1W1HA

Crystal structure of the pdk1 pleckstrin homology (ph) domain
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
147
structure length
147
Chain Sequence
SNIEQYIHDLDSNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights Into the Regulation of Pdk1 by Phosphoinositides and Inositol Phosphates
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
total genus 39
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14593 PH_3 PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 1w1hA00
1U5DA 4WJ7A 5D3VA 4MT7A 4PQ0A 1ZVRA 4HB4B 3LJUX 2Y7BA 2E2XA 2DKPA 3FSSA 4HAUB 2M14A 2P0DA 3PEGA 1BTKA 4GN1A 2J0KA 5KCVA 1SGHA 1K5GB 1FAOA 4H8SA 3QIJA 4YL8A 1K5DB 1XKEA 2VRWB 4YONA 1V89A 1Y5OA 2EC1A 1V88A 2ROZB 1UNRA 2ROVA 3MPXA 4DXAB 2DTCA 2AEHA 2GS0A 3IVFA 4HAWB 3TVVA 4TYZA 4A6KA 3FM8C 3T06A 2ELBA 2KCJA 1E5WA 1X05A 1ZSQA 3UZTA 2X18A 1UNPA 4IAPA 4A6HA 2D9ZA 3PVUA 5C16A 4KAXB 1P3RA 2DYQA 5CLLB 5J3YA 3PVWA 1WVHA 5JP4A 4HAXB 2N0YA 1J0WA 4C0AA 4XWXA 2MKRA 2COAA 2RSGA 1H4RA 4MY6A 4HAZB 3KZ1A 5FI0A 5L81A 2D2QA 4MK0A 2V76A 2YVCA 1I7AA 2EMSA 2MWNB 3PG7A 4GPTB 2H7EA 4HB2B 2W2WA 2CY5A 2YS3A 2AL6A 2ADZA 4GMXB 2UZRA 1XODA 5D3WA 2DHIA 4KHBB 3SO6A 1P6SA 1X1GA 5HE1A 4HB0B 4L6EA 5KQ4A 2CODA 2DA0A 2Z0OA 1XCGA 1MKEA 5C6RA 2PZ1A 1W1DA 3KRWA 2KGXB 4ZRKA 2P8VA 3KRXA 2LYDA 2YT1A 4EJNA 3TCAA 3AU5A 4KVGB 2VSZA 4A6FB 3PVLA 3ML4A 3P7ZA 1DDVA 1QC6A 3FEHA 1X86A 2RGNB 1EAZA 2DHJA 3HQCA 1FGZA 4HAYB 2CY4A 3BINA 3ODWA 4ZRJA 1SHCA 4IOYX 1DDMA 1FHXA 1DDWA 3NSUA 2D9VA 4K2OA 4F7UP 1ZM0A 1BWNA 2Y8FA 2I1JA 1DYNA 4DBBA 1U27A 2YSZA 1N3HA 1XD4A 4WVFB 1TQZA 4HHVA 4BBKA 5JLJB 3QWMA 4KHOA 5HE0A 4EKUA 2COCA 3TW1A 5HE2A 1MK9B 5KQ1A 2DKQA 2DX1A 1H10A 1X1FA 3SNHA 1EF1A 2DN6A 4NSWA 3A8QA 3F0WA 3QBVB 3DXDA 3VIAA 2DLWA 2Q13A 3ODOA 1ZC3B 2RLOA 4HATB 1DROA 2DHKA 5DH9B 2NMBA 3A8PA 3DXEA 1GG3A 1BTNA 1X11A 1MK7B 5JHGA 3D8FA 2IFSA 1FHWA 1OMWA 1WGUA 1B55A 1V5MA 4EMOA 1Q67A 2UVMA 2VKIA 2RVBB 2DYNA 2R09A 3M1IB 1BAKA 1EGXA 1Y19B 1W1GA 3AU4A 2D4QA 2W2XD 1V5PA 4HDOA 2UZSA 4HAVB 2W2XC 3CIKA 2D10A 3GYPA 1KZ7A 3WYFB 1PLSA 5JHHA 5C79A 3MDBC 4D0NB 3HW2B 1WJ1A 3ZDTA 1WG7A 2LKOA 4KHAA 3VOQA 2M38A 4A6FA 5CLQB 1TXDA 3CXBB 1Z87A 5LOPB 1P5TA 4P7IA 4GMVA 4IFSA 4ZRIA 1MPHA 5LONB 2EJ8A 2HE7A 3HK0A 1J19A 5FI1A 2CRFA 2GCJA 4K2PA 5HE3A 1PMSA 2RUKB 4HB3B 1U5GA 1ZC4B 1U5EA 1NI2A 2L1CA 3PP2A 3WA0A 3PSCA 3N7CA 4DX8A 4Z2MB 4WSFA 2J59M 2LOXA 2N23A 2YT0A 2KUPA 1NU2A 3TO1A 2P0FA 1EVHA 4DX90 2NZ8B 2LULA 3TFMA 2GCLA 2OQBA 4K17A 4GZUA 1WI1A 1UEFA 1MAIA 2J0JA 1OQNA 4TKNA 2R0DA 3KY9A 4A5KA 3ULBA 1LW3A 2EMTA 1V5UA 1IRSA 2QKLA 2HTHB 4CHMA 2LOZA 1M7RA 3RCPA 3DXCA 2P0HA 3SV1A 3G9WA 2GJYA 2MFQA 3AJ4A 1U5FA 2H7DA 1M7EA 2J0MA 1FHOA 3ZVRA 2YS1A 2YS5A 2I5CA 2DX5A 5EFXA 4NY0A 1FB8A 4F7GA 1MIZB 2MDXA 3GYOA 4B6HA 1AQCA 5D3YA 2D9WA 2IYBA 2FJLA 1GC7A 3OANA 1UPQA 3A98B 2K00A 1OY2A 2JP2A 2OTXA 3F5RA 2I5FA 1AWEA 2L2IA 1ISNA 2LG1A 3KSYA 3PZDA 