1W1HA

Crystal structure of the pdk1 pleckstrin homology (ph) domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
b'SNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1hA00
1X1GA 1QQGA 5HE0A 3PVLA 1U29A 1J19A 1FAOA 3HW2B 4EKUA 2AL6A 1NTVA 2KUPA 4PQ0A 3AU5A 1K5GB 1DDWA 4ZRIA 4MY6A 4CHJA 2UVMA 4A6FB 3M1IB 1BWNA 2DA0A 5D3VA 1P5TA 3KSYA 3UZTA 2EMSA 3N7CA 4EMOA 4HHVA 1P6SA 1V5MA 1WI1A 1XX0A 4DX90 2D9WA 4HAZB 3SO6A 1WGUA 1GC6A 2NZ8B 1FHOA 3ULBA 2D9XA 1FOEA 2M38A 2FJLA 3TO1A 1KI1B 3MPXA 5CLQB 1LB1A 3TW1A 4HB0B 4XWXA 3SV1A 1DROA 1FHXA 3U8ZA 4DBBA 2D9ZA 2ROZB 2VRWB 2ELAA 1U5DA 1X86A 3A8PA 5FI1A 5FI0A 3P7ZA 2CY5A 4Z2NA 3A8QA 1WJMA 4TKNA 5KQ1A 3AU4A 1N3HA 2R09A 1PMSA 4F7GA 3TVVA 4HAWB 3SNHA 3WA0A 5C5BA 3KY9A 4NSWA 4D0NB 5EFXA 3SYXA 4GMXB 3ODOA 4HAXB 2N0YA 1FGZA 4H8SA 1B55A 4F7UP 2CY4A 3PVWA 2DYQA 3D8FA 2UZSA 2HTHB 4HATB 5GOWB 2K2JA 1WVHA 3O96A 2N23A 2CAYA 3A98B 1EAZA 1EVHA 2J0MA 4MK0A 1QC6A 3OANA 1UPRA 4C0AA 2LG1A 3PZDA 2DN6A 2ROVA 5D3XA 2D4QA 2DHJA 3TCAA 1W1GA 2DKQA 3X23A 2P8VA 1J0WA 2L1CA 2GCJA 2D9YA 4WJ7A 1WGQA 3FM8C 2EJ8A 4WSFA 3WYFB 2MKRA 2DTCA 5DI9B 4MT7A 1OY2A 2YF0A 4IOYX 1NU2A 2L2IA 2MFQA 3DXCA 2W2WA 5J3TA 2D9VA 1V89A 2XQNM 4PNKA 3BJIA 3D8EA 2H7DA 1NI2A 3VOQA 1U5GA 2NMBA 3KZ1A 3PSCA 3CXBB 4DXAB 2EC1A 2Y7BA 1PLSA 4HAVB 4WVFB 3MDBC 4K2OA 2K00A 1XR0B 1BTNA 4A6FA 3NSUA 2LOXA 3P6AA 3ML4A 1X11A 4KVGB 3LJUX 4ZRKA 5C79A 3HK0A 1RRPB 1TXDA 2H7EA 1MAIA 2X18A 1TJ6A 3PG7A 4Z2MB 2DKPA 2GCLA 2YVCA 1AQCA 3ZDTA 4EJNA 3V5WA 2M14A 4GXBA 4YONA 1MK7B 2LYDA 5C5BB 1W1DA 1ZSQA 1MK9B 1U5FA 1I2HA 2OQBA 2Z0QA 4L6EA 5C6RA 1ZC4B 2PZ1A 5HE2A 2J0KA 1DBHA 1GC7A 3DXEA 4F7HA 4GN1A 2P0FA 2BCJA 5CLLB 2I5FA 1ZVRA 1BTKA 2Y8FA 2DLWA 2HE7A 2CODA 2Q13A 2LOZA 2I1JA 1IRSA 5KQ4A 3FSSA 2MWNB 1K5DB 1XD4A 3QWMA 4KHBB 2J0JA 1MKEA 4HB2B 3DXDA 2DX1A 3D8DA 4HAYB 1X05A 2YSZA 1V61A 1UNQA 5L81A 1V88A 4GMVA 4KAXB 4K81A 1RJ2A 2ELBA 5DHFB 1U2BA 2LKOA 3QIJA 1E5WA 1ISNA 1V5PA 2G35A 1TQZA 4HDQA 1I7AA 2KCJA 5KCVA 2YT1A 1U5EA 4NY0A 4GZUA 2P0DA 3GYOA 2YT0A 4A6HA 4CHMA 2ADZA 3FEHA 4DX8A 2Y8GA 1V5UA 2UZRA 3KRXA 1H4RA 1MPHA 2D10A 2RNRB 3BINA 1FHWA 2CRFA 2JP2A 4A6KA 1Z87A 1FGYA 3PEGA 3F0WA 3ZVRA 4K2PA 2QKLA 1XKEA 2EMTA 4ZRJA 2COCA 2P0HA 3VIAA 5LOPB 1H10A 3CIKA 2J59M 2V76A 2YS5A 4A5KA 2RLOA 2DHIA 3HQCA 5C16A 5JP4A 1WG7A 2KGXB 4IFSA 1SGHA 1PFJA 2K2UA 1U27A 3ULCA 2DFKA 2Z0OA 1Y5OA 1ZM0A 3F5RA 1EF1A 2COAA 1GG3A 5D27A 2E2XA 4BBKA 2QKMA 1M7EA 5HE1A 1SHCA 4KHAA 5LONB 5JLJB 3QBVB 4TYZA 2I1KA 2GJYA 2D2QA 4IAPA 2RGNB 1XODA 5JHGA 1P3RA 2VSZA 1UNPA 1MIXA 4YL8A 4CYEA 1LW3A 2IFSA 3ODXA 2I5CA 5D3YA 1W1HA 5HE3A 1BAKA 4GPTB 5DIFB 1Y19B 2VKIA 4P7IA 5J3YA 4K17A 4B6HA 2GS0A 1EGXA 5DHAB 4HAUB 2RSGA 1OQNA 3T06A 1MIZB 1Q67A 3RCPA 2DX5A 2R0DA 2YS3A 2AEHA 4HDOA 2W2XC 2OTXA 1KZGA 3PP2A 2YRYA 2Z0PA 1AWEA 1X1FA 3U7DA 1KZ7A 1DYNA 5JHHA 2W2XD 3PVUA 2RUKB 4HB3B 2DYNA 2MDXA 2D11A 1NTYA 2COFA 3GYPA 1UEFA 3KRWA 1UNRA 3IVFA 1WJ1A 5D3WA 1XCGA 1ZC3B 1DDVA 1M7RA 2IYBA 5J3QA 3G9WA 1OMWA 2ZPYA 3ODWA 1FB8A 2DHKA 3AJ4A 4HB4B 4Y94A 5DH9B 3TFMA 4KHOA 1UPQA 2YS1A 1DDMA 2LULA 2RVBB 3SUZA
