1W1WE

Sc smc1hd:scc1-c complex, atpgs
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
78
structure length
70
Chain Sequence
KAIVQMAKILRKELSEEKEVIFTDVLKSQAKREASRGFFDILSLATEGCIGLSQTEAFGNIKIDAKPALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and stability of cohesin's Smc1-kleisin interaction.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
molecule keywords STRUCTURAL MAINTENANCE OF CHROMOSOME 1
total genus 18
structure length 70
sequence length 78
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2004-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF04824 Rad21_Rec8 Conserved region of Rad21 / Rec8 like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.580 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Structural maintenance of chromosome 1. Chain E 1w1wE00
1W1WE 4I99C
chains in the Genus database with same CATH superfamily
2M2EA 3N05A 1O3TA 1K83J 4IQJA 2V79A 1D8JA 2DOAA 2F5VA 2BY0A 1I1GA 1LNWA 1R5GA 2MW8A 3HOZJ 4HNTA 3RJPA 1VNDA 1I50J 3HEFA 1ZQ3P 1R36A 2Z33A 3KEYA 3OR2C 1QPMA 3B73A 3L2QA 3L9FA 4C3IJ 4EMSA 2W25A 3HG9A 2K9QA 2MLGA 3S2DJ 1W0TA 5EG0B 4EM2A 1ZRFA 3HOYJ 1NK2P 1X4OA 2ESNA 2CO5A 3CJRB 1ETYA 3IAM2 4BHBA 2DPUA 2ZSHB 1Z7UA 4M9ZA 4A3IJ 3CUQA 3CP2A 2FU4A 3K1PA 4RB1A 4II3A 3ZMDA 1Z3XA 3A4CA 1AU7A 2DJNA 3CCSI 4L9TA 2VKEA 1JT0A 3JRIA 3R0JA 2X48A 1ZYRF 4HSTA 1IXSB 5KVRA 2O7OA 3ELKA 3COAC 1IJWC 2R7SA 5H2FC 1IN5A 5E3MA 1Y0NA 3L00A 1OKRA 2IXSA 4I7HA 3WU1B 2F2EA 5EGOA 2V9PA 1S7AA 1JHHA 2OC6A 4UHTA 5CQEA 4J01A 2Y48A 1I27A 2BBYA 4RMNA 4I76A 1VQOI 4XONA 3SDGA 1B6AA 1CGPA 3E6BA 1Y6IA 4AIDA 1RR7A 2OA4A 3G1LA 1E2XA 4L9NA 1KYZA 1EJ9A 2DMTA 3I5UA 3K9TA 2IS1A 4PDKA 4M6XA 1X1PA 3RSNA 1OQYA 5KAFC 2XGDA 2WAQN 4HBLA 2P6TA 2DFHA 3G71I 1ZHFA 1LVKA 3PO2J 3ZQLA 2HTSA 5FROA 1T95A 5ICEA 1RRJA 5HS8A 2F5FA 2G0EA 3ZQGA 4S0HB 2FBHA 4CICA 3HOWJ 2DK8A 5BNGA 2F48A 1PP7U 4CA0A 1MDMB 3DBHB 2IPQX 3WGGA 1XGMA 1FBUA 3CJQB 1H89C 4M3FA 2Y30A 5K5RA 3ZXSA 2HKXA 2B63J 4RLQA 4EVIA 2EB7A 3S17J 3RKXA 1T38A 3JRDA 1WRJA 1BOAA 1D0YA 4PJJA 2R0QC 1FTZA 4AIKA 2BE5F 2DFFA 2GIZA 2JRMA 3TDZC 2V1DA 3Q3SA 2MFZA 2CUZA 3RDIA 2BGCA 1PP8F 2QQAA 4N9IA 1XG1A 2V1NA 3N97A 1VQNI 3V7CA 4XORA 2DU9A 3A01A 3QPTA 3QODA 3KE2A 1S5LC 4A69C 4OIPF 2EPFA 3EYYA 5F08A 2ZXIA 4U7DA 2XF7A 1G8XA 5ICCA 3I71A 1YW8A 3F23A 4F93B 3I4NJ 5HS7A 5JI6A 4IRIA 2Q2EA 4BGDA 4ZDOA 3M4OJ 3EUHA 2QCOA 2E1OA 3CO6C 2H8WA 1GDTA 2QM3A 1WH7A 4IPAA 1X1AA 3K10A 2V7FA 3L2UA 3SZPA 2GXGA 3G4SI 2FA5A 3HSEA 5LD2C 1T39A 3MFKA 4UB8C 2HI3A 2PMUA 1W5TA 2JQ7A 2X51A 4ESBA 1FT9A 2LMDA 3I0TA 2P5KA 3VSKA 4XLFA 1R71A 2DO7A 4A6EA 4HPQA 1R1UA 2E34A 2FJ1A 3E6DA 4XK4A 4QPOA 1R49A 1Z0XA 1R4MB 2DAOA 2VBYA 1J2XA 1TP4A 5BOXA 4A0ZA 3H9JA 3U1KA 4NC7A 2WAQA 5LGTA 4LG3A 2M9HA 3PO3J 2PMZA 1IRGA 1D5VA 3OR1C 2EH3A 5ERIA 1S72I 2M8GX 3G1OA 1UJ8A 2Y0SA 4M9XA 1OCPA 4FASD 1V5GA 3HRUA 1G2HA 3BR0A 4X0GA 3K4MA 1DGWY 4X1EA 1E17A 2JA5J 3HRSA 3A01B 1QZZA 4IZZA 1HC8A 2E35A 1LFPA 1Y8QB 3O2PE 1R7JA 2P5LC 3S3NA 2L0KA 1WJ5A 4WXCA 1IXCA 2YUSA 2OZUA 2LYCA 2EIJH 1X19A 1T0FC 5A2QZ 3LAPA 5E1XA 5HNHA 1DU0A 3OYDA 3MKZA 4GDFA 3GTMJ 1X3WB 3R4KA 2R7OA 2EV5A 2N8GA 1C0WA 3JRBA 4U0YA 3DV8A 5LGNA 4YIIA 2BV6A 3ECOA 2OBPA 4TV7A 2FX0A 1QVUA 3B6CA 4FE7A 3CCLI 3K1MA 2HR3A 4ESJA 2BHZA 2M4KA 4B43A 5EYRA 2Y31A 4MEYF 5IYCJ 1ZN2A 4EGZA 3LSPA 3DTKA 1Y56A 4LLNA 4QPQA 4KA4A 1S6LA 2XV4S 3AL0B 3IKVA 3WTVC 2KRCA 1G4DA 1L3LA 4AU7A 1TBXA 2KMUA 4B8XA 1D8KA 5FKKA 3ZR8X 3MQ0A 2Q2EB 3PFIA 2B9SA 4M3GA 1EKEA 2NRAC 1RKWA 3ZMVA 3GTOJ 3KYDB 5CKTA 1MSFC 2E2JJ 5LHHA 2M7BA 2V9KA 2K9MA 5IYDJ 2ZJQF 1WJFA 4HSRA 4FTHA 1FTTA 1ZTRA 3FXJA 2XASA 3I55I 1H8AC 2D1VA 1O57A 4BY7J 1YO5C 4G7OF 2QQ8A 2KT0A 2AXTC 5L3CA 3PNTA 2EFPA 2EBIA 2RKHA 3GUDA 1ON2A 5IYBJ 1MMGA 1MNDA 3CJNA 3OS0A 1SD6A 3ZN0A 2K5CA 3F8MA 1V5FA 3HXLA 4Y15A 5CVIA 3M07A 3LA3A 4LITA 4D7MA 4XR6A 4LD5A 5KCMA 4EJUA 1HSTA 2NVQJ 3L2VA 2LP0A 3ZQCA 1HLVA 2OU2A 3RYPA 5LFAA 3DF8A 2DJIA 3EPZA 4L9VA 5FD6A 3PIOF 1XGOA 4YFNF 3H0DA 3ERED 1FOYA 1HW1A 2BYVE 2M5WA 3MCZA 3WTWC 1D3YA 4E7JA 2VBWA 3QP5A 2BY2A 2Y9YA 1HKQA 3M7GA 3F3XA 2P81A 4M73A 1KU2A 3BZ6A 2L4AA 2CV1A 4HNVA 1Z6TA 2FE3A 2XGEA 2DW4A 3BY6A 3JTHA 2WTEA 1O3RA 4CSWA 4IKFA 1KU3A 2EQRA 3WTXC 3ZQFA 1KU7A 1ETVA 4ZZDA 3OSGA 2EFQA 1EH8A 2E1MC 1I6XA 1OYIA 3OYJA 5H6RA 2L9VA 1F4KA 1AKHB 3BCBA 5EZHA 1LKXA 3LQQA 3FK7A 5EDNA 1XCVA 2VI6A 5E3LA 4D5CA 1RR8C 3PSFA 5M3MJ 4LB6B 3W6VA 4MHGA 5LHIA 2GOMA 1U0JA 4RM2A 3KFWX 5J4YA 2MSYA 2HYGD 1FIPA 3IWFA 3H3ZA 2ZBKA 3ZP5A 3KP2A 3QQAA 1Y0UA 1S29A 3VFZA 5FKMA 1VQKI 3AG3H 1YIJI 4WX9A 1OCOH 4BHCA 3I53A 1UFMA 4YFXF 4CDGA 1XCBA 5J3LA 3FBNB 2HWVA 3M1CA 2UXXA 2W84A 2A05A 2GXBA 1KONA 2HDWA 4H4KC 2H1KA 2BEOA 3FISA 1MMSA 5IOYA 4HDUA 3TEDA 2DYSH 2H27A 2MABA 4DYCA 1PVEA 3L1PA 4XSXF 1V3FA 1B1BA 2LKSA 1XGNA 4BHPA 1JGGA 1W0UA 2B0LA 2DFEA 4OINF 3TMOA 3OYLA 1JKRC 4AWXB 4FETA 4CHUA 4XRSG 2EILH 3RPUA 1ACIA 4M74A 3TP3A 2DT5A 4KIBA 1MMNA 3CLQA 3MN2A 4NB5A 3LWFA 2CG4A 2ZJRF 1W1WE 1HKSA 2DK5A 1I1SA 4E7KA 2ZFWA 1T98A 2XIGA 2B7EA 4ZDPA 5GTHC 1BN5A 2ZNZA 3ZMTA 1VQ5I 1RPWA 3HOUJ 2HXIA 2MYSA 4XMYA 1QVTA 3BR1A 2HGCA 1BA5A 2FQ3A 1VF9A 2E60A 1FWZA 5L3BA 3I56I 3GX4X 5H6QA 3HIFA 2M4GA 1LDKB 4YFKF 1Z3YA 3S15J 1XX5A 2W4SA 3LSRA 4U0WA 3S3MA 1R23A 1D1CA 3F9KA 2R5YA 3HTSB 4UUVA 2JA6J 3EUAA 4HA8A 4HX8A 4AYBA 2C6YA 1TTYA 3I58A 3RKWA 1MBEA 3WTTC 2LC2A 2H1LA 2A5WA 1R6RA 1YYVA 1OFCX 4A0XA 3QYBA 4XKWA 2P4WA 4EJWA 4BJTA 2H09A 3FXUA 4LLLA 3VDXA 3HYIA 3ONQA 4IRHA 1WGXA 5DM6F 2W57A 2XROA 2YPRA 2NVTJ 2R7XA 2K40A 4A3BJ 1YJWI 1HDPA 2HVQA 4B44A 3P9CA 3P9IA 4OU0A 5J4VA 4WK8F 2JUGA 4P55A 4IHWA 3BG5A 2IGOA 3PQKA 2ME6A 1L0OC 2W00A 2CQ7A 2PX9A 2BY3A 1TNTA 2IA0A 2NAZA 1X1BA 1BW6A 3GBGA 4MO7A 2VIXA 4DBRA 3DBRB 3DEWA 4AUXA 5KAIC 3QAHA 3G6EI 2NNNA 1PUFA 2LY9A 2NOGA 3M9AA 1QHGA 3Q9SA 2GA2A 2HDDA 3T8RA 3A2KA 2MH9A 2QENA 3S93A 4Z6YA 2CUEA 1MBFA 1MJAA 1MKMA 3BR2A 4UVBA 3ZCOA 2DT6A 1FC3A 4ZTJA 3E5QA 2KP6A 1JHFA 1EF4A 3H5RA 2RN7A 1VZ0A 4HX4A 4PSWA 5M3FJ 3HZJA 4L5JA 2CQNA 1VTNC 2K9SA 3LNQA 2JSCA 1N25A 4G6DA 1B8IB 1R5ID 4YRVA 2WB1A 2HFHA 3MZ8A 2DQRA 4BXXJ 4KISA 2F5DA 1LFBA 1E3HA 2M1BA 2QKMB 