2DFKA 1LB1A 3ODXA 4Y94A 2Z0QA 2Y8GA 1PFJA 2CAYA 5DIFB 1MIXA 2K2JA 1KI1B 3X23A 2RNRB 1FGYA 3D8EA 5C5BA 1TJ6A 5DHAB 4GXBA 1UPRA 2D11A 4CYEA 1RRPB 4CHJA 5J3QA 1W1HA 5J3TA 2I1KA 1RJ2A 3V5WA 2G35A 1QQGA 2YRYA 1NTVA 1DBHA 2XQNM 1KZGA 2K2UA 3D8DA 5DHFB 4Z2NA 3O96A 3U7DA 1U29A 3SUZA 2ELAA 1U2BA 5D27A 4PNKA 1NTYA 1GC6A 3BJIA 2D9YA 2QKMA 3P6AA 1WGQA 1XX0A 1XR0B 5GOWB 1FOEA 3ULCA 2ZPYA 4HDQA 1I2HA 2D9XA 3U8ZA 4K81A 2COFA 2Z0PA 5C5BB 2YF0A 1WJMA 5D3XA 2BCJA 5DI9B 1V61A 3SYXA 4F7HA 1UNQA
chains in the Genus database with same CATH superfamily
1U5DA 4WJ7A 5D3VA 4MT7A 4PQ0A 1ZVRA 4HB4B 3LJUX 2Y7BA 1MI1A 2E2XA 2DKPA 3FSSA 4HAUB 2M14A 2P0DA 3PEGA 1BTKA 4GN1A 2J0KA 5KCVA 1SGHA 1K5GB 4DIXA 1FAOA 4H8SA 3QIJA 4YL8A 4QJ4B 1K5DB 1XKEA 2VRWB 4YONA 1V89A 1Y5OA 2EC1A 1V88A 2ROZB 1UNRA 2ROVA 3MPXA 4DXAB 2DTCA 2KIEA 2AEHA 2GS0A 3FVCA 3IVFA 4HAWB 3TVVA 4TYZA 4A6KA 3FM8C 3T06A 2ELBA 2KCJA 1E5WA 1X05A 1ZSQA 3UZTA 2X18A 1UNPA 4IAPA 2YT2A 2ZKMX 2KUQA 2D9ZA 3PVUA 4A6HA 5C16A 4KAXB 1P3RA 2DYQA 5CLLB 4GNKB 5J3YA 3PVWA 1WVHA 5JP4A 4HAXB 2N0YA 1T77A 2Z59A 1J0WA 4C0AA 4XWXA 2MKRA 2COAA 2RSGA 1H4RA 4MY6A 4HAZB 3KZ1A 5FI0A 5L81A 2D2QA 4MK0A 2V76A 2Z14A 2YVCA 1I7AA 2EMSA 2MWNB 3PG7A 4GPTB 2H7EA 2W2WA 4HB2B 2CY5A 2YS3A 3B77A 2AL6A 2ADZA 4GMXB 2UZRA 1XODA 2RRFA 5D3WA 2DHIA 4KHBB 3SO6A 1P6SA 1X1GA 3A58A 5HE1A 4HB0B 4L6EA 5KQ4A 2CODA 2DA0A 2Z0OA 2KIGA 1XCGA 1MKEA 5C6RA 2PZ1A 1W1DA 3KRWA 2KGXB 4ZRKA 2P8VA 3KRXA 2LYDA 2YT1A 4EJNA 3TCAA 3AU5A 4KVGB 2VSZA 4A6FB 3PVLA 3ML4A 3P7ZA 1DDVA 1QC6A 3FEHA 1X86A 2RGNB 1EAZA 2DHJA 3HQCA 1FGZA 4HAYB 2CY4A 3BINA 3ODWA 4ZRJA 1SHCA 4IOYX 2NBVA 1DDMA 1FHXA 1DDWA 3NSUA 2D9VA 4K2OA 4F7UP 1ZM0A 2R2YA 1BWNA 2Y8FA 1ZYIA 2I1JA 1DYNA 4DBBA 1U27A 2YSZA 1N3HA 1XD4A 4WVFB 4L1RA 1TQZA 5I2MA 4HHVA 4BBKA 5JLJB 3QWMA 4KHOA 5HE0A 4EKUA 2COCA 3TW1A 5HE2A 1MK9B 2K8EA 5KQ1A 2DKQA 2DX1A 1H10A 1X1FA 3SNHA 5IRSA 1EF1A 2DN6A 4NSWA 3A8QA 3F0WA 3QBVB 3DXDA 3VIAA 2DLWA 2Q13A 3ODOA 1ZC3B 2RLOA 4HATB 1DROA 2DHKA 5DH9B 2NMBA 3A8PA 3DXEA 5LG4B 1GG3A 1BTNA 1X11A 1MK7B 5JHGA 3D8FA 2IFSA 1FHWA 1OMWA 1WGUA 1B55A 3NWFA 1V5MA 4EMOA 1Q67A 2UVMA 2VKIA 2RVBB 2DYNA 2R09A 3M1IB 1BAKA 1EGXA 1Y19B 1W1GA 3AU4A 2D4QA 2W2XD 1V5PA 4HDOA 2UZSA 4HAVB 2W2XC 3CIKA 2D10A 3GYPA 2Z13A 1KZ7A 3WYFB 1PLSA 5JHHA 5C79A 3MDBC 2GUMA 4D0NB 3HW2B 1WJ1A 3ZDTA 1WG7A 2LKOA 4KHAA 3VOQA 2M38A 4A6FA 5CLQB 5I2SA 1TXDA 4QXAB 3CXBB 1Z87A 5LOPB 1P5TA 4P7IA 4GMVA 4IFSA 4ZRIA 1MPHA 5LONB 2EJ8A 2HE7A 3HK0A 1J19A 5FI1A 2CRFA 2GCJA 4K2PA 5HE3A 1PMSA 2RUKB 4HB3B 1U5GA 1ZC4B 1U5EA 1NI2A 2L1CA 3HSAA 4OT1A 2Z4DA 3PP2A 3WA0A 3PSCA 3N7CA 4DX8A 4Z2MB 4WSFA 2J59M 2LOXA 3NWAA 2N23A 2YT0A 2KUPA 1NU2A 3TO1A 2P0FA 1EVHA 4DX90 2NZ8B 2LULA 3TFMA 2GCLA 2OQBA 3NWDA 4K17A 4GZUA 1WI1A 1UEFA 3DCXA 1MAIA 2J0JA 1OQNA 4TKNA 2R0DA 3KY9A 4A5KA 3ULBA 1LW3A 2EMTA 1V5UA 4QJ5B 1IRSA 2QKLA 2HTHB 2FJUB 5M4YB 4CHMA 2LOZA 1M7RA 3RCPA 3DXCA 2P0HA 3SV1A 