WXDM 4WSKA 1XLGA 3W38A 4NNCA 1WBJA 3OEXA 2PDYA 1TPB1 3B8IA 1L6WA 4DO6A 3G24A 4YS1A 4FXJA 4N9DA 3GLCA 3U48A 4BWLA 3QR1A 2VEFA 2ZXDA 4MWAD 4CGTA 4LEFA 3WKZA 1GOOA 4S2CA 1MW0A 3LSCA 1Z44A 1ECQA 1Z9AA 2WBKA 1PO9A 4H7VA 3HB9A 1V7AA 1VEMA 1EF3A 3ARQA 1LWJA 2C71A 1AMKA 2XJ7A 1E9YB 2UV8G 3KCJA 2OYLA 2C19A 1Y5XA 3O2LA 2YSWA 1DQUA 4DJFA 4POCA 2XWDA 3GXNA 3W7KA 2WNWA 1XG4A 1Y8BA 1D8WA 3UGRA 5I3DA 3QY7A 1E0UA 2BS9A 3GXTA 4WSJA 3N11A 1J0KA 4WY0A 4FXFA 4UNKA 1K8ZA 1XBYA 3I6TA 2VRQA 1P6CA 4BHYA 3P80A 1OCJA 1Y5WA 3L2LA 1EPXA 5DMLA 2BODX 4AVNA 3CWHA 1KFWA 1EC8A 1G7UA 1TPWA 1E6XM 2W61A 7REQA 1OFPA 1ODZA 1WA3A 3V35A 3WMBA 3U3HA 4CKQA 2A3LA 4HA0A 3KAOA 5CLWA 4WJXA 3S9ZA 6XIMA 3AROA 3HPFA 5I24A 4EPDC 3M7SA 1YTEA 5KINA 5I0DA 2PGRA 3DKLA 6TAAA 3GE7A 1EGVA 4PMNA 3TCEA 2PTYA 3U7BA 3WBYA 3HQPA 2XN2A 2WWCA 3BV4A 5LIYX 3GNOA 4WJEA 2YPIA 5BOEA 1F8IA 2OQLA 3FKKA 1RCOB 4UFKA 2PDWA 3FYPA 2Q09A 2C0HA 4MJMA 2P8BA 1B3VA 4REQB 1Q7ZA 3CZLA 3MP5A 4XTDA 1VF8A 3S2CA 5H91A 1Y7VA 4L6OA 1L6GA 3PG9A 4BQ2A 4M5PA 3N3TA 4DPPA 3F5LA 1UOZA 1O95A 3SJ3A 4K8GA 2DIEA 3VM5A 1TMQA 1HFBA 2YDQA 1XIFA 2OZTA 2R1LA 1XP3A 4OBSA 3EA1A 3EPNA 4MSSA 1S2WA 4UNIA 5REQA 2ON3A 2Z1WA 3WFZA 5CH9A 4MUZA 3BMWA 4TX9A 2X09A 1RP8A 4I9JA 4UTTC 5CAKA 1GKRA 4JEQA 2GL5A 4DZHA 3TJXA 3UR7A 3F7JA 3NXLA 3ZO9A 4Q6XA 1SZFA 4X2PA 1ICPA 1OCNA 3GRIA 4DF2A 4GISA 4B5WA 3GX9A 1KXQA 2QJMA 2OMAA 4JTJA 3ZS4A 2D23A 1TTQA 5HDRA 2RH9A 2QUTA 3T0BA 4EIVA 5DRIA 5BU6A 2XSAA 3SFWA 3T09A 3UG5A 3PAOA 1JR1A 2Y0FA 4IFRA 2WQDA 3TR9A 1KW1A 2FFCA 1KBBA 3EDJA 4DYKA 1F74A 4X22A 2Q8ZA 1E9ZB 3QFWA 1RBLA 4TQTA 3AWNA 4MPQA 2V2DA 2FMOA 3THUA 1ZU8A 4ZO8A 3GFXA 2DZAA 4RE4A 3SIZA 4QJ5B 5AC8A 3E0WA 3QV6A 4C5ZA 3HGSA 3KDNA 3NZRA 4E5TA 2HCVA 3W1LA 4B90A 3STPA 4U10A 2QJHA 3QSTA 2O0TA 3S46A 2BP1A 2WHMA 3P82A 3TOYA 3UG8A 2Y6ZA 3N2CA 1B5TA 5EMUA 2NWSA 2WSKA 4R33A 3R94A 2PDKA 5GQBA 4WRHA 4C60A 