2XKPA 5FLXZ 4ENJA 1T56A 1A31A 3S16J 2QZ8A 3MVPA 5M5XJ 2QYOA 3PNYA 3L2RA 3HGGA 4E7ZA 2VL8A 1WCMJ 3C2HA 4DW6A 3VWBA 2ETHA 3OS2A 1VQ6I 3O6BB 1BIAA 5DEQA 1IN7A 3KP3A 1Z91A 2JT1A 1WI3A 2VJ4A 1O4XA 2O3FA 5JHFA 1JT6A 1U3EM 2D5VA 2VONA 3T1BA 5ED4A 2VPLA 1FY7A 2OCCH 2O8KA 2DA6A 2EZIA 4L0YB 2DA2A 5E18F 2BW3B 3WG7H 1ETWA 2DOEA 3KCCA 3GTLJ 2XAUA 3DKYA 1R5HA 4E6KG 1RIOH 3QU6A 1T6SA 4I02A 2NVXJ 2FF4A 2IA1A 2HNHA 1N78A 3GCMA 3LSIA 3KLNA 3VYRB 1ZELA 2L7MP 5F04A 4OWRB 3KP4A 3W6JB 5IP7J 2GQQA 5E1WA 2L3DA 4BQOA 2R5ZB 1XD7A 1NK3P 3Q9VA 1ZR4A 4DJAA 5TRDA 3HSRA 4P96A 4PJ0C 5K1YA 3GFMA 2RVCA 1FNNA 5FFZA 3QPLA 2CQQA 2L54A 2X6YA 1NG6A 2JN6A 2QQ9A 2ZFUA 4UB6C 1HSJA 2Y9ZA 1VQ7I 4XOTA 4KFCA 4G12A 1G3WA 1LUJB 3DTIA 2FSWA 1POGA 4ZZLA 1TWGJ 2ELKA 1T08B 4LG0B 2LF7A 2M8EA 3AAFA 3TO7A 3S1RJ 3A03A 2ZMEC 2QLZA 4IJAA 1JTXA 3LSGA 1UG0A 3TO6A 2KPMA 2RC4A 3PM1A 1IO2A 3M1EA 4DYQA 4IF4A 2ZNYA 3OYFA 1IW7F 1I5ZA 4EGYA 3JRGA 2IGKA 2O03A 4HF1A 5CPRB 3LA2A 3M8EA 4E7HA 4N0BA 4L5IA 4NQWA 4IEJA 2O0YA 1REPC 4UV8A 1U5TB 2GM4A 2RNJA 3DXJF 3NARA 4XBFA 1AKHA 2LK2A 2VQHA 2BOLA 2A61A 1KQ8A 1XGSA 2J5OA 2DA5A 5EJCA 3CC2I 1U8BA 2CRGA 2EIKH 4OAZA 2EFWA 5E3NA 3UKGA 2MA3A 2PMHA 3ABKH 1FYLA 3E6CC 4BKXA 2RQPA 4F3QA 3CO7C 4EM0B 2ZC2A 3CLOA 4ENMA 2JPBA 1YITI 1D5YA 4BE0A 4P1WA 4PJLA 4UNOA 2EINH 1QHHD 5B1BH 2F5CA 3RQ4A 1RI7A 2K9LA 5CQGA 3HOTA 1TLHB 2R7ZJ 1V55H 5HVQC 1OCTC 2O61A 1GV5A 3K7AJ 4M6VA 1XSDA 2CFXA 5D5XB 3AG1H 5KK1A 4ZYHA 4WCGA 3BTCA 5ILVA 3O8HA 3LA7A 4CH7A 1WJEA 3LSMA 5LEJA 2HXOA 3BPVA 1X1DA 4XSZF 3CMAI 5D6EA 1G3SA 3ABTA 2Z5UA 3OSFA 3HL2A 2ZCWA 3I54A 3OOUA 1ZLJA 2M45A 3CCQI 5J1UA 4IO9F 3WTUC 1MIJA 1E0EA 1SMYF 5LGUA 4IRGA 1SVLA 3MKYB 2HOEA 1USSA 2KRHA 3DPTA 3HSFA 2MD5A 5FLXK 4ESFA 1LE8A 1GLNA 1OCCH 4C3JJ 4NNJA 3M8JA 2XKOA 4XRFA 3OL4A 2XAGA 4I0AA 2OTLI 2AHQA 5FKLA 3CCMI 4U0VA 3SXYA 4LK0F 4IHTA 1JKOC 4Y13A 3KP6A 2R7DA 1IV8A 3BDDA 4A3MJ 2YR2A 4FX0A 5J6XA 2GIVA 1TT5B 2VODA 4BE2A 2JA8J 1DQUA 1K7AA 2CUFA 2DDBA 2M0CA 2IRFG 3F8BA 4EQQA 2PG4A 2DFIA 2P7VB 4U88A 5B5EC 2WWYA 5JVGF 1F43A 1OR7C 3SHFA 3BQZA 4BU2A 5BPDA 5GADJ 1QGPA 2PLYA 1TQMA 2W48A 3HGYA 1DDNA 3TBIA 2GXAA 5F0CA 4B48A 1HOMA 2VASA 2EZKA 4XNFA 1FOKA 1F1ZA 2HOTA 2L9RA 1WPKA 3K4JA 5D5UB 5K7HA 2FBKA 5E8GA 1G59A 1KU9A 1ON1A 2I8DA 1UMQA 4DOZA 3CF5F 1QO0D 1RZ4A 2XGCA 1V5EA 3Q0VA 2UUZA 5FLMJ 3ZGKA 1FOXA 5D6FA 2VQLA 3QYEA 1CF7B 1SFUA 2R4GA 1T0FA 2LG4A 5ICFA 5FFXA 1TZLA 3DPLC 3JAMK 3RZDJ 1I3AA 1KA8A 3LAJA 3W2VA 4BJ6C 2R7RA 4XQFA 1YIOA 1Z05A 4PJMA 1O3QA 1X2MA 2OCEA 4MFDA 5FGMA 2LY2A 3CF2A 2EJRA 1W7PA 3CCEI 4IHXA 2VPRA 2VJ5A 4XN0A 2FMYA 1ETOA 4OAYA 4OIOF 1BR2A 3B6AA 2JK3A 4F52A 3VYSB 3CCVI 1R9TJ 3J7AY 3G73A 5L3FA 2HPMA 4JX6A 5EZGA 1WJBA 3RIRA 1AOYA 1W36D 2A6TA 1CF7A 4MTDA 2IVMA 1A6QA 4A0YA 3D5LA 2E1NA 2KQRA 4AIHA 4EM1A 3LQRA 4CCLA 3FX3A 2EZHA 3BOQA 4ITVA 2WB1N 2XB5A 5DCMA 2CW0F 4W97A 3K69A 3CUQC 4D0PA 1OCRH 5GAHJ 3OYNA 2KDOA 3IRRA 4CXFA 3BROA 3BJAA 4RAGA 2E7WA 5C4JJ 1YX3A 3X2QH 4G7ZF 3A0HC 1S7EA 1SD5A 2PBIA 1OJLA 3I3LA 1BJZA 5TGTA 2IJLA 2VC0A 3OYAA 4IQ4A 3BQYA 3DEEA 5J1RA 3S32A 2X6WA 3BG7A 1K6OA 2VXZA 1G3YA 3EUHC 3FKJA 3K1NA 1G6NA 4G8XA 1FYKA 5JVTA 2ISZA 4RGSA 5GTIC 1YW7A 2XVCA 1FBQA 3FWEA 5DCMB 3WE3A 3VOEA 4HZFA 2AQFA 2ZSIB 1ETQA 1F5TA 4PGGA 2R7TA 2VKVA 4M3EA 1FP2A 2CQKA 1WSUA 1ZRDA 5BQTA 1GXQA 2KKOA 3HB9A 3OMYA 3F72A 1OMIA 2ICWG 2NYXA 4KT6A 1J9IA 4F7ZA 1ONVA 2VT3A 4JK1X 3GVAA 4EJOA 2E1MB 3K70C 2K4JA 3K2AA 5CVVA 5HLTA 3RQIA 4XLNF 1SAXA 3S14J 3JCUC 4A3GJ 3P7NA 3L2WA 2FXAA 3DPUA 3PQJA 2Q0OA 1W7PD 1V54H 4KMUX 1R1VA 2IGMA 1D1BA 4B3AA 1MSEC 2EFNA 3HHGA 5FLVA 1U2WA 1YLFA 2MH2A 2WAFA 5F6FA 1GT0C 3GXOA 1X4PA 2O5RA 3OYCA 2ZJ2A 4RGRA 1A5JA 3SEZA 4UXNA 2Z9OA 2CV0A 1FMVA 2LF8A 5FO5A 1IC8A 4AYBN 2NS8A 3BP8A 3BG3A 1MBJA 2GLOA 4EJTA 1PUEE 4HV6A 3OYBA 2LKXA 1K6YA 2M7AA 2R5ZA 3SYTA 4BNCA 2A3SA 4DNCA 4HQEA 4HF0A 5FD5A 3GTGJ 1ZARA 4WF2A 1MW7A 2E36A 4JX4A 4BDZA 3U9GA 3TP0A 5HDGA 3VYUB 1Y8RB 3NEUA 3WE2A 1T2KA 1YHQI 3LMMA 4N9HA 2VB6A 5LRRA 1MGTA 3CESA 4HYEA 3EUKL 1T8IA 4UUSA 3WU0A 1RESA 3IH3A 3AKZA 1P9QC 4V2FA 5LHGA 2DN0A 4Y33A 3J81Z 1W36C 4Q48A 1USTA 1JXSA 1UHWA 2BHYA 3FHNA 2EZLA 1W4MA 1Y1WJ 2P8TA 3BPXA 5EEGA 2MD0A 4E70A 5IP9J 1WQ2A 4RB3C 2GAUA 3GTJJ 2XSJC 4KIFA 2M34A 4M6YA 3CD6I 1FX7A 3HJEA 2DOFA 2LKPA 3KZIC 4EEFG 1H9TA 5HLIA 3NWSA 2HYFA 2NVUB 3HPGA 3HRTA 3RKYA 3KX2A 3LOCA 2QSGX 4A12A 2OUMA 2PJRA 1TWFJ 4Q5SF 3E97A 3FK6A 4RLFA 2TCTA 4I01A 1MDMA 1B59A 2A6HF 1LJ9A 3KEQA 2F5EA 1JUMA 4RAZA 4MTEA 5EEAA 4IOAF 5D8LB 4FQGA 3FXMA 4KJZA 3ZQHA 2LBFB 3OYHA 4XKCA 4XM3A 2A5YB 1KZHA 1RKTA 2TDXA 2FQ4A 1X58A 3TW6A 1P4WA 1JGSA 3H35A 4RA2A 3MMYB 3V4GA 4RS8A 5CVUA 3ZQQA 4ZDLA 1NH3A 2VKDA 2EFOA 5L3GA 2L7KA 1B9NA 3KYLA 2RAEA 3Q5FA 1WJAA 2WC2A 3KIOA 4CCKA 3L7WA 4DIQA 2HYJA 1YE9A 4E7SA 1ETXA 1P4AA 3VB2A 4CO8A 2QEXI 4BQNA 4ZH4F 3LL7A 3FXKA 2K4BA 3BR3A 3JRCA 1J0RA 5D5VB 2VBZA 3S2HJ 3H5NA 3C2GA 1Z77A 2W24A 5F1JA 1MBKA 3T5XA 1G3TA 2D1HA 4BYYA 2GWRA 4MQVA 3GTQJ 1GVJA 3VYTB 1YG2A 3FMQA 2K02A 5IY5H 4L0ZB 1HF0A 1EA3A 1PYVA 1T33A 3SEQA 3C3WA 1ZKGA 2I10A 4PCQA 4E7LA 2KJBA 3V42A 4PUSA 2BZTA 1K4SA 2HVRA 3JAMZ 3AG2H 2NXNB 2XRNA 2Y0MA 3BR5A 2LH9A 1I3QJ 2H6BA 4OIRF 5JFRA 1AWCA 2KDZA 1IXRC 4CCNA 3QPHA 2DODA 4MGRA 4B4CA 1QQIA 1HA8A 4M9SA 1HXDA 2VN2A 2PJRB 2QSFX 4UV9A 3FIWA 5DDGA 2WV1A 5L3EA 1LE8B 1P7IA 3MEXA 4JYKA 2Q8KA 1P2FA 1STZA 3F8CA 2KZVA 4BE1A 3R6SA 3H3VK 3S1NJ 3QPSA 4PK4A 3JRAA 3W6KB 2L7FP 2ZO4A 1BM9A 4NDLA 5GAGJ 4HOBA 4BACA 1XTAA 3IKTA 1A36A 4W1UA 4DQ2A 2ECCA 2KIUA 5ICGA 4BDYA 1PJRA 5DUKA 3REOA 4A3EJ 3IL2A 2BXZA 4QWQA 2JMWA 2KFDA 2L02A 1UAAA 3OY9A 3J80K 3U21A 2Z99A 1MH3A 1DP3A 4RBOA 1JJ6C 1TL8A 1YQAA 2F4OB 3Q0UA 3E5UA 4EJVA 3ESWB 4KIGA 5E17F 1ZAOA 4YIRX 3HUGA 5JR3A 3I4PA 9ANTA 1B72A 1GUUA 2GBYA 4FX4A 2ECBA 2LDUA 2XUBA 1ZG1A 1ZLKA 2NS7A 4J19A 2W1OA 1KGSA 4O3MA 5H20A 2QWWA 1K78B 1H0MA 4S05A 1XSXA 3RPUD 3DLAA 4IXAA 1D1AA 2M87A 3FMRA 1UZCA 5IP6A 4FHTA 5EEHA 1FEXA 4XL9A 1SFXA 4CZZA 2IEKA 2FOWA 4RGUA 3J7ZI 3U2RA 1SANA 1Z1DA 2Y0SN 2STTA 3D5RC 2E1CA 2BXYA 1AA7A 3JTGA 4B09A 3JW4A 1YX5A 3H92A 5HS9A 3BTLA 3SJMA 2EA4A 1A04A 4NUBA 4F92B 1IG7A 3LSKA 4ZYAA 1SVOA 2K85A 