3G9WA 2GJYA 2MFQA 3AJ4A 1U5FA 2H7DA 1M7EA 2J0MA 1FHOA 3ZVRA 2YS1A 2YS5A 2I5CA 3HIEA 2DX5A 5EFXA 4NY0A 1FB8A 4F7GA 1MIZB 2MDXA 3GYOA 4B6HA 1AQCA 5D3YA 2D9WA 2IYBA 2FJLA 1GC7A 3OANA 1UPQA 3A98B 2K00A 1OY2A 4GOUA 2JP2A 2OTXA 3F5RA 2I5FA 1AWEA 2L2IA 1ISNA 2LG1A 3KSYA 4QJ3B 3PZDA 2DFKA 1LB1A 3ODXA 4Y94A 2Z0QA 2Y8GA 1PFJA 2CAYA 5DIFB 1MIXA 2K2JA 1KI1B 3X23A 2KR0A 4CSQA 2RNRB 1FGYA 3D8EA 5C5BA 1TJ6A 5DHAB 4GXBA 1UPRA 2D11A 4CYEA 1RRPB 4CHJA 5J3QA 1W1HA 5J3TA 3U12A 2I1KA 4HSIA 1RJ2A 3V5WA 2G35A 1QQGA 2YRYA 1NTVA 1DBHA 2XQNM 1KZGA 2K2UA 3D8DA 5DHFB 4D6WA 4Z2NA 3O96A 3U7DA 1U29A 3SUZA 2ELAA 1U2BA 5D27A 4PNKA 1NTYA 1GC6A 3BJIA 2D9YA 2QKMA 3P6AA 1WGQA 1XX0A 1XR0B 2K49A 1FOEA 5GOWB 3ULCA 2ZPYA 4HDQA 4KHBA 1I2HA 2D9XA 3U8ZA 4K81A 2COFA 2Z0PA 5C5BB 3OHMB 2YF0A 1WJMA 4OSNA 3NW8A 5D3XA 2BCJA 5DI9B 1V61A 3SYXA 4F7HA 1UNQA
chains in the Genus database with same CATH topology
1U5DA 4WJ7A 5D3VA 4MT7A 4PQ0A 1ZVRA 4HB4B 3LJUX 2Y7BA 2E2XA 2DKPA 3FSSA 4HAUB 2M14A 2P0DA 3PEGA 1BTKA 4GN1A 2J0KA 5KCVA 1SGHA 1K5GB 1FAOA 4H8SA 3QIJA 4YL8A 1K5DB 1XKEA 2VRWB 4YONA 1V89A 1Y5OA 2EC1A 1V88A 2ROZB 1UNRA 2ROVA 3MPXA 4DXAB 2DTCA 2AEHA 2GS0A 3IVFA 4HAWB 3TVVA 4TYZA 4A6KA 3FM8C 3T06A 2ELBA 2KCJA 1E5WA 1X05A 1ZSQA 3UZTA 2X18A 1UNPA 4IAPA 4A6HA 2D9ZA 3PVUA 5C16A 4KAXB 1P3RA 2DYQA 5CLLB 5J3YA 3PVWA 1WVHA 5JP4A 4HAXB 2N0YA 1J0WA 4C0AA 4XWXA 2MKRA 2COAA 2RSGA 1H4RA 4MY6A 4HAZB 3KZ1A 5FI0A 5L81A 2D2QA 4MK0A 2V76A 2YVCA 1I7AA 2EMSA 2MWNB 3PG7A 4GPTB 2H7EA 4HB2B 2W2WA 2CY5A 2YS3A 2AL6A 2ADZA 4GMXB 2UZRA 1XODA 5D3WA 2DHIA 4KHBB 3SO6A 1P6SA 1X1GA 5HE1A 4HB0B 4L6EA 5KQ4A 2CODA 2DA0A 2Z0OA 1XCGA 1MKEA 5C6RA 2PZ1A 1W1DA 3KRWA 2KGXB 4ZRKA 2P8VA 3KRXA 2LYDA 2YT1A 4EJNA 3TCAA 3AU5A 4KVGB 2VSZA 4A6FB 3PVLA 3ML4A 3P7ZA 1DDVA 1QC6A 3FEHA 1X86A 2RGNB 1EAZA 2DHJA 3HQCA 1FGZA 4HAYB 2CY4A 3BINA 3ODWA 4ZRJA 1SHCA 4IOYX 1DDMA 1FHXA 1DDWA 3NSUA 2D9VA 4K2OA 4F7UP 1ZM0A 1BWNA 2Y8FA 2I1JA 1DYNA 4DBBA 1U27A 2YSZA 1N3HA 1XD4A 4WVFB 1TQZA 4HHVA 4BBKA 5JLJB 3QWMA 4KHOA 5HE0A 4EKUA 2COCA 3TW1A 5HE2A 1MK9B 5KQ1A 2DKQA 2DX1A 1H10A 1X1FA 3SNHA 1EF1A 2DN6A 4NSWA 3A8QA 3F0WA 3QBVB 3DXDA 3VIAA 2DLWA 2Q13A 3ODOA 1ZC3B 2RLOA 4HATB 1DROA 2DHKA 5DH9B 2NMBA 3A8PA 3DXEA 1GG3A 1BTNA 1X11A 1MK7B 5JHGA 3D8FA 2IFSA 1FHWA 1OMWA 1WGUA 1B55A 1V5MA 4EMOA 1Q67A 2UVMA 2VKIA 2RVBB 2DYNA 2R09A 3M1IB 1BAKA 1EGXA 1Y19B 1W1GA 3AU4A 2D4QA 2W2XD 1V5PA 4HDOA 2UZSA 4HAVB 2W2XC 3CIKA 2D10A 3GYPA 1KZ7A 3WYFB 1PLSA 5JHHA 5C79A 3MDBC 4D0NB 3HW2B 1WJ1A 3ZDTA 1WG7A 2LKOA 4KHAA 3VOQA 2M38A 4A6FA 5CLQB 1TXDA 3CXBB 1Z87A 5LOPB 1P5TA 4P7IA 4GMVA 4IFSA 4ZRIA 1MPHA 5LONB 2EJ8A 2HE7A 3HK0A 1J19A 5FI1A 2CRFA 2GCJA 4K2PA 5HE3A 1PMSA 2RUKB 4HB3B 1U5GA 1ZC4B 1U5EA 1NI2A 2L1CA 3PP2A 3WA0A 3PSCA 3N7CA 4DX8A 4Z2MB 4WSFA 2J59M 2LOXA 2N23A 2YT0A 2KUPA 1NU2A 3TO1A 2P0FA 1EVHA 4DX90 2NZ8B 2LULA 3TFMA 2GCLA 2OQBA 4K17A 4GZUA 1WI1A 1UEFA 1MAIA 2J0JA 1OQNA 4TKNA 