chains in the Genus database with same CATH superfamily
1X1GA 1QQGA 5HE0A 3PVLA 5IRSA 1U29A 2KR0A 1J19A 1FAOA 3HW2B 4EKUA 2AL6A 1NTVA 2KUPA 4PQ0A 3AU5A 1K5GB 1DDWA 4ZRIA 4MY6A 2YT2A 4CHJA 2UVMA 4A6FB 3M1IB 1BWNA 2DA0A 5D3VA 1P5TA 3KSYA 3UZTA 2EMSA 3N7CA 3OHMB 4EMOA 4HHVA 1P6SA 1V5MA 1WI1A 1XX0A 3FVCA 4DX90 4QJ4B 2D9WA 4HAZB 3SO6A 1WGUA 1GC6A 2NZ8B 3HSAA 1FHOA 3ULBA 2D9XA 1FOEA 3NWDA 2M38A 2FJLA 3TO1A 1KI1B 2GUMA 3MPXA 5CLQB 1LB1A 3TW1A 4HB0B 4XWXA 3SV1A 2FJUB 1DROA 1FHXA 3U8ZA 1ZYIA 4DBBA 2D9ZA 2ROZB 2VRWB 2ELAA 1U5DA 1X86A 3A8PA 5FI1A 5FI0A 3P7ZA 2CY5A 4Z2NA 3A8QA 1WJMA 4TKNA 5KQ1A 3AU4A 1N3HA 2R09A 1PMSA 4F7GA 3TVVA 4QJ5B 4HAWB 3SNHA 3WA0A 5C5BA 3KY9A 4NSWA 4D0NB 5EFXA 3SYXA 4GMXB 3ODOA 4HAXB 2N0YA 1FGZA 4H8SA 1B55A 4F7UP 2CY4A 3PVWA 2DYQA 3D8FA 2UZSA 2HTHB 4HATB 5GOWB 2K2JA 1WVHA 2RRFA 3O96A 2N23A 2CAYA 3A98B 3NW8A 1EAZA 1EVHA 2J0MA 4MK0A 1QC6A 3OANA 1UPRA 4C0AA 2LG1A 3PZDA 2DN6A 2ROVA 5D3XA 2D4QA 3HIEA 2DHJA 3TCAA 1W1GA 2DKQA 3X23A 2P8VA 3B77A 1J0WA 2L1CA 2GCJA 2D9YA 4WJ7A 1WGQA 3FM8C 2EJ8A 4WSFA 3WYFB 2MKRA 2DTCA 5DI9B 4MT7A 1OY2A 2YF0A 4IOYX 1NU2A 2L2IA 2MFQA 3DXCA 2W2WA 2Z14A 5J3TA 2D9VA 1V89A 2XQNM 4PNKA 3BJIA 3D8EA 2H7DA 1NI2A 3VOQA 1U5GA 2NMBA 2Z13A 3KZ1A 3PSCA 4OT1A 3CXBB 4DXAB 2EC1A 5M4YB 5I2SA 2Y7BA 1PLSA 4HAVB 5LG4B 4WVFB 3MDBC 4K2OA 2K00A 1XR0B 1BTNA 4A6FA 3NSUA 2LOXA 4OSNA 3P6AA 3ML4A 1X11A 4KVGB 3LJUX 2ZKMX 4ZRKA 4DIXA 5C79A 3HK0A 1RRPB 1TXDA 2H7EA 1MAIA 2X18A 1TJ6A 3PG7A 4Z2MB 2DKPA 2GCLA 2YVCA 1AQCA 3ZDTA 4EJNA 4HSIA 3V5WA 2M14A 4GXBA 4YONA 1MK7B 2LYDA 5C5BB 1W1DA 4QXAB 3DCXA 2R2YA 1ZSQA 1MK9B 1U5FA 1I2HA 2OQBA 2Z0QA 4L6EA 5C6RA 1ZC4B 2PZ1A 4QJ3B 5HE2A 2J0KA 1DBHA 1GC7A 3DXEA 4F7HA 4GN1A 2P0FA 2BCJA 5CLLB 2I5FA 1ZVRA 1BTKA 2K49A 2Y8FA 2DLWA 2HE7A 2CODA 2Q13A 2LOZA 2I1JA 1IRSA 5KQ4A 3FSSA 2MWNB 1K5DB 1XD4A 3QWMA 4KHBB 2J0JA 1MKEA 4HB2B 3DXDA 2DX1A 3D8DA 4HAYB 1X05A 2YSZA 1V61A 4GNKB 1UNQA 5L81A 1V88A 4GMVA 4KAXB 4K81A 1RJ2A 2ELBA 2NBVA 5DHFB 1U2BA 2LKOA 3QIJA 1E5WA 1ISNA 1V5PA 2G35A 1TQZA 1MI1A 4HDQA 1I7AA 2KCJA 5KCVA 2YT1A 1U5EA 4NY0A 4GZUA 2P0DA 3GYOA 2Z4DA 3A58A 2YT0A 4A6HA 4CHMA 2ADZA 3FEHA 4DX8A 2Y8GA 1T77A 1V5UA 2UZRA 3KRXA 1H4RA 1MPHA 2D10A 2RNRB 3BINA 1FHWA 2CRFA 2JP2A 4A6KA 1Z87A 1FGYA 3PEGA 3F0WA 3ZVRA 4K2PA 2QKLA 1XKEA 2EMTA 4ZRJA 2COCA 4GOUA 2P0HA 3VIAA 5LOPB 1H10A 3CIKA 2J59M 2V76A 2YS5A 4A5KA 2RLOA 2DHIA 3HQCA 5C16A 5JP4A 1WG7A 2KGXB 4IFSA 1SGHA 1PFJA 2K2UA 1U27A 3ULCA 2DFKA 2Z0OA 2KUQA 1Y5OA 1ZM0A 3F5RA 1EF1A 2COAA 1GG3A 5D27A 2E2XA 2Z59A 4BBKA 3U12A 2QKMA 1M7EA 5HE1A 1SHCA 4KHAA 4CSQA 5LONB 5JLJB 3QBVB 4TYZA 2I1KA 2GJYA 2D2QA 4IAPA 2RGNB 1XODA 5JHGA 5I2MA 1P3RA 2VSZA 