4G94A 1U8RA 5J40A 3UNGC 4CYDA 2DXIA 3GTPJ 2DBBA 3D5SC 3IRQA 4B1RA 4HEA2 2GZWA 2RGVA 4OMZA 1HBXG 3C2BA 3ROUA 4K2EA 4BXFA 2WBMA 4GYIA 1ETKA 1WKMA 2AXLA 4ABZA 3EQLF 1OPCA 1PUFB 3QWLA 4P9UA 2VE8A 3DKXA 1RUOA 2R93J 3FDYA 3GW2A 4G7HF 1BJAA 2FEZA 1ULYA 1IDYA 2IS2A 1SAUA 2FBIA 4CGZA 2X6XA 1Z6RA 3FXOA 4OOIA 2CQXA 4MFEA 3S2WA 5AIPA 3GZNB 3W2WA 5KNLA 4BQAA 1WJCA 4YELA 2RV8A 2X9DA 4JQFA 2R7WA 1BI1A 2DCEA 4KUMA 3T8TA 1HQCA 1Y1VJ 4CCMA 3E3VA 5JLXA 2V26A 1P92A 3FXRA 4HX7A 2FOKA 5GAEJ 1ITYA 3RTRA 4UY8I 2W85A 3SZTA 1J7KA 2OD5A 4GRIA 2XSDC 4XRSA 1IAWA 1HDDC 2KZGA 3J7AO 4HDVA 2JVGA 4AC0A 4A5MA 4G6TB 1GVDA 5DM7F 5D4SA 3GFIA 4KITB 3ML6A 2L5QA 3CP8A 4IOCF 4XOPA 5B3SH 3IV5A 2VT2A 1FOWA 3GLXA 1RC9A 1Q1VA 2QVOA 4BQQA 4LK1F 3UR3C 4D1QA 3E0JB 3FM3A 3ZOBA 4U7BA 4CUGA 1JUSA 4BBSJ 1A6IA 3V8KA 1WZ2A 1LEBA 1U6GA 3DWLE 2Q1ZB 3RKQA 2D2WA 4ETSA 2VJJA 2KHMA 4IHYA 2E5ZA 4BH9A 1ZG3A 2HOAA 3GWZA 3NAUA 2FNAA 3BWGA 1BOBA 3ABUA 5AIQA 3RYRA 5LEKA 1TW3A 3C18A 1N77A 2R5YB 2Z3YA 1TQPA 3DKWA 4LGWA 3J81K 3Q0WA 2K7LA 2DMPA 1IGNA 1JE8A 3GLLA 2IGNA 4ENNA 1RUNA 4Y3OA 1KYWA 4LMYA 2X85A 4NQWB 3ZQ7A 2BY1A 3K4NA 3TGNA 4C9YA 2ZMEA 3GF2A 3HHHA 1U5TA 3H9QA 2GOXB 2H6CA 1UHMA 4UVCA 3F8FA 1ZGAA 4PSXA 2M30A 3MKLA 1VFCA 2G7HA 3WG9A 2LFBA 1LDDA 1BW5A 1J75A 4JP0A 5TJJA 3QU3A 3WTZA 2QKLB 2V6CA 5J1YA 2O6GE 5C4XJ 3CMYA 2FMLA 2OAZA 2XAFA 3CCUI 1TWAJ 5HLHA 3ZPLA 2WV0A 3LSTA 4L5EA 2YX7A 3DFGA 2BVMA 4GO1A 3MD2A 5J8FA 2UV1A 1FSHA 5IPAA 1LPQA 4MIMA 2DT7B 2OF7A 4AVPA 1E3PA 5CVRA 1HW5A 2W7NA 1OCZH 2XAQA 3ASOH 2QBYA 1DU6A 3KZYA 2KJCA 1IRXA 3F6VA 3W2AA 3NWTA 1YJ9I 5DTDA 2FD5A 2IW5A 2VQCA 2P0WA 2HQAA 1Z67A 4MLOA 5BS6A 3O8GA 4Q47A 3ERMA 1WJDA 3HPHA 2QUFA 5L3DA 1K61A 5IT9Z 4NHJA 3OIOA 1X3ZB 2HPIA 2OQGA 2Z2SB 2CMPA 4E4HA 5GPCA 5EF6A 3WU2C 3S3OA 5M5WJ 3QRFF 1MBHA 1SFOJ 2DLLA 1NG7A 1MH4A 1Q1HA 3KPHA 4BL0B 4C2MJ 5K7FA 1BL0A 1YRNB 4A3LJ 2LD5A 4ENKA 3ABMH 3BTIA 3MZYA 1JJ8C 3LFUA 2KIFA 2Y2ZA 3VODA 5HOOA 1FMWA 1U9NA 5D8KB 4C2UA 4HF2A 2LY1A 1Y39A 3IC7A 3TDUC 3CQZJ 3K4LA 4HNUA 1O7FA 1F36A 1ENHA 3PUFA 2IBDA 3KLOA 1XB4A 3CDHA 1KQ9A 3HKZN 2AQEA 3CCYA 4HRIA 3JRFA 1R58A 1VQPI 1YW9A 4ZYDA 2BW3A 5TISC 4FCYA 2WAEA 4FISA 4L18B 3DU5A 4ZJZA 1FJLA 4QLCU 4I0BA 1XMKA 1U9OA 4LFUA 5D5WB 3NQOA 3CCRI 2HQRA 5K7ZA 3I9V2 1NTCA 2MC4A 1E3OC 4QTRA 5F0FA 4AVZA 2ACJA 3QOEA 4GYGA 3J7YJ 1CQTA 5GP9A 3OYIA 4O5VA 1TC3C 4GCVA 4BJ5C 1VI0A 2EA2A 2DQLA 2IP2A 2NVYJ 3GZ5A 1VQ9I 1FBSA 4N4NB 2JWTA 2OTJI 4A3JJ 2R7QA 2X4HA 3NRVA 3MAJA 2IS4A 2IAIA 1LB2A 4WXDA 3CUOA 2A69F 2HZDA 3D0SA 3K2ZA 1B8IA 4IHSA 5JLWA 2X6OA 5E1ZB 5DS9A 3TW7A 2QQBA 4DYRA 6PAXA 4Y4RA 3GEZA 3F6OA 2FUG2 4PGHA 5C3EJ 3IUOA 4LG0A 1R1TA 2CS3A 2DMNA 3SFZA 1N75A 3FKIJ 3H9GA 5HODA 2NNYA 2HKOA 2L01A 2XPVA 3BT9A 1FIAA 2LTPA 2ME0A 1XN7A 5FRMA 2W82A 1PDNC 4ANJA 3GZ6A 3OWTA 2OJED 3WTSC 4OIQF 3OS1A 4QSHA 3HRMA 2L9SA 3LFKA 5F27A 1XDSA 2G9WA 2V1XA 3R60A 2X1EA 3VEPA 2F4IA 4XN3A 2ESHA 5HDNA 2XB0X 4MEXF 1BI0A 3OYMA 4PFPA 4AM3A 2TRTA 4WWCA 3G3ZA 3WGHA 4FE4A 5A2QK 3SFIA 1TWCJ 2QBYB 1EH6A 3AFHA 2CWEA 4BEHB 2NS0A 5AONA 2PEXA 1YTYA 1JKQC 1BI3A 1S7OA 3CDLA 4O6JA 3TOAA 3HUGB 4XLHA 1A35A 3A1YA 2STWA 2XHKA 3A0BC 4WXHA 3AL0C 5DD8A 2RREA 1YS6A 4EATA 5FB2A 3LSJA 2R7FA 3IP4B 4IHVA 2XDVA 1SD7A 2K86A 2FRHA 3H3UA 4R1HA 2UZKA 2DDAA 3GFJA 2E2HJ 4NBQA 2CW7A 1MJBA 3I59A 3JREA 3FXLA 5B1AH 3CDIA 3GO5A 4ZYGA 3H36A 3WGIA 1IN8A 3MZHA 2LOOA 3K4CA 1IF1A 2E71A 2QA4I 2O8XA 1YFHA 1BC8C 2NOJB 3S1QJ 2V6EA 4BS9A 5HLGA 2JZYA 3BJOA 3BTJA 1RNLA 1B4AA 3OL3A 1VQ4I 1ORKA 4HG2A 4L9JA 5LBQA 2J5PA 1ZH5A 5DV5A 2KISA 1XMXA 4YEJA 3TKYA 1BIBA 3DEUA 2PI0A 2JUCA 2PQ8A 2E7XA 3ULQB 1D0XA 1K78A 4JOMA 1VQ8I 3L09A 3HOSA 2VBXA 2FNPA 4P5OA 1EH7A 1WFXA 1KQ0A 1ODDA 5BMZA 3V7RA 2XAHA 2XAJA 3DTEA 2CSOA 1QNTA 3H5AA 5D4RA 3RI4A 1K4TA 3EDPA 4KYWA 4HLYA 4IX7A 4MNUA 4UVAA 2DYRH 3BG9A 1BC7C 4J00A 3R0AA 4M71A 2ZJPF 1GHCA 2IT0A 3DCFA 3HTUA 3ZN1A 1W5SA 2YU9J 1SVMA 2LVSA 5GPAA 4ON0A 5M5YJ 4UUSB 3K0LA 1VQLI 2HOSA 4Q4ZF 1IUFA 1FPQA 3JRHA 2Y69H 5KHDA 3F22A 3WHBA 4BBRJ 3LSHA 3PIPF 3DU6A 1S8NA 4ZTFA 3FMSA 1MBGA 2A68F 3OOPA 4DZPA 1X2NA 4IL6C 1S9HA 3E5XA 1QA6A 3F8NA 3CJTB 1SEUA 4D7NA 2HTJA 3BJ6A 3BC8A 3TQNA 5ILUA 2Z1DA 3H0GJ 3RCOA 3OV8A 3PJRA 1XMAA 3VPRA 4DGWB 4HW0A 3T0YA 4QIWN 5DCFA 3GMEA 3D1NI 2JVHA 1TWHJ 4RB2C 1O7LA 1Z7LA 2ELJA 3PNVA 4XLEA 4A2UA 4N4OB 3CZ6A 1I6HJ 2HU9A 1R4NB 2VQGA 4GGGA 2V1UA 4C30A 3HKZA 2E5NA 4ZC3A 3I59B 3PFYA 1S3JA 4ZYEA 4XKVA 1H88C 1QZEA 1OYWA 2HZTA 2WA0A 1TQIA 4YG2F 3K70D 5FKNA 4B3XA 2Y75A 3V7SA 3EETA 2HVSA 2MLKA 4B47A 3V8LA 4CZCA 1R00A 3JR9A 3WTYC 2DA1A 3KETA 2P7CB 1AHDP 1WI9A 2A6EF 2EWNA 1QPIA 2L7ZA 3I4MJ 3S1MJ 2UXNA 1M1EB 2DTZA 3P5JA 5E20A 4NC8A 3U1DA 2H94A 5FJ8J 2ELHA 2ZMEB 2QF7A 1TT0A 4I2OA 2COMA 1IN4A 4LOCA 1D0ZA 2X1DA 2LLKA 5J8CA 1WHUA 2HEOA 3H1CA 4XICA 2DA7A 4A3CJ 2L4MA 1IRZA 3M8FA 5DUIA 1JTYA 1YOVB 5E8IA 3QOPA 3L2CA 5IT9K 1XSVA 2ID6A 1J5YA 1OR7A 3V8JA 4BXUA 4F91B 1X1CA 1BI2A 2A07F 3DBLB 1XDUA 2K27A 1MZBA 3OYEA 4XKBA 1SC7A 2H8RA 1YI2I 2JSPA 2VLAA 2XF5A 3HC7A 3TOBA 1U5TC 2OQRA 1P4XA 2AS5F 3IAS2 1MMAA 3FM5A 5CLSA 4OMYA 2ZB9A 3CUQB 3DP7A 2XC7A 1H9GA 1SFEA 2VKHA 1R22A 4PJNA 3IH2A 2D45A 2JA2A 2COBA 1HW2A 2F4MB 3JSPA 4A93J 2XGXA 3F0CA 5F0HA 5HDKA 4LIUA 1ZREA 2KL4A 4ASNA 4XLPF 4JBAA 4RM3A 4I99C 1IRFA 1GV2A 1NHAA 2MG4A 1DPRA 1SFKA 1YS7A 4FT8A 4D5FA 1U78A 2R7UA 2VJIA 5BPIA 2VE9A 2XPUA 4BAYA 2CFOA 4HAMA 3KP5A 2G7UA 1QU3A 2CGPA 3CC7I 1WWXA 1B72B 5LRSA 3TL4X 3JSOA 4RB0A 1ZGJA 4A5NA 4BY1J 4KDPA 3E1SA 4PFOA 2WY8Q 1P6RA 3S8PA 5IOZA 2EV0A 2R92J 4M72A 4Z2YA 4DBQA 2XF6A 4R8HA 1YJNI 2CUJA 3E6MA 3ZMUA 2PMZN 2ZKZA 1W7PB 1ZK8A 5CVJA 2JRTA 2CH0A 1W5CC 2KIQA 3K4BA 4IVNA 3EYIA 2CW8A 3BZCA 2DPDA 2Z16A 1ERDA 2IA2A 4A3FJ 2K3PA 3OIQA 5C44J 2RNGA 4C3HJ 2E2IJ 4KN4X 4H0EA 4C2TA 1QZYA 3DLLF 3BR6A 1B9MA 2AO9A 2ZXWH 1ZG5A 1F9NA 2VOOA 4I6ZA 2QSHX 3SQNA 3WODF 1ZR2A 2EIMH 2LNBA 3BCAA 3HBLA 3ISPA 2P6SA 2MGQA 2MBFA 1TNSA 1FZPB 1LFUP 1UELB 4CYCA 4NC6A 1BR1A 3CMMA 1XS9A 3ABLH 1FP1D 3K6GA 1YRNA 3ZQIA 2M0MA 3E7LA 5F1RA 1DP7P 2VUMJ 3FF5A 5K5OA 1JUPA 1VQMI 2CYYA 2RDPA 5E79C 2DTRA 2JJ7A 2RQQA 3ASNH 2JTVA 4AIJA 4A3DJ 1UG2A 4M3BA 4Y17A 3IH4A 3IWZA 5CYVA 