2R0DA 3KY9A 4A5KA 3ULBA 1LW3A 2EMTA 1V5UA 1IRSA 2QKLA 2HTHB 4CHMA 2LOZA 1M7RA 3RCPA 3DXCA 2P0HA 3SV1A 3G9WA 2GJYA 2MFQA 3AJ4A 1U5FA 2H7DA 1M7EA 2J0MA 1FHOA 3ZVRA 2YS1A 2YS5A 2I5CA 2DX5A 5EFXA 4NY0A 1FB8A 4F7GA 1MIZB 2MDXA 3GYOA 4B6HA 1AQCA 5D3YA 2D9WA 2IYBA 2FJLA 1GC7A 3OANA 1UPQA 3A98B 2K00A 1OY2A 2JP2A 2OTXA 3F5RA 2I5FA 1AWEA 2L2IA 1ISNA 2LG1A 3KSYA 3PZDA 2DFKA 1LB1A 3ODXA 4Y94A 2Z0QA 2Y8GA 1PFJA 2CAYA 5DIFB 1MIXA 2K2JA 1KI1B 3X23A 2RNRB 1FGYA 3D8EA 5C5BA 1TJ6A 5DHAB 4GXBA 1UPRA 2D11A 4CYEA 1RRPB 4CHJA 5J3QA 1W1HA 5J3TA 2I1KA 1RJ2A 3V5WA 2G35A 1QQGA 2YRYA 1NTVA 1DBHA 2XQNM 1KZGA 2K2UA 3D8DA 5DHFB 4Z2NA 3O96A 3U7DA 1U29A 3SUZA 2ELAA 1U2BA 5D27A 4PNKA 1NTYA 1GC6A 3BJIA 2D9YA 2QKMA 3P6AA 1WGQA 1XX0A 1XR0B 5GOWB 1FOEA 3ULCA 2ZPYA 4HDQA 1I2HA 2D9XA 3U8ZA 4K81A 2COFA 2Z0PA 5C5BB 2YF0A 1WJMA 5D3XA 2BCJA 5DI9B 1V61A 3SYXA 4F7HA 1UNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5D A;  4WJ7 A;  5D3V A;  4MT7 A;  4PQ0 A;  1ZVR A;  4HB4 B;  3LJU X;  2Y7B A;  2E2X A;  2DKP A;  3FSS A;  4HAU B;  2M14 A;  2P0D A;  3PEG A;  1BTK A;  4GN1 A;  2J0K A;  5KCV A;  1SGH A;  1K5G B;  1FAO A;  4H8S A;  3QIJ A;  4YL8 A;  1K5D B;  1XKE A;  2VRW B;  4YON A;  1V89 A;  1Y5O A;  2EC1 A;  1V88 A;  2ROZ B;  1UNR A;  2ROV A;  3MPX A;  4DXA B;  2DTC A;  2AEH A;  2GS0 A;  3IVF A;  4HAW B;  3TVV A;  4TYZ A;  4A6K A;  3FM8 C;  3T06 A;  2ELB A;  2KCJ A;  1E5W A;  1X05 A;  1ZSQ A;  3UZT A;  2X18 A;  1UNP A;  4IAP A;  4A6H A;  2D9Z A;  3PVU A;  5C16 A;  4KAX B;  1P3R A;  2DYQ A;  5CLL B;  5J3Y A;  3PVW A;  1WVH A;  5JP4 A;  4HAX B;  2N0Y A;  1J0W A;  4C0A A;  4XWX A;  2MKR A;  2COA A;  2RSG A;  1H4R A;  4MY6 A;  4HAZ B;  3KZ1 A;  5FI0 A;  5L81 A;  2D2Q A;  4MK0 A;  2V76 A;  2YVC A;  1I7A A;  2EMS A;  2MWN B;  3PG7 A;  4GPT B;  2H7E A;  4HB2 B;  2W2W A;  2CY5 A;  2YS3 A;  2AL6 A;  2ADZ A;  4GMX B;  2UZR A;  1XOD A;  5D3W A;  2DHI A;  4KHB B;  3SO6 A;  1P6S A;  1X1G A;  5HE1 A;  4HB0 B;  4L6E A;  5KQ4 A;  2COD A;  2DA0 A;  2Z0O A;  1XCG A;  1MKE A;  5C6R A;  2PZ1 A;  1W1D A;  3KRW A;  2KGX B;  4ZRK A;  2P8V A;  3KRX A;  2LYD A;  2YT1 A;  4EJN A;  3TCA A;  3AU5 A;  4KVG B;  2VSZ A;  4A6F B;  3PVL A;  3ML4 A;  3P7Z A;  1DDV A;  1QC6 A;  3FEH A;  1X86 A;  2RGN B;  1EAZ A;  2DHJ A;  3HQC A;  1FGZ A;  4HAY B;  2CY4 A;  3BIN A;  3ODW A;  4ZRJ A;  1SHC A;  4IOY X;  1DDM A;  1FHX A;  1DDW A;  3NSU A;  2D9V A;  4K2O A;  4F7U P;  1ZM0 A;  1BWN A;  2Y8F A;  2I1J A;  1DYN A;  4DBB A;  1U27 A;  2YSZ A;  1N3H A;  1XD4 A;  4WVF B;  1TQZ A;  4HHV A;  4BBK A;  5JLJ B;  3QWM A;  4KHO A;  5HE0 A;  4EKU A;  2COC A;  3TW1 A;  5HE2 A;  1MK9 B;  5KQ1 A;  2DKQ A;  2DX1 A;  1H10 A;  1X1F A;  3SNH A;  1EF1 A;  2DN6 A;  4NSW A;  3A8Q A;  3F0W A;  3QBV B;  3DXD A;  3VIA A;  2DLW A;  2Q13 A;  3ODO A;  1ZC3 B;  2RLO A;  4HAT B;  1DRO A;  2DHK A;  5DH9 B;  2NMB A;  3A8P A;  3DXE A;  1GG3 A;  