1UNPA 1MIXA 4YL8A 4CYEA 1LW3A 2IFSA 3ODXA 2I5CA 5D3YA 1W1HA 5HE3A 1BAKA 4GPTB 5DIFB 2KIEA 1Y19B 2VKIA 4P7IA 4L1RA 5J3YA 4K17A 4B6HA 2GS0A 1EGXA 5DHAB 4HAUB 2RSGA 1OQNA 3T06A 1MIZB 1Q67A 3RCPA 2DX5A 2R0DA 2YS3A 2AEHA 4HDOA 2W2XC 2OTXA 1KZGA 3PP2A 2YRYA 2Z0PA 1AWEA 1X1FA 3U7DA 3NWFA 1KZ7A 1DYNA 5JHHA 2W2XD 3PVUA 2RUKB 4HB3B 2DYNA 2MDXA 2D11A 2K8EA 1NTYA 2COFA 3GYPA 1UEFA 3KRWA 1UNRA 3IVFA 1WJ1A 5D3WA 1XCGA 1ZC3B 1DDVA 1M7RA 2IYBA 5J3QA 4KHBA 3G9WA 1OMWA 2ZPYA 3ODWA 1FB8A 2DHKA 3AJ4A 3NWAA 4HB4B 4Y94A 5DH9B 2KIGA 3TFMA 4D6WA 4KHOA 1UPQA 2YS1A 1DDMA 2LULA 2RVBB 3SUZA
chains in the Genus database with same CATH topology
1X1GA 1QQGA 5HE0A 3PVLA 1U29A 1J19A 1FAOA 3HW2B 4EKUA 2AL6A 1NTVA 2KUPA 4PQ0A 3AU5A 1K5GB 1DDWA 4ZRIA 4MY6A 4CHJA 2UVMA 4A6FB 3M1IB 1BWNA 2DA0A 5D3VA 1P5TA 3KSYA 3UZTA 2EMSA 3N7CA 4EMOA 4HHVA 1P6SA 1V5MA 1WI1A 1XX0A 4DX90 2D9WA 4HAZB 3SO6A 1WGUA 1GC6A 2NZ8B 1FHOA 3ULBA 2D9XA 1FOEA 2M38A 2FJLA 3TO1A 1KI1B 3MPXA 5CLQB 1LB1A 3TW1A 4HB0B 4XWXA 3SV1A 1DROA 1FHXA 3U8ZA 4DBBA 2D9ZA 2ROZB 2VRWB 2ELAA 1U5DA 1X86A 3A8PA 5FI1A 5FI0A 3P7ZA 2CY5A 4Z2NA 3A8QA 1WJMA 4TKNA 5KQ1A 3AU4A 1N3HA 2R09A 1PMSA 4F7GA 3TVVA 4HAWB 3SNHA 3WA0A 5C5BA 3KY9A 4NSWA 4D0NB 5EFXA 3SYXA 4GMXB 3ODOA 4HAXB 2N0YA 1FGZA 4H8SA 1B55A 4F7UP 2CY4A 3PVWA 2DYQA 3D8FA 2UZSA 2HTHB 4HATB 5GOWB 2K2JA 1WVHA 3O96A 2N23A 2CAYA 3A98B 1EAZA 1EVHA 2J0MA 4MK0A 1QC6A 3OANA 1UPRA 4C0AA 2LG1A 3PZDA 2DN6A 2ROVA 5D3XA 2D4QA 2DHJA 3TCAA 1W1GA 2DKQA 3X23A 2P8VA 1J0WA 2L1CA 2GCJA 2D9YA 4WJ7A 1WGQA 3FM8C 2EJ8A 4WSFA 3WYFB 2MKRA 2DTCA 5DI9B 4MT7A 1OY2A 2YF0A 4IOYX 1NU2A 2L2IA 2MFQA 3DXCA 2W2WA 5J3TA 2D9VA 1V89A 2XQNM 4PNKA 3BJIA 3D8EA 2H7DA 1NI2A 3VOQA 1U5GA 2NMBA 3KZ1A 3PSCA 3CXBB 4DXAB 2EC1A 2Y7BA 1PLSA 4HAVB 4WVFB 3MDBC 4K2OA 2K00A 1XR0B 1BTNA 4A6FA 3NSUA 2LOXA 3P6AA 3ML4A 1X11A 4KVGB 3LJUX 4ZRKA 5C79A 3HK0A 1RRPB 1TXDA 2H7EA 1MAIA 2X18A 1TJ6A 3PG7A 4Z2MB 2DKPA 2GCLA 2YVCA 1AQCA 3ZDTA 4EJNA 3V5WA 2M14A 4GXBA 4YONA 1MK7B 2LYDA 5C5BB 1W1DA 1ZSQA 1MK9B 1U5FA 1I2HA 2OQBA 2Z0QA 4L6EA 5C6RA 1ZC4B 2PZ1A 5HE2A 2J0KA 1DBHA 1GC7A 3DXEA 4F7HA 4GN1A 2P0FA 2BCJA 5CLLB 2I5FA 1ZVRA 1BTKA 2Y8FA 2DLWA 2HE7A 2CODA 2Q13A 2LOZA 2I1JA 1IRSA 5KQ4A 3FSSA 2MWNB 1K5DB 1XD4A 3QWMA 4KHBB 2J0JA 1MKEA 4HB2B 3DXDA 2DX1A 3D8DA 4HAYB 1X05A 2YSZA 1V61A 1UNQA 5L81A 1V88A 4GMVA 4KAXB 4K81A 1RJ2A 2ELBA 5DHFB 1U2BA 2LKOA 3QIJA 1E5WA 1ISNA 1V5PA 2G35A 1TQZA 4HDQA 1I7AA 2KCJA 5KCVA 2YT1A 1U5EA 4NY0A 4GZUA 2P0DA 3GYOA 2YT0A 4A6HA 4CHMA 2ADZA 3FEHA 4DX8A 2Y8GA 1V5UA 2UZRA 3KRXA 1H4RA 1MPHA 2D10A 2RNRB 3BINA 1FHWA 2CRFA 2JP2A 4A6KA 1Z87A 1FGYA 3PEGA 3F0WA 3ZVRA 4K2PA 2QKLA 1XKEA 2EMTA 4ZRJA 2COCA 2P0HA 3VIAA 5LOPB 1H10A 3CIKA 2J59M 2V76A 2YS5A 4A5KA 2RLOA 2DHIA 3HQCA 5C16A 5JP4A 1WG7A 2KGXB 4IFSA 1SGHA 1PFJA 2K2UA 1U27A 3ULCA 2DFKA 2Z0OA 1Y5OA 1ZM0A 3F5RA 1EF1A 2COAA 1GG3A 5D27A 