3KZZA 4EV0A 1IZ1A 1XC5A 2OZ6A 3ZRGA 2LSOA 5LLQA 4RAYA 4A3KJ 2P5VA 3A02A 3FXQA 1UB9A 1P7JA 2KIMA 1LDJA 3O3KA 5FKOA 1WH5A 2K9NA 3GTKJ 2DA4A 4XRMA 1OYYA 4KN7X 2GA1A 2X0LA 3FZVA 3PL8A 1MJ9A 3G2BA 4AD9A 3BLYA 3HM5A 5IT3A 1EV7A 4S04A 4I09A 3CMEI 2M3AA 5FRNA 1IDZA 5J47A 3OIPA 2VOPA 4XLAA 1APLC 1RETA 1IN6A 3CC4I 3RZOJ 2HQNA 5B66C 4F55A 4LLGF 1JI8A 2DA3A 2LBFA 2ID3A 2XPWA 1IV6A 1FYMA 3SZGA 3GFLA 3W3CA 2E19A 2ZXHA 4JX5A 4V19K 5CJ9A 1DGRM 3BZKA 2YSRA 3PUBA 5E3OA 3QYFA 4RDUA 2YS9A 1LQ1A 1J09A 2DI3A 1BR4A 3FHZA 5F64A 4II2A 2OV7A 1GXPA 2XRLA 4U87A 1V4RA 3F21A 3G1MA 4BUPA 4GFBA 2WADA 1JKPC 4XIDA 4V2GA 4RGXA 3TO9A 2DMQA 2LREA 3C7JA 3HDDA 3VSLA 3N4MA 4Y7NJ 2HQ5A 4LJZF 5HNFA 3M3YJ 3ECHA 4KT5C 4P9FA 1IUYA 3MKWB 5EG0A 3RPQA 4PZJA 2CV2A 2IS6A 5EGOB 1LVAA 4BEHA 4Y52J 1MD0A 1MNMC 4CCJA 4RAFA 4I98B 4KNYA 1MNEA 1WVRA 3KYCB 4UUTA 4MQ9F 3HOXJ 2KRFA 2QGUA 3PSIA 1I39A 3MWMA 4CCOA 3K4KA 3BG6A 3ZMSA 1UCRA 2OPTA 1OISA 2X1CA 3CCJI 2YX4A 2R7VA 3KP7A 4A6DA 1O3SA 2LRDA 3IHUA 1TW2A 2CJJA 3I64A 3QP6A 2I5UA 1ZGWA 1J59A 4KMFA 1X3UA 2UWMA 4LB5A 1HKTA 2ADUA 2VC1A 2BVLA 4M3DA 2L2OA 2F6CA 4E7IA 2CU7A 4R79A 1LEAA 3R61A 1K79A 1ZRCA 4G6QA 3SDBA 3WHCA 2HS5A 2PFBA 1FSEA 4D9JA 2JA7J 5K5QA 1FLIA 1HCRA 2PN6A 3FBIB 5DD4A 4HLXA 4HQMA 2KLOA 3DQVC 4GXOA 2PJPA 1UHSA 2HDCA 4X6AJ 2V4JC 3CTAA 4LIVA 1QRYA 4G9YA 2WY7Q 3P9KA 1SD4A 3KEOA 2ISYA 5ILSA 1XPXA 5DYMA 3GYHX 1SMTA 3OYKA 2K3FA 1Z9CA 2EK5A 1MMDA 2LR8A 2R3SA 2L9NA 2ZXJA 3AG4H 4YIFA 1DUXC 2MC3A 1Z21A 3J80Z 1BBYA 2YU3A 1OLTA 2EV6A 2JPCA 3ZMZA 4CYCB 2O9LA 1DPUA 2DMUA 5JHUA 3B02A 4DZJA 1QBJA 3OYGA 2V9VA 4KICA 2VXDA 4HV5A 4XLCA 3C1DA 3HOVJ
chains in the Genus database with same CATH topology
1W1WE 4I99C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1W E;  4I99 C; 
#chains in the Genus database with same CATH topology
 2M2E A;  3N05 A;  1O3T A;  1K83 J;  4IQJ A;  2V79 A;  1D8J A;  2DOA A;  2F5V A;  2BY0 A;  1I1G A;  1LNW A;  1R5G A;  2MW8 A;  3HOZ J;  4HNT A;  3RJP A;  1VND A;  1I50 J;  3HEF A;  1ZQ3 P;  1R36 A;  2Z33 A;  3KEY A;  3OR2 C;  1QPM A;  3B73 A;  3L2Q A;  3L9F A;  4C3I J;  4EMS A;  2W25 A;  3HG9 A;  2K9Q A;  2MLG A;  3S2D J;  1W0T A;  5EG0 B;  4EM2 A;  1ZRF A;  3HOY J;  1NK2 P;  1X4O A;  2ESN A;  2CO5 A;  3CJR B;  1ETY A;  3IAM 2;  4BHB A;  2DPU A;  2ZSH B;  1Z7U A;  4M9Z A;  4A3I J;  3CUQ A;  3CP2 A;  2FU4 A;  3K1P A;  4RB1 A;  4II3 A;  3ZMD A;  1Z3X A;  3A4C A;  1AU7 A;  2DJN A;  3CCS I;  4L9T A;  2VKE A;  1JT0 A;  3JRI A;  3R0J A;  2X48 A;  1ZYR F;  4HST A;  1IXS B;  5KVR A;  2O7O A;  3ELK A;  3COA C;  1IJW C;  2R7S A;  5H2F C;  1IN5 A;  5E3M A;  1Y0N A;  3L00 A;  1OKR A;  2IXS A;  4I7H A;  3WU1 B;  2F2E A;  5EGO A;  2V9P A;  1S7A A;  1JHH A;  2OC6 A;  4UHT A;  5CQE A;  4J01 A;  2Y48 A;  1I27 A;  2BBY A;  4RMN A;  4I76 A;  1VQO I;  4XON A;  3SDG A;  1B6A A;  1CGP A;  3E6B A;  1Y6I A;  4AID A;  1RR7 A;  2OA4 A;  3G1L A;  1E2X A;  4L9N A;  1KYZ A;  1EJ9 A;  2DMT A;  3I5U A;  3K9T A;  2IS1 A;  4PDK A;  4M6X A;  1X1P A;  3RSN A;  1OQY A;  5KAF C;  2XGD A;  2WAQ N;  4HBL A;  2P6T A;  2DFH A;  3G71 I;  1ZHF A;  1LVK A;  3PO2 J;  3ZQL A;  2HTS A;  5FRO A;  1T95 A;  5ICE A;  1RRJ A;  5HS8 A;  2F5F A;  2G0E A;  3ZQG A;  4S0H B;  2FBH A;  4CIC A;  3HOW J;  2DK8 A;  5BNG A;  2F48 A;  1PP7 U;  4CA0 A;  1MDM B;  3DBH B;  2IPQ X;  3WGG A;  1XGM A;  1FBU A;  3CJQ B;  1H89 C;  4M3F A;  2Y30 A;  5K5R A;  3ZXS A;  2HKX A;  2B63 J;  4RLQ A;  4EVI A;  2EB7 A;  3S17 J;  3RKX A;  1T38 A;  3JRD A;  1WRJ A;  1BOA A;  1D0Y A;  4PJJ A;  2R0Q C;  1FTZ A;  4AIK A;  2BE5 F;  2DFF A;  2GIZ A;  2JRM A;  3TDZ C;  2V1D A;  3Q3S A;  2MFZ A;  2CUZ A;  3RDI A;  2BGC A;  1PP8 F;  2QQA A;  4N9I A;  1XG1 A;  2V1N A;  3N97 A;  1VQN I;  3V7C A;  4XOR A;  2DU9 A;  3A01 A;  3QPT A;  3QOD A;  3KE2 A;  1S5L C;  4A69 C;  4OIP F;  2EPF A;  3EYY A;  5F08 A;  2ZXI A;  4U7D A;  2XF7 A;  1G8X A;  5ICC A;  3I71 A;  1YW8 A;  3F23 A;  4F93 B;  3I4N J;  5HS7 A;  5JI6 A;  4IRI A;  2Q2E A;  4BGD A;  4ZDO A;  3M4O J;  3EUH A;  2QCO A;  2E1O A;  3CO6 C;  2H8W A;  1GDT A;  2QM3 A;  1WH7 A;  4IPA A;  1X1A A;  3K10 A;  2V7F A;  3L2U A;  3SZP A;  2GXG A;  3G4S I;  2FA5 A;  3HSE A;  5LD2 C;  1T39 A;  3MFK A;  4UB8 C;  2HI3 A;  2PMU A;  1W5T A;  2JQ7 A;  2X51 A;  4ESB A;  1FT9 A;  2LMD A;  3I0T A;  2P5K A;  3VSK A;  4XLF A;  1R71 A;  2DO7 A;  4A6E A;  4HPQ A;  1R1U A;  2E34 A;  2FJ1 A;  3E6D A;  4XK4 A;  4QPO A;  1R49 A;  1Z0X A;  1R4M B;  2DAO A;  2VBY A;  1J2X A;  1TP4 A;  5BOX A;  4A0Z A;  3H9J A;  3U1K A;  4NC7 A;  2WAQ A;  5LGT A;  4LG3 A;  2M9H A;  3PO3 J;  2PMZ A;  1IRG A;  1D5V A;  3OR1 C;  2EH3 A;  5ERI A;  1S72 I;  2M8G X;  3G1O A;  1UJ8 A;  2Y0S A;  4M9X A;  1OCP A;  4FAS D;  1V5G A;  3HRU A;  1G2H A;  3BR0 A;  4X0G A;  3K4M A;  1DGW Y;  4X1E A;  1E17 A;  2JA5 J;  3HRS A;  3A01 B;  1QZZ A;  4IZZ A;  1HC8 A;  2E35 A;  1LFP A;  1Y8Q B;  3O2P E;  1R7J A;  2P5L C;  3S3N A;  2L0K A;  1WJ5 A;  4WXC A;  1IXC A;  2YUS A;  2OZU A;  2LYC A;  2EIJ H;  1X19 A;  1T0F C;  5A2Q Z;  3LAP A;  5E1X A;  5HNH A;  1DU0 A;  3OYD A;  3MKZ A;  4GDF A;  3GTM J;  1X3W B;  3R4K A;  2R7O A;  2EV5 A;  2N8G A;  1C0W A;  3JRB A;  4U0Y A;  3DV8 A;  5LGN A;  4YII A;  2BV6 A;  3ECO A;  2OBP A;  4TV7 A;  2FX0 A;  1QVU A;  3B6C A;  4FE7 A;  3CCL I;  3K1M A;  2HR3 A;  4ESJ A;  2BHZ A;  2M4K A;  4B43 A;  5EYR A;  2Y31 A;  4MEY F;  5IYC J;  1ZN2 A;  4EGZ A;  3LSP A;  3DTK A;  1Y56 A;  4LLN A;  4QPQ A;  4KA4 A;  1S6L A;  2XV4 S;  3AL0 B;  3IKV A;  3WTV C;  2KRC A;  1G4D A;  1L3L A;  4AU7 A;  1TBX A;  2KMU A;  4B8X A;  1D8K A;  5FKK A;  3ZR8 X;  3MQ0 A;  2Q2E B;  3PFI A;  2B9S A;  4M3G A;  1EKE A;  2NRA C;  1RKW A;  3ZMV A;  3GTO J;  3KYD B;  5CKT A;  1MSF C;  2E2J J;  5LHH A;  2M7B A;  2V9K A;  2K9M A;  5IYD J;  2ZJQ F;  1WJF A;  4HSR A;  4FTH A;  1FTT A;  1ZTR A;  3FXJ A;  2XAS A;  3I55 I;  1H8A C;  2D1V A;  1O57 A;  4BY7 J;  1YO5 C;  4G7O F;  2QQ8 A;  2KT0 A;  2AXT C;  5L3C A;  3PNT A;  2EFP A;  2EBI A;  2RKH A;  3GUD A;  1ON2 A;  5IYB J;  1MMG A;  1MND A;  3CJN