1BTN A;  1X11 A;  1MK7 B;  5JHG A;  3D8F A;  2IFS A;  1FHW A;  1OMW A;  1WGU A;  1B55 A;  1V5M A;  4EMO A;  1Q67 A;  2UVM A;  2VKI A;  2RVB B;  2DYN A;  2R09 A;  3M1I B;  1BAK A;  1EGX A;  1Y19 B;  1W1G A;  3AU4 A;  2D4Q A;  2W2X D;  1V5P A;  4HDO A;  2UZS A;  4HAV B;  2W2X C;  3CIK A;  2D10 A;  3GYP A;  1KZ7 A;  3WYF B;  1PLS A;  5JHH A;  5C79 A;  3MDB C;  4D0N B;  3HW2 B;  1WJ1 A;  3ZDT A;  1WG7 A;  2LKO A;  4KHA A;  3VOQ A;  2M38 A;  4A6F A;  5CLQ B;  1TXD A;  3CXB B;  1Z87 A;  5LOP B;  1P5T A;  4P7I A;  4GMV A;  4IFS A;  4ZRI A;  1MPH A;  5LON B;  2EJ8 A;  2HE7 A;  3HK0 A;  1J19 A;  5FI1 A;  2CRF A;  2GCJ A;  4K2P A;  5HE3 A;  1PMS A;  2RUK B;  4HB3 B;  1U5G A;  1ZC4 B;  1U5E A;  1NI2 A;  2L1C A;  3PP2 A;  3WA0 A;  3PSC A;  3N7C A;  4DX8 A;  4Z2M B;  4WSF A;  2J59 M;  2LOX A;  2N23 A;  2YT0 A;  2KUP A;  1NU2 A;  3TO1 A;  2P0F A;  1EVH A;  4DX9 0;  2NZ8 B;  2LUL A;  3TFM A;  2GCL A;  2OQB A;  4K17 A;  4GZU A;  1WI1 A;  1UEF A;  1MAI A;  2J0J A;  1OQN A;  4TKN A;  2R0D A;  3KY9 A;  4A5K A;  3ULB A;  1LW3 A;  2EMT A;  1V5U A;  1IRS A;  2QKL A;  2HTH B;  4CHM A;  2LOZ A;  1M7R A;  3RCP A;  3DXC A;  2P0H A;  3SV1 A;  3G9W A;  2GJY A;  2MFQ A;  3AJ4 A;  1U5F A;  2H7D A;  1M7E A;  2J0M A;  1FHO A;  3ZVR A;  2YS1 A;  2YS5 A;  2I5C A;  2DX5 A;  5EFX A;  4NY0 A;  1FB8 A;  4F7G A;  1MIZ B;  2MDX A;  3GYO A;  4B6H A;  1AQC A;  5D3Y A;  2D9W A;  2IYB A;  2FJL A;  1GC7 A;  3OAN A;  1UPQ A;  3A98 B;  2K00 A;  1OY2 A;  2JP2 A;  2OTX A;  3F5R A;  2I5F A;  1AWE A;  2L2I A;  1ISN A;  2LG1 A;  3KSY A;  3PZD A;  2DFK A;  1LB1 A;  3ODX A;  4Y94 A;  2Z0Q A;  2Y8G A;  1PFJ A;  2CAY A;  5DIF B;  1MIX A;  2K2J A;  1KI1 B;  3X23 A;  2RNR B;  1FGY A;  3D8E A;  5C5B A;  1TJ6 A;  5DHA B;  4GXB A;  1UPR A;  2D11 A;  4CYE A;  1RRP B;  4CHJ A;  5J3Q A;  1W1H A;  5J3T A;  2I1K A;  1RJ2 A;  3V5W A;  2G35 A;  1QQG A;  2YRY A;  1NTV A;  1DBH A;  2XQN M;  1KZG A;  2K2U A;  3D8D A;  5DHF B;  4Z2N A;  3O96 A;  3U7D A;  1U29 A;  3SUZ A;  2ELA A;  1U2B A;  5D27 A;  4PNK A;  1NTY A;  1GC6 A;  3BJI A;  2D9Y A;  2QKM A;  3P6A A;  1WGQ A;  1XX0 A;  1XR0 B;  5GOW B;  1FOE A;  3ULC A;  2ZPY A;  4HDQ A;  1I2H A;  2D9X A;  3U8Z A;  4K81 A;  2COF A;  2Z0P A;  5C5B B;  2YF0 A;  1WJM A;  5D3X A;  2BCJ A;  5DI9 B;  1V61 A;  3SYX A;  4F7H A;  1UNQ A; 
#chains in the Genus database with same CATH topology
 1U5D A;  4WJ7 A;  5D3V A;  4MT7 A;  4PQ0 A;  1ZVR A;  4HB4 B;  3LJU X;  2Y7B A;  1MI1 A;  2E2X A;  2DKP A;  3FSS A;  4HAU B;  2M14 A;  2P0D A;  3PEG A;  1BTK A;  4GN1 A;  2J0K A;  5KCV A;  1SGH A;  1K5G B;  4DIX A;  1FAO A;  4H8S A;  3QIJ A;  4YL8 A;  4QJ4 B;  1K5D B;  1XKE A;  2VRW B;  4YON A;  1V89 A;  1Y5O A;  2EC1 A;  1V88 A;  2ROZ B;  1UNR A;  2ROV A;  3MPX A;  4DXA B;  2DTC A;  2KIE A;  2AEH A;  2GS0 A;  3FVC A;  3IVF A;  4HAW B;  3TVV A;  4TYZ A;  4A6K A;  3FM8 C;  3T06 A;  