2E2XA 4BBKA 2QKMA 1M7EA 5HE1A 1SHCA 4KHAA 5LONB 5JLJB 3QBVB 4TYZA 2I1KA 2GJYA 2D2QA 4IAPA 2RGNB 1XODA 5JHGA 1P3RA 2VSZA 1UNPA 1MIXA 4YL8A 4CYEA 1LW3A 2IFSA 3ODXA 2I5CA 5D3YA 1W1HA 5HE3A 1BAKA 4GPTB 5DIFB 1Y19B 2VKIA 4P7IA 5J3YA 4K17A 4B6HA 2GS0A 1EGXA 5DHAB 4HAUB 2RSGA 1OQNA 3T06A 1MIZB 1Q67A 3RCPA 2DX5A 2R0DA 2YS3A 2AEHA 4HDOA 2W2XC 2OTXA 1KZGA 3PP2A 2YRYA 2Z0PA 1AWEA 1X1FA 3U7DA 1KZ7A 1DYNA 5JHHA 2W2XD 3PVUA 2RUKB 4HB3B 2DYNA 2MDXA 2D11A 1NTYA 2COFA 3GYPA 1UEFA 3KRWA 1UNRA 3IVFA 1WJ1A 5D3WA 1XCGA 1ZC3B 1DDVA 1M7RA 2IYBA 5J3QA 3G9WA 1OMWA 2ZPYA 3ODWA 1FB8A 2DHKA 3AJ4A 4HB4B 4Y94A 5DH9B 3TFMA 4KHOA 1UPQA 2YS1A 1DDMA 2LULA 2RVBB 3SUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X1G A;  1QQG A;  5HE0 A;  3PVL A;  1U29 A;  1J19 A;  1FAO A;  3HW2 B;  4EKU A;  2AL6 A;  1NTV A;  2KUP A;  4PQ0 A;  3AU5 A;  1K5G B;  1DDW A;  4ZRI A;  4MY6 A;  4CHJ A;  2UVM A;  4A6F B;  3M1I B;  1BWN A;  2DA0 A;  5D3V A;  1P5T A;  3KSY A;  3UZT A;  2EMS A;  3N7C A;  4EMO A;  4HHV A;  1P6S A;  1V5M A;  1WI1 A;  1XX0 A;  4DX9 0;  2D9W A;  4HAZ B;  3SO6 A;  1WGU A;  1GC6 A;  2NZ8 B;  1FHO A;  3ULB A;  2D9X A;  1FOE A;  2M38 A;  2FJL A;  3TO1 A;  1KI1 B;  3MPX A;  5CLQ B;  1LB1 A;  3TW1 A;  4HB0 B;  4XWX A;  3SV1 A;  1DRO A;  1FHX A;  3U8Z A;  4DBB A;  2D9Z A;  2ROZ B;  2VRW B;  2ELA A;  1U5D A;  1X86 A;  3A8P A;  5FI1 A;  5FI0 A;  3P7Z A;  2CY5 A;  4Z2N A;  3A8Q A;  1WJM A;  4TKN A;  5KQ1 A;  3AU4 A;  1N3H A;  2R09 A;  1PMS A;  4F7G A;  3TVV A;  4HAW B;  3SNH A;  3WA0 A;  5C5B A;  3KY9 A;  4NSW A;  4D0N B;  5EFX A;  3SYX A;  4GMX B;  3ODO A;  4HAX B;  2N0Y A;  1FGZ A;  4H8S A;  1B55 A;  4F7U P;  2CY4 A;  3PVW A;  2DYQ A;  3D8F A;  2UZS A;  2HTH B;  4HAT B;  5GOW B;  2K2J A;  1WVH A;  3O96 A;  2N23 A;  2CAY A;  3A98 B;  1EAZ A;  1EVH A;  2J0M A;  4MK0 A;  1QC6 A;  3OAN A;  1UPR A;  4C0A A;  2LG1 A;  3PZD A;  2DN6 A;  2ROV A;  5D3X A;  2D4Q A;  2DHJ A;  3TCA A;  1W1G A;  2DKQ A;  3X23 A;  2P8V A;  1J0W A;  2L1C A;  2GCJ A;  2D9Y A;  4WJ7 A;  1WGQ A;  3FM8 C;  2EJ8 A;  4WSF A;  3WYF B;  2MKR A;  2DTC A;  5DI9 B;  4MT7 A;  1OY2 A;  2YF0 A;  4IOY X;  1NU2 A;  2L2I A;  2MFQ A;  3DXC A;  2W2W A;  5J3T A;  2D9V A;  1V89 A;  2XQN M;  4PNK A;  3BJI A;  3D8E A;  2H7D A;  1NI2 A;  3VOQ A;  1U5G A;  2NMB A;  3KZ1 A;  3PSC A;  3CXB B;  4DXA B;  2EC1 A;  2Y7B A;  1PLS A;  4HAV B;  4WVF B;  3MDB C;  4K2O A;  2K00 A;  1XR0 B;  1BTN A;  4A6F A;  3NSU A;  2LOX A;  3P6A A;  3ML4 A;  1X11 A;  4KVG B;  3LJU X;  4ZRK A;  5C79 A;  3HK0 A;  1RRP B;  1TXD A;  2H7E A;  1MAI A;  2X18 A;  1TJ6 A;  3PG7 A;  4Z2M B;  2DKP A;  2GCL A;  2YVC A;  1AQC A;  3ZDT A;  4EJN A;  3V5W A;  2M14 A;  4GXB A;  4YON A;  1MK7 B;  2LYD A;  5C5B B;  1W1D A;  1ZSQ A;  1MK9 B;  1U5F A;  1I2H A;  2OQB A;  2Z0Q A;  4L6E A;  5C6R A;  1ZC4 B;  2PZ1 A;  5HE2 A;  2J0K A;  