A;  3OS0 A;  1SD6 A;  3ZN0 A;  2K5C A;  3F8M A;  1V5F A;  3HXL A;  4Y15 A;  5CVI A;  3M07 A;  3LA3 A;  4LIT A;  4D7M A;  4XR6 A;  4LD5 A;  5KCM A;  4EJU A;  1HST A;  2NVQ J;  3L2V A;  2LP0 A;  3ZQC A;  1HLV A;  2OU2 A;  3RYP A;  5LFA A;  3DF8 A;  2DJI A;  3EPZ A;  4L9V A;  5FD6 A;  3PIO F;  1XGO A;  4YFN F;  3H0D A;  3ERE D;  1FOY A;  1HW1 A;  2BYV E;  2M5W A;  3MCZ A;  3WTW C;  1D3Y A;  4E7J A;  2VBW A;  3QP5 A;  2BY2 A;  2Y9Y A;  1HKQ A;  3M7G A;  3F3X A;  2P81 A;  4M73 A;  1KU2 A;  3BZ6 A;  2L4A A;  2CV1 A;  4HNV A;  1Z6T A;  2FE3 A;  2XGE A;  2DW4 A;  3BY6 A;  3JTH A;  2WTE A;  1O3R A;  4CSW A;  4IKF A;  1KU3 A;  2EQR A;  3WTX C;  3ZQF A;  1KU7 A;  1ETV A;  4ZZD A;  3OSG A;  2EFQ A;  1EH8 A;  2E1M C;  1I6X A;  1OYI A;  3OYJ A;  5H6R A;  2L9V A;  1F4K A;  1AKH B;  3BCB A;  5EZH A;  1LKX A;  3LQQ A;  3FK7 A;  5EDN A;  1XCV A;  2VI6 A;  5E3L A;  4D5C A;  1RR8 C;  3PSF A;  5M3M J;  4LB6 B;  3W6V A;  4MHG A;  5LHI A;  2GOM A;  1U0J A;  4RM2 A;  3KFW X;  5J4Y A;  2MSY A;  2HYG D;  1FIP A;  3IWF A;  3H3Z A;  2ZBK A;  3ZP5 A;  3KP2 A;  3QQA A;  1Y0U A;  1S29 A;  3VFZ A;  5FKM A;  1VQK I;  3AG3 H;  1YIJ I;  4WX9 A;  1OCO H;  4BHC A;  3I53 A;  1UFM A;  4YFX F;  4CDG A;  1XCB A;  5J3L A;  3FBN B;  2HWV A;  3M1C A;  2UXX A;  2W84 A;  2A05 A;  2GXB A;  1KON A;  2HDW A;  4H4K C;  2H1K A;  2BEO A;  3FIS A;  1MMS A;  5IOY A;  4HDU A;  3TED A;  2DYS H;  2H27 A;  2MAB A;  4DYC A;  1PVE A;  3L1P A;  4XSX F;  1V3F A;  1B1B A;  2LKS A;  1XGN A;  4BHP A;  1JGG A;  1W0U A;  2B0L A;  2DFE A;  4OIN F;  3TMO A;  3OYL A;  1JKR C;  4AWX B;  4FET A;  4CHU A;  4XRS G;  2EIL H;  3RPU A;  1ACI A;  4M74 A;  3TP3 A;  2DT5 A;  4KIB A;  1MMN A;  3CLQ A;  3MN2 A;  4NB5 A;  3LWF A;  2CG4 A;  2ZJR F;  1W1W E;  1HKS A;  2DK5 A;  1I1S A;  4E7K A;  2ZFW A;  1T98 A;  2XIG A;  2B7E A;  4ZDP A;  5GTH C;  1BN5 A;  2ZNZ A;  3ZMT A;  1VQ5 I;  1RPW A;  3HOU J;  2HXI A;  2MYS A;  4XMY A;  1QVT A;  3BR1 A;  2HGC A;  1BA5 A;  2FQ3 A;  1VF9 A;  2E60 A;  1FWZ A;  5L3B A;  3I56 I;  3GX4 X;  5H6Q A;  3HIF A;  2M4G A;  1LDK B;  4YFK F;  1Z3Y A;  3S15 J;  1XX5 A;  2W4S A;  3LSR A;  4U0W A;  3S3M A;  1R23 A;  1D1C A;  3F9K A;  2R5Y A;  3HTS B;  4UUV A;  2JA6 J;  3EUA A;  4HA8 A;  4HX8 A;  4AYB A;  2C6Y A;  1TTY A;  3I58 A;  3RKW A;  1MBE A;  3WTT C;  2LC2 A;  2H1L A;  2A5W A;  1R6R A;  1YYV A;  1OFC X;  4A0X A;  3QYB A;  4XKW A;  2P4W A;  4EJW A;  4BJT A;  2H09 A;  3FXU A;  4LLL A;  3VDX A;  3HYI A;  3ONQ A;  4IRH A;  1WGX A;  5DM6 F;  2W57 A;  2XRO A;  2YPR A;  2NVT J;  2R7X A;  2K40 A;  4A3B J;  1YJW I;  1HDP A;  2HVQ A;  4B44 A;  3P9C A;  3P9I A;  4OU0 A;  5J4V A;  4WK8 F;  2JUG A;  4P55 A;  4IHW A;  3BG5 A;  2IGO A;  3PQK A;  2ME6 A;  1L0O C;  2W00 A;  2CQ7 A;  2PX9 A;  2BY3 A;  1TNT A;  2IA0 A;  2NAZ A;  1X1B A;  1BW6 A;  3GBG A;  4MO7 A;  2VIX A;  4DBR A;  3DBR B;  3DEW A;  4AUX A;  5KAI C;  3QAH A;  3G6E I;  2NNN A;  1PUF A;  2LY9 A;  2NOG A;  3M9A A;  1QHG A;  3Q9S A;  2GA2 A;  2HDD A;  3T8R A;  3A2K A;  2MH9 A;  2QEN A;  3S93 A;  4Z6Y A;  2CUE A;  1MBF A;  1MJA A;  1MKM A;  3BR2 A;  4UVB A;  3ZCO A;  2DT6 A;  1FC3 A;  4ZTJ A;  3E5Q A;  2KP6 A;  1JHF A;  1EF4 A;  3H5R A;  2RN7 A;  1VZ0 A;  4HX4 A;  4PSW A;  5M3F J;  3HZJ A;  4L5J A;  2CQN A;  1VTN C;  2K9S A;  3LNQ A;  2JSC A;  1N25 A;  4G6D A;  1B8I B;  1R5I D;  4YRV A;  2WB1 A;  2HFH A;  3MZ8 A;  2DQR A;  4BXX J;  4KIS A;  2F5D A;  1LFB A;  1E3H A;  2M1B A;  2QKM B;  2XKP A;  5FLX Z;  4ENJ A;  1T56 A;  1A31 A;  3S16 J;  2QZ8 A;  3MVP A;  5M5X J;  2QYO A;  3PNY A;  3L2R A;  3HGG A;  4E7Z A;  2VL8 A;  1WCM J;  3C2H A;  4DW6 A;  3VWB A;  2ETH A;  3OS2 A;  1VQ6 I;  3O6B B;  1BIA A;  5DEQ A;  1IN7 A;  3KP3 A;  1Z91 A;  2JT1 A;  1WI3 A;  2VJ4 A;  1O4X A;  2O3F A;  5JHF A;  1JT6 A;  1U3E M;  2D5V A;  2VON A;  3T1B A;  5ED4 A;  2VPL A;  1FY7 A;  2OCC H;  2O8K A;  2DA6 A;  2EZI A;  4L0Y B;  2DA2 A;  5E18 F;  2BW3 B;  3WG7 H;  1ETW A;  2DOE A;  3KCC A;  3GTL J;  2XAU A;  3DKY A;  1R5H A;  4E6K G;  1RIO H;  3QU6 A;  1T6S A;  4I02 A;  2NVX J;  2FF4 A;  2IA1 A;  2HNH A;  1N78 A;  3GCM A;  3LSI A;  3KLN A;  3VYR B;  1ZEL A;  2L7M P;  5F04 A;  4OWR B;  3KP4 A;  3W6J B;  5IP7 J;  2GQQ A;  5E1W A;  2L3D A;  4BQO A;  2R5Z B;  1XD7 A;  1NK3 P;  3Q9V A;  1ZR4 A;  4DJA A;  5TRD A;  3HSR A;  4P96 A;  4PJ0 C;  5K1Y A;  3GFM A;  2RVC A;  1FNN A;  5FFZ A;  3QPL A;  2CQQ A;  2L54 A;  2X6Y A;  1NG6 A;  2JN6 A;  2QQ9 A;  2ZFU A;  4UB6 C;  1HSJ A;  2Y9Z A;  1VQ7 I;  4XOT A;  4KFC A;  4G12 A;  1G3W A;  1LUJ B;  3DTI A;  2FSW A;  1POG A;  4ZZL A;  1TWG J;  2ELK A;  1T08 B;  4LG0 B;  2LF7 A;  2M8E A;  3AAF A;  3TO7 A;  3S1R J;  3A03 A;  2ZME C;  2QLZ A;  4IJA A;  1JTX A;  3LSG A;  1UG0 A;  3TO6 A;  2KPM A;  2RC4 A;  3PM1 A;  1IO2 A;  3M1E A;  4DYQ A;  4IF4 A;  2ZNY A;  3OYF A;  1IW7 F;  1I5Z A;  4EGY A;  3JRG A;  2IGK A;  2O03 A;  4HF1 A;  5CPR B;  3LA2 A;  3M8E A;  4E7H A;  4N0B A;  4L5I A;  4NQW A;  4IEJ A;  2O0Y A;  1REP C;  4UV8 A;  1U5T B;  2GM4 A;  2RNJ A;  3DXJ F;  3NAR A;  4XBF A;  1AKH A;  2LK2 A;  2VQH A;  2BOL A;  2A61 A;  1KQ8 A;  1XGS A;  2J5O A;  2DA5 A;  5EJC A;  3CC2 I;  1U8B A;  2CRG A;  2EIK H;  4OAZ A;  2EFW A;  5E3N A;  3UKG A;  2MA3 A;  2PMH A;  3ABK H;  1FYL A;  3E6C C;  4BKX A;  2RQP A;  4F3Q A;  3CO7 C;  4EM0 B;  2ZC2 A;  3CLO A;  4ENM A;  2JPB A;  1YIT I;  1D5Y A;  4BE0 A;  4P1W A;  4PJL A;  4UNO A;  2EIN H;  1QHH D;  5B1B H;  2F5C A;  3RQ4 A;  1RI7 A;  2K9L A;  5CQG A;  3HOT A;  1TLH B;  2R7Z J;  1V55 H;  5HVQ C;  1OCT C;  2O61 A;  1GV5 A;  3K7A J;  4M6V A;  1XSD A;  2CFX A;  5D5X B;  3AG1 H;  5KK1 A;  4ZYH A;  4WCG A;  3BTC A;  5ILV A;  3O8H A;  3LA7 A;  4CH7 A;  1WJE A;  3LSM A;  5LEJ A;  2HXO A;  3BPV A;  1X1D A;  4XSZ F;  3CMA I;  5D6E A;  1G3S A;  3ABT A;  2Z5U A;  3OSF A;  3HL2 A;  2ZCW A;  3I54 A;  3OOU A;  1ZLJ A;  2M45 A;  3CCQ I;  5J1U A;  4IO9 F;  3WTU C;  1MIJ A;  1E0E A;  1SMY F;  5LGU A;  4IRG A;  1SVL A;  3MKY B;  2HOE A;  1USS A;  2KRH A;  3DPT A;  3HSF A;  2MD5 A;  