2ELB A;  2KCJ A;  1E5W A;  1X05 A;  1ZSQ A;  3UZT A;  2X18 A;  1UNP A;  4IAP A;  2YT2 A;  2ZKM X;  2KUQ A;  2D9Z A;  3PVU A;  4A6H A;  5C16 A;  4KAX B;  1P3R A;  2DYQ A;  5CLL B;  4GNK B;  5J3Y A;  3PVW A;  1WVH A;  5JP4 A;  4HAX B;  2N0Y A;  1T77 A;  2Z59 A;  1J0W A;  4C0A A;  4XWX A;  2MKR A;  2COA A;  2RSG A;  1H4R A;  4MY6 A;  4HAZ B;  3KZ1 A;  5FI0 A;  5L81 A;  2D2Q A;  4MK0 A;  2V76 A;  2Z14 A;  2YVC A;  1I7A A;  2EMS A;  2MWN B;  3PG7 A;  4GPT B;  2H7E A;  2W2W A;  4HB2 B;  2CY5 A;  2YS3 A;  3B77 A;  2AL6 A;  2ADZ A;  4GMX B;  2UZR A;  1XOD A;  2RRF A;  5D3W A;  2DHI A;  4KHB B;  3SO6 A;  1P6S A;  1X1G A;  3A58 A;  5HE1 A;  4HB0 B;  4L6E A;  5KQ4 A;  2COD A;  2DA0 A;  2Z0O A;  2KIG A;  1XCG A;  1MKE A;  5C6R A;  2PZ1 A;  1W1D A;  3KRW A;  2KGX B;  4ZRK A;  2P8V A;  3KRX A;  2LYD A;  2YT1 A;  4EJN A;  3TCA A;  3AU5 A;  4KVG B;  2VSZ A;  4A6F B;  3PVL A;  3ML4 A;  3P7Z A;  1DDV A;  1QC6 A;  3FEH A;  1X86 A;  2RGN B;  1EAZ A;  2DHJ A;  3HQC A;  1FGZ A;  4HAY B;  2CY4 A;  3BIN A;  3ODW A;  4ZRJ A;  1SHC A;  4IOY X;  2NBV A;  1DDM A;  1FHX A;  1DDW A;  3NSU A;  2D9V A;  4K2O A;  4F7U P;  1ZM0 A;  2R2Y A;  1BWN A;  2Y8F A;  1ZYI A;  2I1J A;  1DYN A;  4DBB A;  1U27 A;  2YSZ A;  1N3H A;  1XD4 A;  4WVF B;  4L1R A;  1TQZ A;  5I2M A;  4HHV A;  4BBK A;  5JLJ B;  3QWM A;  4KHO A;  5HE0 A;  4EKU A;  2COC A;  3TW1 A;  5HE2 A;  1MK9 B;  2K8E A;  5KQ1 A;  2DKQ A;  2DX1 A;  1H10 A;  1X1F A;  3SNH A;  5IRS A;  1EF1 A;  2DN6 A;  4NSW A;  3A8Q A;  3F0W A;  3QBV B;  3DXD A;  3VIA A;  2DLW A;  2Q13 A;  3ODO A;  1ZC3 B;  2RLO A;  4HAT B;  1DRO A;  2DHK A;  5DH9 B;  2NMB A;  3A8P A;  3DXE A;  5LG4 B;  1GG3 A;  1BTN A;  1X11 A;  1MK7 B;  5JHG A;  3D8F A;  2IFS A;  1FHW A;  1OMW A;  1WGU A;  1B55 A;  3NWF A;  1V5M A;  4EMO A;  1Q67 A;  2UVM A;  2VKI A;  2RVB B;  2DYN A;  2R09 A;  3M1I B;  1BAK A;  1EGX A;  1Y19 B;  1W1G A;  3AU4 A;  2D4Q A;  2W2X D;  1V5P A;  4HDO A;  2UZS A;  4HAV B;  2W2X C;  3CIK A;  2D10 A;  3GYP A;  2Z13 A;  1KZ7 A;  3WYF B;  1PLS A;  5JHH A;  5C79 A;  3MDB C;  2GUM A;  4D0N B;  3HW2 B;  1WJ1 A;  3ZDT A;  1WG7 A;  2LKO A;  4KHA A;  3VOQ A;  2M38 A;  4A6F A;  5CLQ B;  5I2S A;  1TXD A;  4QXA B;  3CXB B;  1Z87 A;  5LOP B;  1P5T A;  4P7I A;  4GMV A;  4IFS A;  4ZRI A;  1MPH A;  5LON B;  2EJ8 A;  2HE7 A;  3HK0 A;  1J19 A;  5FI1 A;  2CRF A;  2GCJ A;  4K2P A;  5HE3 A;  1PMS A;  2RUK B;  4HB3 B;  1U5G A;  1ZC4 B;  1U5E A;  1NI2 A;  2L1C A;  3HSA A;  4OT1 A;  2Z4D A;  3PP2 A;  3WA0 A;  3PSC A;  3N7C A;  4DX8 A;  4Z2M B;  4WSF A;  2J59 M;  2LOX A;  3NWA A;  2N23 A;  2YT0 A;  2KUP A;  1NU2 A;  3TO1 A;  2P0F A;  1EVH A;  4DX9 0;  2NZ8 B;  2LUL A;  3TFM A;  2GCL A;  2OQB A;  3NWD A;  4K17 A;  4GZU A;  1WI1 A;  1UEF A;  3DCX A;  1MAI A;  2J0J A;  1OQN A;  4TKN A;  2R0D A;  3KY9 A;  4A5K A;  3ULB A;  1LW3 A;  2EMT A;  1V5U A;  4QJ5 B;  1IRS A;  