1DBH A;  1GC7 A;  3DXE A;  4F7H A;  4GN1 A;  2P0F A;  2BCJ A;  5CLL B;  2I5F A;  1ZVR A;  1BTK A;  2Y8F A;  2DLW A;  2HE7 A;  2COD A;  2Q13 A;  2LOZ A;  2I1J A;  1IRS A;  5KQ4 A;  3FSS A;  2MWN B;  1K5D B;  1XD4 A;  3QWM A;  4KHB B;  2J0J A;  1MKE A;  4HB2 B;  3DXD A;  2DX1 A;  3D8D A;  4HAY B;  1X05 A;  2YSZ A;  1V61 A;  1UNQ A;  5L81 A;  1V88 A;  4GMV A;  4KAX B;  4K81 A;  1RJ2 A;  2ELB A;  5DHF B;  1U2B A;  2LKO A;  3QIJ A;  1E5W A;  1ISN A;  1V5P A;  2G35 A;  1TQZ A;  4HDQ A;  1I7A A;  2KCJ A;  5KCV A;  2YT1 A;  1U5E A;  4NY0 A;  4GZU A;  2P0D A;  3GYO A;  2YT0 A;  4A6H A;  4CHM A;  2ADZ A;  3FEH A;  4DX8 A;  2Y8G A;  1V5U A;  2UZR A;  3KRX A;  1H4R A;  1MPH A;  2D10 A;  2RNR B;  3BIN A;  1FHW A;  2CRF A;  2JP2 A;  4A6K A;  1Z87 A;  1FGY A;  3PEG A;  3F0W A;  3ZVR A;  4K2P A;  2QKL A;  1XKE A;  2EMT A;  4ZRJ A;  2COC A;  2P0H A;  3VIA A;  5LOP B;  1H10 A;  3CIK A;  2J59 M;  2V76 A;  2YS5 A;  4A5K A;  2RLO A;  2DHI A;  3HQC A;  5C16 A;  5JP4 A;  1WG7 A;  2KGX B;  4IFS A;  1SGH A;  1PFJ A;  2K2U A;  1U27 A;  3ULC A;  2DFK A;  2Z0O A;  1Y5O A;  1ZM0 A;  3F5R A;  1EF1 A;  2COA A;  1GG3 A;  5D27 A;  2E2X A;  4BBK A;  2QKM A;  1M7E A;  5HE1 A;  1SHC A;  4KHA A;  5LON B;  5JLJ B;  3QBV B;  4TYZ A;  2I1K A;  2GJY A;  2D2Q A;  4IAP A;  2RGN B;  1XOD A;  5JHG A;  1P3R A;  2VSZ A;  1UNP A;  1MIX A;  4YL8 A;  4CYE A;  1LW3 A;  2IFS A;  3ODX A;  2I5C A;  5D3Y A;  1W1H A;  5HE3 A;  1BAK A;  4GPT B;  5DIF B;  1Y19 B;  2VKI A;  4P7I A;  5J3Y A;  4K17 A;  4B6H A;  2GS0 A;  1EGX A;  5DHA B;  4HAU B;  2RSG A;  1OQN A;  3T06 A;  1MIZ B;  1Q67 A;  3RCP A;  2DX5 A;  2R0D A;  2YS3 A;  2AEH A;  4HDO A;  2W2X C;  2OTX A;  1KZG A;  3PP2 A;  2YRY A;  2Z0P A;  1AWE A;  1X1F A;  3U7D A;  1KZ7 A;  1DYN A;  5JHH A;  2W2X D;  3PVU A;  2RUK B;  4HB3 B;  2DYN A;  2MDX A;  2D11 A;  1NTY A;  2COF A;  3GYP A;  1UEF A;  3KRW A;  1UNR A;  3IVF A;  1WJ1 A;  5D3W A;  1XCG A;  1ZC3 B;  1DDV A;  1M7R A;  2IYB A;  5J3Q A;  3G9W A;  1OMW A;  2ZPY A;  3ODW A;  1FB8 A;  2DHK A;  3AJ4 A;  4HB4 B;  4Y94 A;  5DH9 B;  3TFM A;  4KHO A;  1UPQ A;  2YS1 A;  1DDM A;  2LUL A;  2RVB B;  3SUZ A; 
#chains in the Genus database with same CATH topology
 1X1G A;  1QQG A;  5HE0 A;  3PVL A;  5IRS A;  1U29 A;  2KR0 A;  1J19 A;  1FAO A;  3HW2 B;  4EKU A;  2AL6 A;  1NTV A;  2KUP A;  4PQ0 A;  3AU5 A;  1K5G B;  1DDW A;  4ZRI A;  4MY6 A;  2YT2 A;  4CHJ A;  2UVM A;  4A6F B;  3M1I B;  1BWN A;  2DA0 A;  5D3V A;  1P5T A;  3KSY A;  3UZT A;  2EMS A;  3N7C A;  3OHM B;  4EMO A;  4HHV A;  1P6S A;  1V5M A;  1WI1 A;  1XX0 A;  3FVC A;  4DX9 0;  4QJ4 B;  2D9W A;  4HAZ B;  3SO6 A;  1WGU A;  1GC6 A;  2NZ8 B;  3HSA A;  1FHO A;  3ULB A;  2D9X A;  1FOE A;  3NWD A;  2M38 A;  2FJL A;  3TO1 A;  1KI1 B;  2GUM A;  3MPX A;  5CLQ B;  1LB1 A;  3TW1 A;  4HB0 B;  4XWX A;  3SV1 A;  2FJU