3KRZA 2ZICA 1K3UA 4I90A 1JGIA 5D2XA 2W92A 4KBXA 2ANUA 3QW3A 1EL3A 2J7BA 4LVGA 3HO8A 4GH3A 1XXXA 3NA8A 4JTGA 4DLFA 5CSRA 3M0XA 3S6TA 3KVJA 1J18A 2C16A 4MWAC 2V5KA 1MEHA 2VGBA 4P8VA 4XD6A 2HNEA 1SU5A 2OX1A 3ARUA 3UNTA 2VFEA 4QM1A 3GBEA 3IANA 1OCBA 2ZE3A 2XISA 1KWKA 4CU6A 1BHGA 4ALDA 4WEVX 3QXBA 3IJ8A 4QROA 4IOTA 1J8VA 2OB3A 4PCNA 3A3XA 2A3AA 4FOKA 4ZOBA 1GVEA 3LBCA 1J01A 1KQYA 1Q6OA 3NQFA 3OIHA 4JTKA 1O5KA 2D3NA 5A5WA 4ZA0A 1GNXA 1W1VA 1YPFA 4GI8A 5C9XA 4W7UA 2SFPA 1XD1A 4WQ6A 1AZ1A 2HK1A 2YLLA 2PTDA 3WUEA 3WLQA 3A4AA 1GOQA 2WNNA 3OYZA 4IL2A 4KEUA 1HO1A 3IRSA 2HBVA 2O7QA 3A6OA 2HQAA 5BRPA 4K3ZA 1QK2A 1QASA 3VE7A 3SUWA 4Z2IA 3RLGA 2F84A 1V08A 1U83A 5XIAA 5I3GA 2IKIA 3EGJA 1WB0A 4YTUA 3VZZA 1E6NA 3TONA 2W4XA 3W1MA 5M3WA 2X8RA 3PB2A 3ZR4A 4G1KA 4F8XA 4JL2A 4JTSA 1BYDA 3WBAA 2WCGA 3U57A 3QKEA 1AH0A 1HL9A 1LP6A 1E73M 4J5NA 3WLMA 4YWSA 1ZY9A 4UR8A 4LRSA 1U1UA 3WDHA 3OP2A 2RKXA 2ZUVA 3N2MA 1PPIA 1J79A 2H3BA 5AB3A 3A5VA 1GJPA 2R24A 3S6DA 1AL8A 4BI5A 1JRCA 4PCFA 2C8NA 1ADDA 2YCIX 3FJ6A 5LA0A 1DP0A 3NO3A 3GG7A 1EDTA 6REQB 3FYOA 4JIQA 3UNDA 1JYNA 1SO4A 5C9WA 3DC8A 2RGLA 4NVTA 4H9TA 1U33A 1J93A 1A5NC 2Q01A 3QYSA 3DKJA 4AB4A 1ISXA 1PX3A 1XC6A 3MHFA 1VJIA 4C90A 3SO7A 3T0AA 3EBVA 3G1RA 1RV8A 2X40A 3UPBA 1KCKA 1C29A 1UKSA 5AHIA 3W22A 3WQGA 3KWXA 1JDFA 4K6AA 3UETA 3M47A 3SDOA 1H1ZA 1I0BA 2PDUA 3XIMA 4XB3A 3UY8A 3UA3A 3HURA 3EEGA 5GJNA 2J9ZA 4DUOA 3WQ5A 4GIRA 1UR8A 2IKJA 2FFIA 2EPHA 3FIGA 3L2IA 1JPHA 5JH1A 2E6DA 5FIPA 4FOUA 5XINA 3PM6A 3NZ1A 3UWEA 4Z1CA 3A5FA 3DBNA 4A8NA 1ONXA 1S38A 2ICSA 5ABHA 1H11A 3LSBA 4H6EA 3DAQA 2ZOXA 3VUPA 3VNMA 2CIPA 3AI0A 1WCGA 1DPMA 1GEQA 2ZZ2A 4W85A 4S3KA 3W00A 5BRBA 2PZNA 4AISA 3NDYA 3EWYA 3W24A 3HPZA 2XZ9A 5HNNA 1K77A 3WUBA 4IT1A 3KOYA 2VZTA 2QDGA 1O5XA 4B3ZA 2J79A 1UWRA 3PTKA 4ZQOA 3PUGA 4GUJA 4MZYA 3RITA 5TQLA 1VEOA 3LS9A 4JTEA 3EDDA 3RLHA 4L6DA 1PKLA 5BXRA 