2QKL A;  2HTH B;  2FJU B;  5M4Y B;  4CHM A;  2LOZ A;  1M7R A;  3RCP A;  3DXC A;  2P0H A;  3SV1 A;  3G9W A;  2GJY A;  2MFQ A;  3AJ4 A;  1U5F A;  2H7D A;  1M7E A;  2J0M A;  1FHO A;  3ZVR A;  2YS1 A;  2YS5 A;  2I5C A;  3HIE A;  2DX5 A;  5EFX A;  4NY0 A;  1FB8 A;  4F7G A;  1MIZ B;  2MDX A;  3GYO A;  4B6H A;  1AQC A;  5D3Y A;  2D9W A;  2IYB A;  2FJL A;  1GC7 A;  3OAN A;  1UPQ A;  3A98 B;  2K00 A;  1OY2 A;  4GOU A;  2JP2 A;  2OTX A;  3F5R A;  2I5F A;  1AWE A;  2L2I A;  1ISN A;  2LG1 A;  3KSY A;  4QJ3 B;  3PZD A;  2DFK A;  1LB1 A;  3ODX A;  4Y94 A;  2Z0Q A;  2Y8G A;  1PFJ A;  2CAY A;  5DIF B;  1MIX A;  2K2J A;  1KI1 B;  3X23 A;  2KR0 A;  4CSQ A;  2RNR B;  1FGY A;  3D8E A;  5C5B A;  1TJ6 A;  5DHA B;  4GXB A;  1UPR A;  2D11 A;  4CYE A;  1RRP B;  4CHJ A;  5J3Q A;  1W1H A;  5J3T A;  3U12 A;  2I1K A;  4HSI A;  1RJ2 A;  3V5W A;  2G35 A;  1QQG A;  2YRY A;  1NTV A;  1DBH A;  2XQN M;  1KZG A;  2K2U A;  3D8D A;  5DHF B;  4D6W A;  4Z2N A;  3O96 A;  3U7D A;  1U29 A;  3SUZ A;  2ELA A;  1U2B A;  5D27 A;  4PNK A;  1NTY A;  1GC6 A;  3BJI A;  2D9Y A;  2QKM A;  3P6A A;  1WGQ A;  1XX0 A;  1XR0 B;  2K49 A;  1FOE A;  5GOW B;  3ULC A;  2ZPY A;  4HDQ A;  4KHB A;  1I2H A;  2D9X A;  3U8Z A;  4K81 A;  2COF A;  2Z0P A;  5C5B B;  3OHM B;  2YF0 A;  1WJM A;  4OSN A;  3NW8 A;  5D3X A;  2BCJ A;  5DI9 B;  1V61 A;  3SYX A;  4F7H A;  1UNQ A; 
#chains in the Genus database with same CATH homology
 1U5D A;  4WJ7 A;  5D3V A;  4MT7 A;  4PQ0 A;  1ZVR A;  4HB4 B;  3LJU X;  2Y7B A;  2E2X A;  2DKP A;  3FSS A;  4HAU B;  2M14 A;  2P0D A;  3PEG A;  1BTK A;  4GN1 A;  2J0K A;  5KCV A;  1SGH A;  1K5G B;  1FAO A;  4H8S A;  3QIJ A;  4YL8 A;  1K5D B;  1XKE A;  2VRW B;  4YON A;  1V89 A;  1Y5O A;  2EC1 A;  1V88 A;  2ROZ B;  1UNR A;  2ROV A;  3MPX A;  4DXA B;  2DTC A;  2AEH A;  2GS0 A;  3IVF A;  4HAW B;  3TVV A;  4TYZ A;  4A6K A;  3FM8 C;  3T06 A;  2ELB A;  2KCJ A;  1E5W A;  1X05 A;  1ZSQ A;  3UZT A;  2X18 A;  1UNP A;  4IAP A;  4A6H A;  2D9Z A;  3PVU A;  5C16 A;  4KAX B;  1P3R A;  2DYQ A;  5CLL B;  5J3Y A;  3PVW A;  1WVH A;  5JP4 A;  4HAX B;  2N0Y A;  1J0W A;  4C0A A;  4XWX A;  2MKR A;  2COA A;  2RSG A;  1H4R A;  4MY6 A;  4HAZ B;  3KZ1 A;  5FI0 A;  5L81 A;  2D2Q A;  4MK0 A;  2V76 A;  2YVC A;  1I7A A;  2EMS A;  2MWN B;  3PG7 A;  4GPT B;  2H7E A;  4HB2 B;  2W2W A;  2CY5 A;  2YS3 A;  2AL6 A;  2ADZ A;  4GMX B;  2UZR A;  1XOD A;  5D3W A;  2DHI A;  4KHB B;  3SO6 A;  1P6S A;  1X1G A;  5HE1 A;  4HB0 B;  4L6E A;  5KQ4 A;  2COD A;  2DA0 A;  2Z0O A;  1XCG A;  1MKE A;  5C6R A;  2PZ1 A;  1W1D A;  3KRW A;  2KGX B;  4ZRK A;  2P8V A;  3KRX A;  2LYD A;  2YT1 A;  4EJN A;  3TCA A;  3AU5 A;  4KVG B;  2VSZ A;  4A6F B;  3PVL A;  3ML4 A;  3P7Z A;  1DDV A;  1QC6 A;  3FEH A;  1X86 A;  2RGN B;  1EAZ A;  2DHJ A;  3HQC A;  1FGZ A;  4HAY B;  2CY4 A;  3BIN A;  3ODW A;  4ZRJ A;  1SHC A;  4IOY X;  1DDM A;  1FHX A;  1DDW