B;  1DRO A;  1FHX A;  3U8Z A;  1ZYI A;  4DBB A;  2D9Z A;  2ROZ B;  2VRW B;  2ELA A;  1U5D A;  1X86 A;  3A8P A;  5FI1 A;  5FI0 A;  3P7Z A;  2CY5 A;  4Z2N A;  3A8Q A;  1WJM A;  4TKN A;  5KQ1 A;  3AU4 A;  1N3H A;  2R09 A;  1PMS A;  4F7G A;  3TVV A;  4QJ5 B;  4HAW B;  3SNH A;  3WA0 A;  5C5B A;  3KY9 A;  4NSW A;  4D0N B;  5EFX A;  3SYX A;  4GMX B;  3ODO A;  4HAX B;  2N0Y A;  1FGZ A;  4H8S A;  1B55 A;  4F7U P;  2CY4 A;  3PVW A;  2DYQ A;  3D8F A;  2UZS A;  2HTH B;  4HAT B;  5GOW B;  2K2J A;  1WVH A;  2RRF A;  3O96 A;  2N23 A;  2CAY A;  3A98 B;  3NW8 A;  1EAZ A;  1EVH A;  2J0M A;  4MK0 A;  1QC6 A;  3OAN A;  1UPR A;  4C0A A;  2LG1 A;  3PZD A;  2DN6 A;  2ROV A;  5D3X A;  2D4Q A;  3HIE A;  2DHJ A;  3TCA A;  1W1G A;  2DKQ A;  3X23 A;  2P8V A;  3B77 A;  1J0W A;  2L1C A;  2GCJ A;  2D9Y A;  4WJ7 A;  1WGQ A;  3FM8 C;  2EJ8 A;  4WSF A;  3WYF B;  2MKR A;  2DTC A;  5DI9 B;  4MT7 A;  1OY2 A;  2YF0 A;  4IOY X;  1NU2 A;  2L2I A;  2MFQ A;  3DXC A;  2W2W A;  2Z14 A;  5J3T A;  2D9V A;  1V89 A;  2XQN M;  4PNK A;  3BJI A;  3D8E A;  2H7D A;  1NI2 A;  3VOQ A;  1U5G A;  2NMB A;  2Z13 A;  3KZ1 A;  3PSC A;  4OT1 A;  3CXB B;  4DXA B;  2EC1 A;  5M4Y B;  5I2S A;  2Y7B A;  1PLS A;  4HAV B;  5LG4 B;  4WVF B;  3MDB C;  4K2O A;  2K00 A;  1XR0 B;  1BTN A;  4A6F A;  3NSU A;  2LOX A;  4OSN A;  3P6A A;  3ML4 A;  1X11 A;  4KVG B;  3LJU X;  2ZKM X;  4ZRK A;  4DIX A;  5C79 A;  3HK0 A;  1RRP B;  1TXD A;  2H7E A;  1MAI A;  2X18 A;  1TJ6 A;  3PG7 A;  4Z2M B;  2DKP A;  2GCL A;  2YVC A;  1AQC A;  3ZDT A;  4EJN A;  4HSI A;  3V5W A;  2M14 A;  4GXB A;  4YON A;  1MK7 B;  2LYD A;  5C5B B;  1W1D A;  4QXA B;  3DCX A;  2R2Y A;  1ZSQ A;  1MK9 B;  1U5F A;  1I2H A;  2OQB A;  2Z0Q A;  4L6E A;  5C6R A;  1ZC4 B;  2PZ1 A;  4QJ3 B;  5HE2 A;  2J0K A;  1DBH A;  1GC7 A;  3DXE A;  4F7H A;  4GN1 A;  2P0F A;  2BCJ A;  5CLL B;  2I5F A;  1ZVR A;  1BTK A;  2K49 A;  2Y8F A;  2DLW A;  2HE7 A;  2COD A;  2Q13 A;  2LOZ A;  2I1J A;  1IRS A;  5KQ4 A;  3FSS A;  2MWN B;  1K5D B;  1XD4 A;  3QWM A;  4KHB B;  2J0J A;  1MKE A;  4HB2 B;  3DXD A;  2DX1 A;  3D8D A;  4HAY B;  1X05 A;  2YSZ A;  1V61 A;  4GNK B;  1UNQ A;  5L81 A;  1V88 A;  4GMV A;  4KAX B;  4K81 A;  1RJ2 A;  2ELB A;  2NBV A;  5DHF B;  1U2B A;  2LKO A;  3QIJ A;  1E5W A;  1ISN A;  1V5P A;  2G35 A;  1TQZ A;  1MI1 A;  4HDQ A;  1I7A A;  2KCJ A;  5KCV A;  2YT1 A;  1U5E A;  4NY0 A;  4GZU A;  2P0D A;  3GYO A;  2Z4D A;  3A58 A;  2YT0 A;  4A6H A;  4CHM A;  2ADZ A;  3FEH A;  4DX8 A;  2Y8G A;  1T77 A;  1V5U A;  2UZR A;  3KRX A;  1H4R A;  1MPH A;  2D10 A;  2RNR B;  3BIN A;  1FHW A;  2CRF A;  2JP2 A;  4A6K A;  1Z87 A;  1FGY A;  3PEG A;  3F0W A;  3ZVR A;  4K2P A;  2QKL A;  1XKE A;  2EMT A;  4ZRJ A;  2COC A;  4GOU A;  2P0H A;  3VIA A;  5LOP B;  1H10 A;  3CIK A;  2J59 M;  2V76 A;  2YS5 A;  4A5K A;  2RLO A;  2DHI A;  3HQC A;  5C16 