5FLX K;  4ESF A;  1LE8 A;  1GLN A;  1OCC H;  4C3J J;  4NNJ A;  3M8J A;  2XKO A;  4XRF A;  3OL4 A;  2XAG A;  4I0A A;  2OTL I;  2AHQ A;  5FKL A;  3CCM I;  4U0V A;  3SXY A;  4LK0 F;  4IHT A;  1JKO C;  4Y13 A;  3KP6 A;  2R7D A;  1IV8 A;  3BDD A;  4A3M J;  2YR2 A;  4FX0 A;  5J6X A;  2GIV A;  1TT5 B;  2VOD A;  4BE2 A;  2JA8 J;  1DQU A;  1K7A A;  2CUF A;  2DDB A;  2M0C A;  2IRF G;  3F8B A;  4EQQ A;  2PG4 A;  2DFI A;  2P7V B;  4U88 A;  5B5E C;  2WWY A;  5JVG F;  1F43 A;  1OR7 C;  3SHF A;  3BQZ A;  4BU2 A;  5BPD A;  5GAD J;  1QGP A;  2PLY A;  1TQM A;  2W48 A;  3HGY A;  1DDN A;  3TBI A;  2GXA A;  5F0C A;  4B48 A;  1HOM A;  2VAS A;  2EZK A;  4XNF A;  1FOK A;  1F1Z A;  2HOT A;  2L9R A;  1WPK A;  3K4J A;  5D5U B;  5K7H A;  2FBK A;  5E8G A;  1G59 A;  1KU9 A;  1ON1 A;  2I8D A;  1UMQ A;  4DOZ A;  3CF5 F;  1QO0 D;  1RZ4 A;  2XGC A;  1V5E A;  3Q0V A;  2UUZ A;  5FLM J;  3ZGK A;  1FOX A;  5D6F A;  2VQL A;  3QYE A;  1CF7 B;  1SFU A;  2R4G A;  1T0F A;  2LG4 A;  5ICF A;  5FFX A;  1TZL A;  3DPL C;  3JAM K;  3RZD J;  1I3A A;  1KA8 A;  3LAJ A;  3W2V A;  4BJ6 C;  2R7R A;  4XQF A;  1YIO A;  1Z05 A;  4PJM A;  1O3Q A;  1X2M A;  2OCE A;  4MFD A;  5FGM A;  2LY2 A;  3CF2 A;  2EJR A;  1W7P A;  3CCE I;  4IHX A;  2VPR A;  2VJ5 A;  4XN0 A;  2FMY A;  1ETO A;  4OAY A;  4OIO F;  1BR2 A;  3B6A A;  2JK3 A;  4F52 A;  3VYS B;  3CCV I;  1R9T J;  3J7A Y;  3G73 A;  5L3F A;  2HPM A;  4JX6 A;  5EZG A;  1WJB A;  3RIR A;  1AOY A;  1W36 D;  2A6T A;  1CF7 A;  4MTD A;  2IVM A;  1A6Q A;  4A0Y A;  3D5L A;  2E1N A;  2KQR A;  4AIH A;  4EM1 A;  3LQR A;  4CCL A;  3FX3 A;  2EZH A;  3BOQ A;  4ITV A;  2WB1 N;  2XB5 A;  5DCM A;  2CW0 F;  4W97 A;  3K69 A;  3CUQ C;  4D0P A;  1OCR H;  5GAH J;  3OYN A;  2KDO A;  3IRR A;  4CXF A;  3BRO A;  3BJA A;  4RAG A;  2E7W A;  5C4J J;  1YX3 A;  3X2Q H;  4G7Z F;  3A0H C;  1S7E A;  1SD5 A;  2PBI A;  1OJL A;  3I3L A;  1BJZ A;  5TGT A;  2IJL A;  2VC0 A;  3OYA A;  4IQ4 A;  3BQY A;  3DEE A;  5J1R A;  3S32 A;  2X6W A;  3BG7 A;  1K6O A;  2VXZ A;  1G3Y A;  3EUH C;  3FKJ A;  3K1N A;  1G6N A;  4G8X A;  1FYK A;  5JVT A;  2ISZ A;  4RGS A;  5GTI C;  1YW7 A;  2XVC A;  1FBQ A;  3FWE A;  5DCM B;  3WE3 A;  3VOE A;  4HZF A;  2AQF A;  2ZSI B;  1ETQ A;  1F5T A;  4PGG A;  2R7T A;  2VKV A;  4M3E A;  1FP2 A;  2CQK A;  1WSU A;  1ZRD A;  5BQT A;  1GXQ A;  2KKO A;  3HB9 A;  3OMY A;  3F72 A;  1OMI A;  2ICW G;  2NYX A;  4KT6 A;  1J9I A;  4F7Z A;  1ONV A;  2VT3 A;  4JK1 X;  3GVA A;  4EJO A;  2E1M B;  3K70 C;  2K4J A;  3K2A A;  5CVV A;  5HLT A;  3RQI A;  4XLN F;  1SAX A;  3S14 J;  3JCU C;  4A3G J;  3P7N A;  3L2W A;  2FXA A;  3DPU A;  3PQJ A;  2Q0O A;  1W7P D;  1V54 H;  4KMU X;  1R1V A;  2IGM A;  1D1B A;  4B3A A;  1MSE C;  2EFN A;  3HHG A;  5FLV A;  1U2W A;  1YLF A;  2MH2 A;  2WAF A;  5F6F A;  1GT0 C;  3GXO A;  1X4P A;  2O5R A;  3OYC A;  2ZJ2 A;  4RGR A;  1A5J A;  3SEZ A;  4UXN A;  2Z9O A;  2CV0 A;  1FMV A;  2LF8 A;  5FO5 A;  1IC8 A;  4AYB N;  2NS8 A;  3BP8 A;  3BG3 A;  1MBJ A;  2GLO A;  4EJT A;  1PUE E;  4HV6 A;  3OYB A;  2LKX A;  1K6Y A;  2M7A A;  2R5Z A;  3SYT A;  4BNC A;  2A3S A;  4DNC A;  4HQE A;  4HF0 A;  5FD5 A;  3GTG J;  1ZAR A;  4WF2 A;  1MW7 A;  2E36 A;  4JX4 A;  4BDZ A;  3U9G A;  3TP0 A;  5HDG A;  3VYU B;  1Y8R B;  3NEU A;  3WE2 A;  1T2K A;  1YHQ I;  3LMM A;  4N9H A;  2VB6 A;  5LRR A;  1MGT A;  3CES A;  4HYE A;  3EUK L;  1T8I A;  4UUS A;  3WU0 A;  1RES A;  3IH3 A;  3AKZ A;  1P9Q C;  4V2F A;  5LHG A;  2DN0 A;  4Y33 A;  3J81 Z;  1W36 C;  4Q48 A;  1UST A;  1JXS A;  1UHW A;  2BHY A;  3FHN A;  2EZL A;  1W4M A;  1Y1W J;  2P8T A;  3BPX A;  5EEG A;  2MD0 A;  4E70 A;  5IP9 J;  1WQ2 A;  4RB3 C;  2GAU A;  3GTJ J;  2XSJ C;  4KIF A;  2M34 A;  4M6Y A;  3CD6 I;  1FX7 A;  3HJE A;  2DOF A;  2LKP A;  3KZI C;  4EEF G;  1H9T A;  5HLI A;  3NWS A;  2HYF A;  2NVU B;  3HPG A;  3HRT A;  3RKY A;  3KX2 A;  3LOC A;  2QSG X;  4A12 A;  2OUM A;  2PJR A;  1TWF J;  4Q5S F;  3E97 A;  3FK6 A;  4RLF A;  2TCT A;  4I01 A;  1MDM A;  1B59 A;  2A6H F;  1LJ9 A;  3KEQ A;  2F5E A;  1JUM A;  4RAZ A;  4MTE A;  5EEA A;  4IOA F;  5D8L B;  4FQG A;  3FXM A;  4KJZ A;  3ZQH A;  2LBF B;  3OYH A;  4XKC A;  4XM3 A;  2A5Y B;  1KZH A;  1RKT A;  2TDX A;  2FQ4 A;  1X58 A;  3TW6 A;  1P4W A;  1JGS A;  3H35 A;  4RA2 A;  3MMY B;  3V4G A;  4RS8 A;  5CVU A;  3ZQQ A;  4ZDL A;  1NH3 A;  2VKD A;  2EFO A;  5L3G A;  2L7K A;  1B9N A;  3KYL A;  2RAE A;  3Q5F A;  1WJA A;  2WC2 A;  3KIO A;  4CCK A;  3L7W A;  4DIQ A;  2HYJ A;  1YE9 A;  4E7S A;  1ETX A;  1P4A A;  3VB2 A;  4CO8 A;  2QEX I;  4BQN A;  4ZH4 F;  3LL7 A;  3FXK A;  2K4B A;  3BR3 A;  3JRC A;  1J0R A;  5D5V B;  2VBZ A;  3S2H J;  3H5N A;  3C2G A;  1Z77 A;  2W24 A;  5F1J A;  1MBK A;  3T5X A;  1G3T A;  2D1H A;  4BYY A;  2GWR A;  4MQV A;  3GTQ J;  1GVJ A;  3VYT B;  1YG2 A;  3FMQ A;  2K02 A;  5IY5 H;  4L0Z B;  1HF0 A;  1EA3 A;  1PYV A;  1T33 A;  3SEQ A;  3C3W A;  1ZKG A;  2I10 A;  4PCQ A;  4E7L A;  2KJB A;  3V42 A;  4PUS A;  2BZT A;  1K4S A;  2HVR A;  3JAM Z;  3AG2 H;  2NXN B;  2XRN A;  2Y0M A;  3BR5 A;  2LH9 A;  1I3Q J;  2H6B A;  4OIR F;  5JFR A;  1AWC A;  2KDZ A;  1IXR C;  4CCN A;  3QPH A;  2DOD A;  4MGR A;  4B4C A;  1QQI A;  1HA8 A;  4M9S A;  1HXD A;  2VN2 A;  2PJR B;  2QSF X;  4UV9 A;  3FIW A;  5DDG A;  2WV1 A;  5L3E A;  1LE8 B;  1P7I A;  3MEX A;  4JYK A;  2Q8K A;  1P2F A;  1STZ A;  3F8C A;  2KZV A;  4BE1 A;  3R6S A;  3H3V K;  3S1N J;  3QPS A;  4PK4 A;  3JRA A;  3W6K B;  2L7F P;  2ZO4 A;  1BM9 A;  4NDL A;  5GAG J;  4HOB A;  4BAC A;  1XTA A;  3IKT A;  1A36 A;  4W1U A;  4DQ2 A;  2ECC A;  2KIU A;  5ICG A;  4BDY A;  1PJR A;  5DUK A;  3REO A;  4A3E J;  3IL2 A;  2BXZ A;  4QWQ A;  2JMW A;  2KFD A;  2L02 A;  1UAA A;  3OY9 A;  3J80 K;  3U21 A;  2Z99 A;  1MH3 A;  1DP3 A;  4RBO A;  1JJ6 C;  1TL8 A;  1YQA A;  2F4O B;  3Q0U A;  3E5U A;  4EJV A;  3ESW B;  4KIG A;  5E17 F;  1ZAO A;  4YIR X;  3HUG A;  5JR3 A;  3I4P A;  9ANT A;  1B72 A;  1GUU A;  2GBY A;  4FX4 A;  2ECB A;  2LDU A;  2XUB A;  1ZG1 A;  1ZLK A;  2NS7 A;  4J19 A;  2W1O A;  1KGS A;  4O3M A;  5H20 A;  