A;  3NSU A;  2D9V A;  4K2O A;  4F7U P;  1ZM0 A;  1BWN A;  2Y8F A;  2I1J A;  1DYN A;  4DBB A;  1U27 A;  2YSZ A;  1N3H A;  1XD4 A;  4WVF B;  1TQZ A;  4HHV A;  4BBK A;  5JLJ B;  3QWM A;  4KHO A;  5HE0 A;  4EKU A;  2COC A;  3TW1 A;  5HE2 A;  1MK9 B;  5KQ1 A;  2DKQ A;  2DX1 A;  1H10 A;  1X1F A;  3SNH A;  1EF1 A;  2DN6 A;  4NSW A;  3A8Q A;  3F0W A;  3QBV B;  3DXD A;  3VIA A;  2DLW A;  2Q13 A;  3ODO A;  1ZC3 B;  2RLO A;  4HAT B;  1DRO A;  2DHK A;  5DH9 B;  2NMB A;  3A8P A;  3DXE A;  1GG3 A;  1BTN A;  1X11 A;  1MK7 B;  5JHG A;  3D8F A;  2IFS A;  1FHW A;  1OMW A;  1WGU A;  1B55 A;  1V5M A;  4EMO A;  1Q67 A;  2UVM A;  2VKI A;  2RVB B;  2DYN A;  2R09 A;  3M1I B;  1BAK A;  1EGX A;  1Y19 B;  1W1G A;  3AU4 A;  2D4Q A;  2W2X D;  1V5P A;  4HDO A;  2UZS A;  4HAV B;  2W2X C;  3CIK A;  2D10 A;  3GYP A;  1KZ7 A;  3WYF B;  1PLS A;  5JHH A;  5C79 A;  3MDB C;  4D0N B;  3HW2 B;  1WJ1 A;  3ZDT A;  1WG7 A;  2LKO A;  4KHA A;  3VOQ A;  2M38 A;  4A6F A;  5CLQ B;  1TXD A;  3CXB B;  1Z87 A;  5LOP B;  1P5T A;  4P7I A;  4GMV A;  4IFS A;  4ZRI A;  1MPH A;  5LON B;  2EJ8 A;  2HE7 A;  3HK0 A;  1J19 A;  5FI1 A;  2CRF A;  2GCJ A;  4K2P A;  5HE3 A;  1PMS A;  2RUK B;  4HB3 B;  1U5G A;  1ZC4 B;  1U5E A;  1NI2 A;  2L1C A;  3PP2 A;  3WA0 A;  3PSC A;  3N7C A;  4DX8 A;  4Z2M B;  4WSF A;  2J59 M;  2LOX A;  2N23 A;  2YT0 A;  2KUP A;  1NU2 A;  3TO1 A;  2P0F A;  1EVH A;  4DX9 0;  2NZ8 B;  2LUL A;  3TFM A;  2GCL A;  2OQB A;  4K17 A;  4GZU A;  1WI1 A;  1UEF A;  1MAI A;  2J0J A;  1OQN A;  4TKN A;  2R0D A;  3KY9 A;  4A5K A;  3ULB A;  1LW3 A;  2EMT A;  1V5U A;  1IRS A;  2QKL A;  2HTH B;  4CHM A;  2LOZ A;  1M7R A;  3RCP A;  3DXC A;  2P0H A;  3SV1 A;  3G9W A;  2GJY A;  2MFQ A;  3AJ4 A;  1U5F A;  2H7D A;  1M7E A;  2J0M A;  1FHO A;  3ZVR A;  2YS1 A;  2YS5 A;  2I5C A;  2DX5 A;  5EFX A;  4NY0 A;  1FB8 A;  4F7G A;  1MIZ B;  2MDX A;  3GYO A;  4B6H A;  1AQC A;  5D3Y A;  2D9W A;  2IYB A;  2FJL A;  1GC7 A;  3OAN A;  1UPQ A;  3A98 B;  2K00 A;  1OY2 A;  2JP2 A;  2OTX A;  3F5R A;  2I5F A;  1AWE A;  2L2I A;  1ISN A;  2LG1 A;  3KSY A;  3PZD A;  2DFK A;  1LB1 A;  3ODX A;  4Y94 A;  2Z0Q A;  2Y8G A;  1PFJ A;  2CAY A;  5DIF B;  1MIX A;  2K2J A;  1KI1 B;  3X23 A;  2RNR B;  1FGY A;  3D8E A;  5C5B A;  1TJ6 A;  5DHA B;  4GXB A;  1UPR A;  2D11 A;  4CYE A;  1RRP B;  4CHJ A;  5J3Q A;  1W1H A;  5J3T A;  2I1K A;  1RJ2 A;  3V5W A;  2G35 A;  1QQG A;  2YRY A;  1NTV A;  1DBH A;  2XQN M;  1KZG A;  2K2U A;  3D8D A;  5DHF B;  4Z2N A;  3O96 A;  3U7D A;  1U29 A;  3SUZ A;  2ELA A;  1U2B A;  5D27 A;  4PNK A;  1NTY A;  1GC6 A;  3BJI A;  2D9Y A;  2QKM A;  3P6A A;  1WGQ A;  1XX0 A;  1XR0 B;  5GOW B;  1FOE A;  3ULC A;  2ZPY A;  4HDQ A;  1I2H A;  2D9X A;  3U8Z A;  4K81 A;  2COF A;  2Z0P A;  5C5B B;  2YF0 A;  1WJM A;  5D3X A;  2BCJ A;  5DI9 B;  1V61 A;  3SYX A;  4F7H A;  1UNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...