A;  5JP4 A;  1WG7 A;  2KGX B;  4IFS A;  1SGH A;  1PFJ A;  2K2U A;  1U27 A;  3ULC A;  2DFK A;  2Z0O A;  2KUQ A;  1Y5O A;  1ZM0 A;  3F5R A;  1EF1 A;  2COA A;  1GG3 A;  5D27 A;  2E2X A;  2Z59 A;  4BBK A;  3U12 A;  2QKM A;  1M7E A;  5HE1 A;  1SHC A;  4KHA A;  4CSQ A;  5LON B;  5JLJ B;  3QBV B;  4TYZ A;  2I1K A;  2GJY A;  2D2Q A;  4IAP A;  2RGN B;  1XOD A;  5JHG A;  5I2M A;  1P3R A;  2VSZ A;  1UNP A;  1MIX A;  4YL8 A;  4CYE A;  1LW3 A;  2IFS A;  3ODX A;  2I5C A;  5D3Y A;  1W1H A;  5HE3 A;  1BAK A;  4GPT B;  5DIF B;  2KIE A;  1Y19 B;  2VKI A;  4P7I A;  4L1R A;  5J3Y A;  4K17 A;  4B6H A;  2GS0 A;  1EGX A;  5DHA B;  4HAU B;  2RSG A;  1OQN A;  3T06 A;  1MIZ B;  1Q67 A;  3RCP A;  2DX5 A;  2R0D A;  2YS3 A;  2AEH A;  4HDO A;  2W2X C;  2OTX A;  1KZG A;  3PP2 A;  2YRY A;  2Z0P A;  1AWE A;  1X1F A;  3U7D A;  3NWF A;  1KZ7 A;  1DYN A;  5JHH A;  2W2X D;  3PVU A;  2RUK B;  4HB3 B;  2DYN A;  2MDX A;  2D11 A;  2K8E A;  1NTY A;  2COF A;  3GYP A;  1UEF A;  3KRW A;  1UNR A;  3IVF A;  1WJ1 A;  5D3W A;  1XCG A;  1ZC3 B;  1DDV A;  1M7R A;  2IYB A;  5J3Q A;  4KHB A;  3G9W A;  1OMW A;  2ZPY A;  3ODW A;  1FB8 A;  2DHK A;  3AJ4 A;  3NWA A;  4HB4 B;  4Y94 A;  5DH9 B;  2KIG A;  3TFM A;  4D6W A;  4KHO A;  1UPQ A;  2YS1 A;  1DDM A;  2LUL A;  2RVB B;  3SUZ A; 
#chains in the Genus database with same CATH homology
 1X1G A;  1QQG A;  5HE0 A;  3PVL A;  1U29 A;  1J19 A;  1FAO A;  3HW2 B;  4EKU A;  2AL6 A;  1NTV A;  2KUP A;  4PQ0 A;  3AU5 A;  1K5G B;  1DDW A;  4ZRI A;  4MY6 A;  4CHJ A;  2UVM A;  4A6F B;  3M1I B;  1BWN A;  2DA0 A;  5D3V A;  1P5T A;  3KSY A;  3UZT A;  2EMS A;  3N7C A;  4EMO A;  4HHV A;  1P6S A;  1V5M A;  1WI1 A;  1XX0 A;  4DX9 0;  2D9W A;  4HAZ B;  3SO6 A;  1WGU A;  1GC6 A;  2NZ8 B;  1FHO A;  3ULB A;  2D9X A;  1FOE A;  2M38 A;  2FJL A;  3TO1 A;  1KI1 B;  3MPX A;  5CLQ B;  1LB1 A;  3TW1 A;  4HB0 B;  4XWX A;  3SV1 A;  1DRO A;  1FHX A;  3U8Z A;  4DBB A;  2D9Z A;  2ROZ B;  2VRW B;  2ELA A;  1U5D A;  1X86 A;  3A8P A;  5FI1 A;  5FI0 A;  3P7Z A;  2CY5 A;  4Z2N A;  3A8Q A;  1WJM A;  4TKN A;  5KQ1 A;  3AU4 A;  1N3H A;  2R09 A;  1PMS A;  4F7G A;  3TVV A;  4HAW B;  3SNH A;  3WA0 A;  5C5B A;  3KY9 A;  4NSW A;  4D0N B;  5EFX A;  3SYX A;  4GMX B;  3ODO A;  4HAX B;  2N0Y A;  1FGZ A;  4H8S A;  1B55 A;  4F7U P;  2CY4 A;  3PVW A;  2DYQ A;  3D8F A;  2UZS A;  2HTH B;  4HAT B;  5GOW B;  2K2J A;  1WVH A;  3O96 A;  2N23 A;  2CAY A;  3A98 B;  1EAZ A;  1EVH A;  2J0M A;  4MK0 A;  1QC6 A;  3OAN A;  1UPR A;  4C0A A;  2LG1 A;  3PZD A;  2DN6 A;  2ROV A;  5D3X A;  2D4Q A;  2DHJ A;  3TCA A;  1W1G A;  2DKQ A;  3X23 A;  2P8V A;  1J0W A;  2L1C A;  2GCJ A;  2D9Y A;  4WJ7 A;  1WGQ A;  3FM8 C;  2EJ8 A;  4WSF A;  3WYF B;  2MKR A;  2DTC A;  5DI9 B;  4MT7 A;  1OY2 A;  2YF0 A;  4IOY X;  1NU2 A;  2L2I A;  2MFQ A;  3DXC A;  2W2W A;  5J3T A;  2D9V A;  1V89 A;  