2QWW A;  1K78 B;  1H0M A;  4S05 A;  1XSX A;  3RPU D;  3DLA A;  4IXA A;  1D1A A;  2M87 A;  3FMR A;  1UZC A;  5IP6 A;  4FHT A;  5EEH A;  1FEX A;  4XL9 A;  1SFX A;  4CZZ A;  2IEK A;  2FOW A;  4RGU A;  3J7Z I;  3U2R A;  1SAN A;  1Z1D A;  2Y0S N;  2STT A;  3D5R C;  2E1C A;  2BXY A;  1AA7 A;  3JTG A;  4B09 A;  3JW4 A;  1YX5 A;  3H92 A;  5HS9 A;  3BTL A;  3SJM A;  2EA4 A;  1A04 A;  4NUB A;  4F92 B;  1IG7 A;  3LSK A;  4ZYA A;  1SVO A;  2K85 A;  4G94 A;  1U8R A;  5J40 A;  3UNG C;  4CYD A;  2DXI A;  3GTP J;  2DBB A;  3D5S C;  3IRQ A;  4B1R A;  4HEA 2;  2GZW A;  2RGV A;  4OMZ A;  1HBX G;  3C2B A;  3ROU A;  4K2E A;  4BXF A;  2WBM A;  4GYI A;  1ETK A;  1WKM A;  2AXL A;  4ABZ A;  3EQL F;  1OPC A;  1PUF B;  3QWL A;  4P9U A;  2VE8 A;  3DKX A;  1RUO A;  2R93 J;  3FDY A;  3GW2 A;  4G7H F;  1BJA A;  2FEZ A;  1ULY A;  1IDY A;  2IS2 A;  1SAU A;  2FBI A;  4CGZ A;  2X6X A;  1Z6R A;  3FXO A;  4OOI A;  2CQX A;  4MFE A;  3S2W A;  5AIP A;  3GZN B;  3W2W A;  5KNL A;  4BQA A;  1WJC A;  4YEL A;  2RV8 A;  2X9D A;  4JQF A;  2R7W A;  1BI1 A;  2DCE A;  4KUM A;  3T8T A;  1HQC A;  1Y1V J;  4CCM A;  3E3V A;  5JLX A;  2V26 A;  1P92 A;  3FXR A;  4HX7 A;  2FOK A;  5GAE J;  1ITY A;  3RTR A;  4UY8 I;  2W85 A;  3SZT A;  1J7K A;  2OD5 A;  4GRI A;  2XSD C;  4XRS A;  1IAW A;  1HDD C;  2KZG A;  3J7A O;  4HDV A;  2JVG A;  4AC0 A;  4A5M A;  4G6T B;  1GVD A;  5DM7 F;  5D4S A;  3GFI A;  4KIT B;  3ML6 A;  2L5Q A;  3CP8 A;  4IOC F;  4XOP A;  5B3S H;  3IV5 A;  2VT2 A;  1FOW A;  3GLX A;  1RC9 A;  1Q1V A;  2QVO A;  4BQQ A;  4LK1 F;  3UR3 C;  4D1Q A;  3E0J B;  3FM3 A;  3ZOB A;  4U7B A;  4CUG A;  1JUS A;  4BBS J;  1A6I A;  3V8K A;  1WZ2 A;  1LEB A;  1U6G A;  3DWL E;  2Q1Z B;  3RKQ A;  2D2W A;  4ETS A;  2VJJ A;  2KHM A;  4IHY A;  2E5Z A;  4BH9 A;  1ZG3 A;  2HOA A;  3GWZ A;  3NAU A;  2FNA A;  3BWG A;  1BOB A;  3ABU A;  5AIQ A;  3RYR A;  5LEK A;  1TW3 A;  3C18 A;  1N77 A;  2R5Y B;  2Z3Y A;  1TQP A;  3DKW A;  4LGW A;  3J81 K;  3Q0W A;  2K7L A;  2DMP A;  1IGN A;  1JE8 A;  3GLL A;  2IGN A;  4ENN A;  1RUN A;  4Y3O A;  1KYW A;  4LMY A;  2X85 A;  4NQW B;  3ZQ7 A;  2BY1 A;  3K4N A;  3TGN A;  4C9Y A;  2ZME A;  3GF2 A;  3HHH A;  1U5T A;  3H9Q A;  2GOX B;  2H6C A;  1UHM A;  4UVC A;  3F8F A;  1ZGA A;  4PSX A;  2M30 A;  3MKL A;  1VFC A;  2G7H A;  3WG9 A;  2LFB A;  1LDD A;  1BW5 A;  1J75 A;  4JP0 A;  5TJJ A;  3QU3 A;  3WTZ A;  2QKL B;  2V6C A;  5J1Y A;  2O6G E;  5C4X J;  3CMY A;  2FML A;  2OAZ A;  2XAF A;  3CCU I;  1TWA J;  5HLH A;  3ZPL A;  2WV0 A;  3LST A;  4L5E A;  2YX7 A;  3DFG A;  2BVM A;  4GO1 A;  3MD2 A;  5J8F A;  2UV1 A;  1FSH A;  5IPA A;  1LPQ A;  4MIM A;  2DT7 B;  2OF7 A;  4AVP A;  1E3P A;  5CVR A;  1HW5 A;  2W7N A;  1OCZ H;  2XAQ A;  3ASO H;  2QBY A;  1DU6 A;  3KZY A;  2KJC A;  1IRX A;  3F6V A;  3W2A A;  3NWT A;  1YJ9 I;  5DTD A;  2FD5 A;  2IW5 A;  2VQC A;  2P0W A;  2HQA A;  1Z67 A;  4MLO A;  5BS6 A;  3O8G A;  4Q47 A;  3ERM A;  1WJD A;  3HPH A;  2QUF A;  5L3D A;  1K61 A;  5IT9 Z;  4NHJ A;  3OIO A;  1X3Z B;  2HPI A;  2OQG A;  2Z2S B;  2CMP A;  4E4H A;  5GPC A;  5EF6 A;  3WU2 C;  3S3O A;  5M5W J;  3QRF F;  1MBH A;  1SFO J;  2DLL A;  1NG7 A;  1MH4 A;  1Q1H A;  3KPH A;  4BL0 B;  4C2M J;  5K7F A;  1BL0 A;  1YRN B;  4A3L J;  2LD5 A;  4ENK A;  3ABM H;  3BTI A;  3MZY A;  1JJ8 C;  3LFU A;  2KIF A;  2Y2Z A;  3VOD A;  5HOO A;  1FMW A;  1U9N A;  5D8K B;  4C2U A;  4HF2 A;  2LY1 A;  1Y39 A;  3IC7 A;  3TDU C;  3CQZ J;  3K4L A;  4HNU A;  1O7F A;  1F36 A;  1ENH A;  3PUF A;  2IBD A;  3KLO A;  1XB4 A;  3CDH A;  1KQ9 A;  3HKZ N;  2AQE A;  3CCY A;  4HRI A;  3JRF A;  1R58 A;  1VQP I;  1YW9 A;  4ZYD A;  2BW3 A;  5TIS C;  4FCY A;  2WAE A;  4FIS A;  4L18 B;  3DU5 A;  4ZJZ A;  1FJL A;  4QLC U;  4I0B A;  1XMK A;  1U9O A;  4LFU A;  5D5W B;  3NQO A;  3CCR I;  2HQR A;  5K7Z A;  3I9V 2;  1NTC A;  2MC4 A;  1E3O C;  4QTR A;  5F0F A;  4AVZ A;  2ACJ A;  3QOE A;  4GYG A;  3J7Y J;  1CQT A;  5GP9 A;  3OYI A;  4O5V A;  1TC3 C;  4GCV A;  4BJ5 C;  1VI0 A;  2EA2 A;  2DQL A;  2IP2 A;  2NVY J;  3GZ5 A;  1VQ9 I;  1FBS A;  4N4N B;  2JWT A;  2OTJ I;  4A3J J;  2R7Q A;  2X4H A;  3NRV A;  3MAJ A;  2IS4 A;  2IAI A;  1LB2 A;  4WXD A;  3CUO A;  2A69 F;  2HZD A;  3D0S A;  3K2Z A;  1B8I A;  4IHS A;  5JLW A;  2X6O A;  5E1Z B;  5DS9 A;  3TW7 A;  2QQB A;  4DYR A;  6PAX A;  4Y4R A;  3GEZ A;  3F6O A;  2FUG 2;  4PGH A;  5C3E J;  3IUO A;  4LG0 A;  1R1T A;  2CS3 A;  2DMN A;  3SFZ A;  1N75 A;  3FKI J;  3H9G A;  5HOD A;  2NNY A;  2HKO A;  2L01 A;  2XPV A;  3BT9 A;  1FIA A;  2LTP A;  2ME0 A;  1XN7 A;  5FRM A;  2W82 A;  1PDN C;  4ANJ A;  3GZ6 A;  3OWT A;  2OJE D;  3WTS C;  4OIQ F;  3OS1 A;  4QSH A;  3HRM A;  2L9S A;  3LFK A;  5F27 A;  1XDS A;  2G9W A;  2V1X A;  3R60 A;  2X1E A;  3VEP A;  2F4I A;  4XN3 A;  2ESH A;  5HDN A;  2XB0 X;  4MEX F;  1BI0 A;  3OYM A;  4PFP A;  4AM3 A;  2TRT A;  4WWC A;  3G3Z A;  3WGH A;  4FE4 A;  5A2Q K;  3SFI A;  1TWC J;  2QBY B;  1EH6 A;  3AFH A;  2CWE A;  4BEH B;  2NS0 A;  5AON A;  2PEX A;  1YTY A;  1JKQ C;  1BI3 A;  1S7O A;  3CDL A;  4O6J A;  3TOA A;  3HUG B;  4XLH A;  1A35 A;  3A1Y A;  2STW A;  2XHK A;  3A0B C;  4WXH A;  3AL0 C;  5DD8 A;  2RRE A;  1YS6 A;  4EAT A;  5FB2 A;  3LSJ A;  2R7F A;  3IP4 B;  4IHV A;  2XDV A;  1SD7 A;  2K86 A;  2FRH A;  3H3U A;  4R1H A;  2UZK A;  2DDA A;  3GFJ A;  2E2H J;  4NBQ A;  2CW7 A;  1MJB A;  3I59 A;  3JRE A;  3FXL A;  5B1A H;  3CDI A;  3GO5 A;  4ZYG A;  3H36 A;  3WGI A;  1IN8 A;  3MZH A;  2LOO A;  3K4C A;  1IF1 A;  2E71 A;  2QA4 I;  2O8X A;  1YFH A;  1BC8 C;  2NOJ B;  3S1Q J;  2V6E A;  4BS9 A;  5HLG A;  2JZY A;  3BJO A;  3BTJ A;  1RNL A;  1B4A A;  3OL3 A;  1VQ4 I;  1ORK A;  4HG2 A;  4L9J A;  5LBQ A;  2J5P A;  1ZH5 A;  5DV5 A;  2KIS A;  1XMX A;  4YEJ A;  3TKY A;  1BIB A;  3DEU A;  2PI0 A;  2JUC A;  2PQ8 A;  2E7X A;  3ULQ B;  1D0X A;  1K78 A;  4JOM A;  1VQ8 I;  3L09 A;  3HOS A;  2VBX A;  2FNP A;  4P5O A;  1EH7 A;  1WFX A;  1KQ0 A;  1ODD A;  5BMZ A;  3V7R A;  2XAH A;  2XAJ A;  3DTE A;  2CSO A;  1QNT A;  3H5A A;  5D4R A;  3RI4 A;  1K4T A;  3EDP A;  4KYW