4QJ3B 4FLOA 1IXPA 4NZ4A 2VX6A 4I6KA 3KTSA 3QZ6A 3PBGA 2XSBA 3PWIA 4RW3A 1XX1A 3KW3A 4M80A 2VVSA 4EPKA 1AW2A 2HPIA 3TW7A 2I7GA 3RRXA 3PPFA 4M7TA 1LOSA 4NKCA 2AQWA 3M0HA 3LTSA 3HG4A 4B3KA 1AG1O 3UZ5A 1WBHA 2ONEA 2FH8A 3QQ0A 3CPUA 4A35A 1DXFA 3NQVA 1OZQA 4PCTA 4DJDD 5DXYA 2ZVIA 3M0LA 1P0BA 4FHAA 3QVQA 3AS3A 1B31A 2QUVA 4BF7A 3VCNA 1TPC1 1TE1A 2ZUUA 4A21A 4O4WA 3REQA 2XINA 1VFSA 3TXVA 5E6ZA 4UQDA 2MANA 1KBLA 1KGXA 1UWAA 4K1GA 5AKQA 1H7OA 4W5ZA 4YVPA 1YE4A 3O16A 2BFGA 4QP0A 1VFFA 1WNOA 4W84A 3TSBA 2EPNA 3IIZA 3TWBA 1SQ7A 3VMNA 2NLYA 3W1TA 7ENLA 3VU2A 2BXVA 2ZX7A 2NV9A 5C2XA 3CUGA 1KBJA 2Q8XA 2D2HA 2HE5A 3L0NA 4UMAA 3MSDA 2WLZA 3NOYA 1YDYA 4CQDA 4PB5A 1UA7A 3ZR6A 2ZRUA 2E67A 1KTNA 4AX7A 3ATYA 4XBKA 1XW8A 3WNMA 4XISA 2VFIA 3WMCA 1VYSX 3IVTA 3W83A 2J75A 3PUDA 1DIEA 4F9DA 5DRCA 1ME9A 4Y8FA 4GCAA 4IUGA 1G69A 4UR7A 4PRWA 4R7OA 3RMEA 3U2EA 1K4HA 3LCGA 1PB0A 2NV2A 4Z1YA 1MW3A 4GWEA 2A6LA 2QR6A 1ZP3A 1LRTA 3EWWA 5I3HA 1ISZA 7PTDA 3HFTA 1KCXA 2PC4A 4X0NA 3GSMA 1PE1A 4GVIA 4HNVA 5FACA 3S1GA 1VH7A 2QDDA 1XG3A 1P5BA 1XBXA 3RUBL 3B0XA 1EOKA 2Y63A 3RCYA 4P7QA 3LDVA 4AIBA 5HXMA 3AHTA 2PGEA 5BU9A 2I56A 3CL8A 3TVAA 4GKTA 4Y90A 4EACA 3QGVA 4KFPA 4AD2A 3MSGA 3VOJA 3NOEA 4RDYA 1JDAA 2TYSA 3D6NA 5GPRA 5J5RA 4LC8A 4GMEA 3VUSA 1VBHA 5CG0A 5K4ZA 1R85A 2WNZA 1UYQA 3RIKA 3SUTA 4WDTA 2QULA 4GIYA 3MDUA 1I75A 1CEOA 3BAXA 1FKXA 4DXXA 3W86A 1FFQA 3VXGA 3MUZ1 4B92A 3IJ6A 4RDVA 1R7AA 3M44A 2OLHA 4ADTA 4UXDA 1OJXA 4LV9A 2ZX6A 4HNNA 4AWUA 1HQTA 3FN9A 3SCUA 2GDVA 1C93A 3WL0A 3ARVA 3INPA 2OGJA 3B0VC 4R9XA 4A3YA 1UD5A 4DZ5A 3T55A 1JD7A 4KERA 4C7FA 5FKYA 1E1CA 3UCQA 1EHAA 2JE8A 1Q13A 2OEJA 3R0UA 2NVDA 4LU0A 3EWBX 1J0IA 3GG0A 4DWSB 1BD0A 3E0VA 3IAQA 1LBMA 3DG6A 3W72A 1TG7A 2H9AA 1M7OA 3FHQA 4UWMA 2OODA 2HEJA 3TYEA 3VDHA 4WHBA 3STFA 3FW6A 1HKMA 3BAJA 4ZL1A 1TB3A 3ZSSA 3F5JA 1O66A 1UJPA 3O1NA 5FF3A 1Q6QA 4J3TA 3FKRA