2XQN M;  4PNK A;  3BJI A;  3D8E A;  2H7D A;  1NI2 A;  3VOQ A;  1U5G A;  2NMB A;  3KZ1 A;  3PSC A;  3CXB B;  4DXA B;  2EC1 A;  2Y7B A;  1PLS A;  4HAV B;  4WVF B;  3MDB C;  4K2O A;  2K00 A;  1XR0 B;  1BTN A;  4A6F A;  3NSU A;  2LOX A;  3P6A A;  3ML4 A;  1X11 A;  4KVG B;  3LJU X;  4ZRK A;  5C79 A;  3HK0 A;  1RRP B;  1TXD A;  2H7E A;  1MAI A;  2X18 A;  1TJ6 A;  3PG7 A;  4Z2M B;  2DKP A;  2GCL A;  2YVC A;  1AQC A;  3ZDT A;  4EJN A;  3V5W A;  2M14 A;  4GXB A;  4YON A;  1MK7 B;  2LYD A;  5C5B B;  1W1D A;  1ZSQ A;  1MK9 B;  1U5F A;  1I2H A;  2OQB A;  2Z0Q A;  4L6E A;  5C6R A;  1ZC4 B;  2PZ1 A;  5HE2 A;  2J0K A;  1DBH A;  1GC7 A;  3DXE A;  4F7H A;  4GN1 A;  2P0F A;  2BCJ A;  5CLL B;  2I5F A;  1ZVR A;  1BTK A;  2Y8F A;  2DLW A;  2HE7 A;  2COD A;  2Q13 A;  2LOZ A;  2I1J A;  1IRS A;  5KQ4 A;  3FSS A;  2MWN B;  1K5D B;  1XD4 A;  3QWM A;  4KHB B;  2J0J A;  1MKE A;  4HB2 B;  3DXD A;  2DX1 A;  3D8D A;  4HAY B;  1X05 A;  2YSZ A;  1V61 A;  1UNQ A;  5L81 A;  1V88 A;  4GMV A;  4KAX B;  4K81 A;  1RJ2 A;  2ELB A;  5DHF B;  1U2B A;  2LKO A;  3QIJ A;  1E5W A;  1ISN A;  1V5P A;  2G35 A;  1TQZ A;  4HDQ A;  1I7A A;  2KCJ A;  5KCV A;  2YT1 A;  1U5E A;  4NY0 A;  4GZU A;  2P0D A;  3GYO A;  2YT0 A;  4A6H A;  4CHM A;  2ADZ A;  3FEH A;  4DX8 A;  2Y8G A;  1V5U A;  2UZR A;  3KRX A;  1H4R A;  1MPH A;  2D10 A;  2RNR B;  3BIN A;  1FHW A;  2CRF A;  2JP2 A;  4A6K A;  1Z87 A;  1FGY A;  3PEG A;  3F0W A;  3ZVR A;  4K2P A;  2QKL A;  1XKE A;  2EMT A;  4ZRJ A;  2COC A;  2P0H A;  3VIA A;  5LOP B;  1H10 A;  3CIK A;  2J59 M;  2V76 A;  2YS5 A;  4A5K A;  2RLO A;  2DHI A;  3HQC A;  5C16 A;  5JP4 A;  1WG7 A;  2KGX B;  4IFS A;  1SGH A;  1PFJ A;  2K2U A;  1U27 A;  3ULC A;  2DFK A;  2Z0O A;  1Y5O A;  1ZM0 A;  3F5R A;  1EF1 A;  2COA A;  1GG3 A;  5D27 A;  2E2X A;  4BBK A;  2QKM A;  1M7E A;  5HE1 A;  1SHC A;  4KHA A;  5LON B;  5JLJ B;  3QBV B;  4TYZ A;  2I1K A;  2GJY A;  2D2Q A;  4IAP A;  2RGN B;  1XOD A;  5JHG A;  1P3R A;  2VSZ A;  1UNP A;  1MIX A;  4YL8 A;  4CYE A;  1LW3 A;  2IFS A;  3ODX A;  2I5C A;  5D3Y A;  1W1H A;  5HE3 A;  1BAK A;  4GPT B;  5DIF B;  1Y19 B;  2VKI A;  4P7I A;  5J3Y A;  4K17 A;  4B6H A;  2GS0 A;  1EGX A;  5DHA B;  4HAU B;  2RSG A;  1OQN A;  3T06 A;  1MIZ B;  1Q67 A;  3RCP A;  2DX5 A;  2R0D A;  2YS3 A;  2AEH A;  4HDO A;  2W2X C;  2OTX A;  1KZG A;  3PP2 A;  2YRY A;  2Z0P A;  1AWE A;  1X1F A;  3U7D A;  1KZ7 A;  1DYN A;  5JHH A;  2W2X D;  3PVU A;  2RUK B;  4HB3 B;  2DYN A;  2MDX A;  2D11 A;  1NTY A;  2COF A;  3GYP A;  1UEF A;  3KRW A;  1UNR A;  3IVF A;  1WJ1 A;  5D3W A;  1XCG A;  1ZC3 B;  1DDV A;  1M7R A;  2IYB A;  5J3Q A;  3G9W A;  1OMW A;  2ZPY A;  3ODW A;  1FB8 A;  2DHK A;  3AJ4 A;  4HB4 B;  4Y94 A;  5DH9 B;  3TFM A;  4KHO A;  1UPQ A;  2YS1 A;  1DDM A;  2LUL A;  2RVB B;  3SUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...