A;  4HLY A;  4IX7 A;  4MNU A;  4UVA A;  2DYR H;  3BG9 A;  1BC7 C;  4J00 A;  3R0A A;  4M71 A;  2ZJP F;  1GHC A;  2IT0 A;  3DCF A;  3HTU A;  3ZN1 A;  1W5S A;  2YU9 J;  1SVM A;  2LVS A;  5GPA A;  4ON0 A;  5M5Y J;  4UUS B;  3K0L A;  1VQL I;  2HOS A;  4Q4Z F;  1IUF A;  1FPQ A;  3JRH A;  2Y69 H;  5KHD A;  3F22 A;  3WHB A;  4BBR J;  3LSH A;  3PIP F;  3DU6 A;  1S8N A;  4ZTF A;  3FMS A;  1MBG A;  2A68 F;  3OOP A;  4DZP A;  1X2N A;  4IL6 C;  1S9H A;  3E5X A;  1QA6 A;  3F8N A;  3CJT B;  1SEU A;  4D7N A;  2HTJ A;  3BJ6 A;  3BC8 A;  3TQN A;  5ILU A;  2Z1D A;  3H0G J;  3RCO A;  3OV8 A;  3PJR A;  1XMA A;  3VPR A;  4DGW B;  4HW0 A;  3T0Y A;  4QIW N;  5DCF A;  3GME A;  3D1N I;  2JVH A;  1TWH J;  4RB2 C;  1O7L A;  1Z7L A;  2ELJ A;  3PNV A;  4XLE A;  4A2U A;  4N4O B;  3CZ6 A;  1I6H J;  2HU9 A;  1R4N B;  2VQG A;  4GGG A;  2V1U A;  4C30 A;  3HKZ A;  2E5N A;  4ZC3 A;  3I59 B;  3PFY A;  1S3J A;  4ZYE A;  4XKV A;  1H88 C;  1QZE A;  1OYW A;  2HZT A;  2WA0 A;  1TQI A;  4YG2 F;  3K70 D;  5FKN A;  4B3X A;  2Y75 A;  3V7S A;  3EET A;  2HVS A;  2MLK A;  4B47 A;  3V8L A;  4CZC A;  1R00 A;  3JR9 A;  3WTY C;  2DA1 A;  3KET A;  2P7C B;  1AHD P;  1WI9 A;  2A6E F;  2EWN A;  1QPI A;  2L7Z A;  3I4M J;  3S1M J;  2UXN A;  1M1E B;  2DTZ A;  3P5J A;  5E20 A;  4NC8 A;  3U1D A;  2H94 A;  5FJ8 J;  2ELH A;  2ZME B;  2QF7 A;  1TT0 A;  4I2O A;  2COM A;  1IN4 A;  4LOC A;  1D0Z A;  2X1D A;  2LLK A;  5J8C A;  1WHU A;  2HEO A;  3H1C A;  4XIC A;  2DA7 A;  4A3C J;  2L4M A;  1IRZ A;  3M8F A;  5DUI A;  1JTY A;  1YOV B;  5E8I A;  3QOP A;  3L2C A;  5IT9 K;  1XSV A;  2ID6 A;  1J5Y A;  1OR7 A;  3V8J A;  4BXU A;  4F91 B;  1X1C A;  1BI2 A;  2A07 F;  3DBL B;  1XDU A;  2K27 A;  1MZB A;  3OYE A;  4XKB A;  1SC7 A;  2H8R A;  1YI2 I;  2JSP A;  2VLA A;  2XF5 A;  3HC7 A;  3TOB A;  1U5T C;  2OQR A;  1P4X A;  2AS5 F;  3IAS 2;  1MMA A;  3FM5 A;  5CLS A;  4OMY A;  2ZB9 A;  3CUQ B;  3DP7 A;  2XC7 A;  1H9G A;  1SFE A;  2VKH A;  1R22 A;  4PJN A;  3IH2 A;  2D45 A;  2JA2 A;  2COB A;  1HW2 A;  2F4M B;  3JSP A;  4A93 J;  2XGX A;  3F0C A;  5F0H A;  5HDK A;  4LIU A;  1ZRE A;  2KL4 A;  4ASN A;  4XLP F;  4JBA A;  4RM3 A;  4I99 C;  1IRF A;  1GV2 A;  1NHA A;  2MG4 A;  1DPR A;  1SFK A;  1YS7 A;  4FT8 A;  4D5F A;  1U78 A;  2R7U A;  2VJI A;  5BPI A;  2VE9 A;  2XPU A;  4BAY A;  2CFO A;  4HAM A;  3KP5 A;  2G7U A;  1QU3 A;  2CGP A;  3CC7 I;  1WWX A;  1B72 B;  5LRS A;  3TL4 X;  3JSO A;  4RB0 A;  1ZGJ A;  4A5N A;  4BY1 J;  4KDP A;  3E1S A;  4PFO A;  2WY8 Q;  1P6R A;  3S8P A;  5IOZ A;  2EV0 A;  2R92 J;  4M72 A;  4Z2Y A;  4DBQ A;  2XF6 A;  4R8H A;  1YJN I;  2CUJ A;  3E6M A;  3ZMU A;  2PMZ N;  2ZKZ A;  1W7P B;  1ZK8 A;  5CVJ A;  2JRT A;  2CH0 A;  1W5C C;  2KIQ A;  3K4B A;  4IVN A;  3EYI A;  2CW8 A;  3BZC A;  2DPD A;  2Z16 A;  1ERD A;  2IA2 A;  4A3F J;  2K3P A;  3OIQ A;  5C44 J;  2RNG A;  4C3H J;  2E2I J;  4KN4 X;  4H0E A;  4C2T A;  1QZY A;  3DLL F;  3BR6 A;  1B9M A;  2AO9 A;  2ZXW H;  1ZG5 A;  1F9N A;  2VOO A;  4I6Z A;  2QSH X;  3SQN A;  3WOD F;  1ZR2 A;  2EIM H;  2LNB A;  3BCA A;  3HBL A;  3ISP A;  2P6S A;  2MGQ A;  2MBF A;  1TNS A;  1FZP B;  1LFU P;  1UEL B;  4CYC A;  4NC6 A;  1BR1 A;  3CMM A;  1XS9 A;  3ABL H;  1FP1 D;  3K6G A;  1YRN A;  3ZQI A;  2M0M A;  3E7L A;  5F1R A;  1DP7 P;  2VUM J;  3FF5 A;  5K5O A;  1JUP A;  1VQM I;  2CYY A;  2RDP A;  5E79 C;  2DTR A;  2JJ7 A;  2RQQ A;  3ASN H;  2JTV A;  4AIJ A;  4A3D J;  1UG2 A;  4M3B A;  4Y17 A;  3IH4 A;  3IWZ A;  5CYV A;  3KZZ A;  4EV0 A;  1IZ1 A;  1XC5 A;  2OZ6 A;  3ZRG A;  2LSO A;  5LLQ A;  4RAY A;  4A3K J;  2P5V A;  3A02 A;  3FXQ A;  1UB9 A;  1P7J A;  2KIM A;  1LDJ A;  3O3K A;  5FKO A;  1WH5 A;  2K9N A;  3GTK J;  2DA4 A;  4XRM A;  1OYY A;  4KN7 X;  2GA1 A;  2X0L A;  3FZV A;  3PL8 A;  1MJ9 A;  3G2B A;  4AD9 A;  3BLY A;  3HM5 A;  5IT3 A;  1EV7 A;  4S04 A;  4I09 A;  3CME I;  2M3A A;  5FRN A;  1IDZ A;  5J47 A;  3OIP A;  2VOP A;  4XLA A;  1APL C;  1RET A;  1IN6 A;  3CC4 I;  3RZO J;  2HQN A;  5B66 C;  4F55 A;  4LLG F;  1JI8 A;  2DA3 A;  2LBF A;  2ID3 A;  2XPW A;  1IV6 A;  1FYM A;  3SZG A;  3GFL A;  3W3C A;  2E19 A;  2ZXH A;  4JX5 A;  4V19 K;  5CJ9 A;  1DGR M;  3BZK A;  2YSR A;  3PUB A;  5E3O A;  3QYF A;  4RDU A;  2YS9 A;  1LQ1 A;  1J09 A;  2DI3 A;  1BR4 A;  3FHZ A;  5F64 A;  4II2 A;  2OV7 A;  1GXP A;  2XRL A;  4U87 A;  1V4R A;  3F21 A;  3G1M A;  4BUP A;  4GFB A;  2WAD A;  1JKP C;  4XID A;  4V2G A;  4RGX A;  3TO9 A;  2DMQ A;  2LRE A;  3C7J A;  3HDD A;  3VSL A;  3N4M A;  4Y7N J;  2HQ5 A;  4LJZ F;  5HNF A;  3M3Y J;  3ECH A;  4KT5 C;  4P9F A;  1IUY A;  3MKW B;  5EG0 A;  3RPQ A;  4PZJ A;  2CV2 A;  2IS6 A;  5EGO B;  1LVA A;  4BEH A;  4Y52 J;  1MD0 A;  1MNM C;  4CCJ A;  4RAF A;  4I98 B;  4KNY A;  1MNE A;  1WVR A;  3KYC B;  4UUT A;  4MQ9 F;  3HOX J;  2KRF A;  2QGU A;  3PSI A;  1I39 A;  3MWM A;  4CCO A;  3K4K A;  3BG6 A;  3ZMS A;  1UCR A;  2OPT A;  1OIS A;  2X1C A;  3CCJ I;  2YX4 A;  2R7V A;  3KP7 A;  4A6D A;  1O3S A;  2LRD A;  3IHU A;  1TW2 A;  2CJJ A;  3I64 A;  3QP6 A;  2I5U A;  1ZGW A;  1J59 A;  4KMF A;  1X3U A;  2UWM A;  4LB5 A;  1HKT A;  2ADU A;  2VC1 A;  2BVL A;  4M3D A;  2L2O A;  2F6C A;  4E7I A;  2CU7 A;  4R79 A;  1LEA A;  3R61 A;  1K79 A;  1ZRC A;  4G6Q A;  3SDB A;  3WHC A;  2HS5 A;  2PFB A;  1FSE A;  4D9J A;  2JA7 J;  5K5Q A;  1FLI A;  1HCR A;  2PN6 A;  3FBI B;  5DD4 A;  4HLX A;  4HQM A;  2KLO A;  3DQV C;  4GXO A;  2PJP A;  1UHS A;  2HDC A;  4X6A J;  2V4J C;  3CTA A;  4LIV A;  1QRY A;  4G9Y A;  2WY7 Q;  3P9K A;  1SD4 A;  3KEO A;  2ISY A;  5ILS A;  1XPX A;  5DYM A;  3GYH X;  1SMT A;  3OYK A;  2K3F A;  1Z9C A;  2EK5 A;  1MMD A;  2LR8 A;  2R3S A;  2L9N A;  2ZXJ A;  3AG4 H;  4YIF A;  1DUX C;  2MC3 A;  1Z21 A;  3J80 Z;  1BBY A;  2YU3 A;  1OLT A;  2EV6 A;  2JPC A;  3ZMZ A;  4CYC B;  2O9L A;  1DPU A;  2DMU A;  5JHU A;  3B02 A;  4DZJ A;  1QBJ A;  3OYG A;  2V9V A;  4KIC A;  2VXD A;  4HV5 A;  4XLC A;  3C1D A;  3HOV J; 
#chains in the Genus database with same CATH homology
 1W1W E;  4I99 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...