1W2BF

Trigger factor ribosome binding domain in complex with 50s
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w2bF00
1KQSF 4LCKA 1W2BF 3LFOA 1YJ9F 3CCMF 1VQPF 2OZBA 5DCVA 1NMUB 2OTLF 1YIJF 1DT9A 3NK7A 3NVIB 2LBWA 1W40A 2CZWA 1N8RH 1GO1A 5GIOC 1K9MH 1SDSA 1GZ0A 1XBIA 3CMAF 3CCVF 3GYQA 3V7EA 1VQ5F 1VQ6F 3LWRC 3SIUA 2WALA 5GAPK 1VQMF 2BO1A 1PXWA 2OHWA 3CCEF 1YJWF 2JNBA 1VQOF 3VMFB 2HVYD 3RA6A 3V7QA 3LWQC 4NUTA 1CN7A 1VQNF 3G6EF 3SIVA 1K73H 1K8AH 2QA4F 5EWRA 3PLAC 1VQ4F 1Q81H 1YJNF 3J7AR 3CCSF 3RA5A 1W42A 3E20B 3E1YA 3OBYA 3OW2F 1Q7YH 2VGMA 1ZWZA 4BY9D 1GO0A 1KC8H 1Q86H 3CG6A 3IR9A 3N4ZA 3O85A 3J81M 3JCMM 3I56F 3NMUC 1X7PA 5GINC 2KTUA 1X52A 3CC7F 2LBXA 3CCUF 3MCAB 3CD6F 3ON1A 3CC2F 5IT9M 1VQ9F 1YHQF 3CMEF 3FFMA 1JJ2F 1QVFF 5GANK 3I55F 1E7KA 3N4YA 3CPQA 1M1KH 1M90H 2I6DA 5EO3A 3HAXD 1H7MA 2QI2A 1QVGF 2AIFA 4TZZA 3NK6A 5FJ4C 1S72F 3AGKA 2VGNA 4BW0B 1T0KB 1RLGA 3G4SF 3CCJF 3WXMB 3JAMM 1VQKF 3HJWC 4X3MA 1KD1H 3LWPC 5FLXM 2KTVA 1W3EX 1CK2A 1IPAA 3OBWA 3NVKE 3G71F 2OTJF 4X3LA 3PAFA 3LWVC 5G4VC 1VQ7F 1X7OA 1YITF 5G4UC 3J80M 1Q82H 2FC3A 3CC4F 5GIPC 1VQ8F 4C4WC 3LWOC 3CCRF 3CCLF 3CPWF 1YI2F 2KG4A 3VI6A 1VQLF 1W41A 5A2QM 3CXCF 1RA4A 2ALEA 1NJIH 2QEXF 3CCQF
chains in the Genus database with same CATH superfamily
1KQSF 1YJ9F 2OZBA 3F0GA 3GTZA 1DT9A 3NVIB 1ONIA 5MN6A 1W40A 2CZWA 5HXZA 1GX1A 4O4IA 3BYQA 4BVSA 3MDOA 4G4YA 1QAHA 5HY2A 3V7EA 5IJ9B 2Z1FA 5J2TA 3RE3A 5LP6A 4ERHA 2WALA 3VO8A 3RYCA 1PXWA 2OHWA 3EORA 2Z1EA 4G4ZA 1YJWF 2JNBA 3U0OA 2RHJA 3FPIA 4R40B 2P6YA 3CYQA 1VQNF 3WGKA 5LYJB 3Q8HA 2QA4F 4I4TA 5EWRA 2HP0A 2CVLA 3J7AR 4TV9B 4EI8A 3CCSF 3F6MA 2OTMA 4HNAB 3E20B 3OBYA 4I50B 2VGMA 1QD9A 4BY9D 5CA0A 3N4ZA 3IEWA 2PMPA 5JVDA 4C8IA 3HKCA 1KNJA 3NMUC 4B5CA 2KTUA 5HWEA 1OAPA 4WBNA 1W59A 3CC7F 1SA0A 2R6R1 3WPXA 2Z1TA 3M84A 3CC2F 3K14A 1VQ9F 5LP6B 4BT6A 1YHQF 3HKEA 3CMEF 1FNJA 1JN1A 3ESJA 4LNUB 2Q1XA 2ZF8A 1W581 5EAZA 3CPQA 2GVIA 1M1KH 1Z5WA 2I6DA 2LBTA 2IAFA 3RYFA 4IIJA 2QI2A 4KWEA 1DBFA 4EB6B 4U3JA 2BTQB 1TVKA 2IQQA 3AGKA 2K1SA 2VGNA 3M1XA 4NWOB 4X1IA 4I50A 3G4SF 1VQKF 5EZYB 3HJWC 4X3MA 5FNVB 3HKBB 5FLXM 3QTYA 3VOAA 1IPAA 4I55B 1W5AA 1VQ7F 5G4UC 1H47A 2UYNB 4WBNB 4C4WC 1XHOA 2HS4A 1SA0B 4BT4A 3CCRF 2RB9A 3CCLF 3ZP4A 5CA1B 3HKDB 2KG4A 3VI6A 1U3PA 4YJ3B 5CA0B 3K12A 2MQEA 3CXCF 1YQNA 4LCKA 5EIBC 3S0YA 3OONA 4O2AB 1YIJF 3E22B 1U43A 4ZOLA 4EB6A 3F0EA 2ZVZA 1SDSA 4O2AA 1GZ0A 4BVRA 1XBIA 4LNUA 1FFXB 3LDTA 5GONA 3RYIB 3VYSC 1R1MA 1VQVA 2ZAUA 4BVTA 3SIUA 1FNKA 3TD3A 3D54A 1FFXA 1VQMF 3UT5B 3KJJA 4B45A 5JQGB 3JALA 2CHTA 3VMFB 2HVYD 3RA6A 2H8EA 3N2KA 4IHJA 4ZK7A 3C9TA 2AMTA 4X1IB 1K73H 5JH7B 3WGMA 2VAMA 2HP0B 2FGYA 2G9IA 4I4TB 1VQ4F 4BVQA 1W5EA 2IG8A 4HNAA 3ELCA 3JASA 3E1YA 3M4SA 5HY1A 4ZHVA 2VAWA 2L26A 3OW2F 3WGJA 1ZWZA 5LA6A 3TD4A 1J7HA 1Q86H 3C9SA 3L7QA 3GHZA 3HKDA 5ITZA 3I7TA 3WJRA 2W8BC 2LBXA 3D01A 2VAPA 1VK3A 4ZI7A 3CD6F 2Q1YA 3ON1A 5B8FA 3ZOPA 3JARA 4EI7A 3E22A 2CW4A 3FFMA 4O4LB 4O4HB 1QVFF 4C8EA 3HTNA 4C82A 5J2TB 2HRYA 2AIZP 3VYTC 5BMVA 2GZLA 3K0TA 1H7MA 3D00A 4DRXA 2AIFA 4TZZA 4U3JB 3NK6A 2HS0A 5FJ4C 1RQ7A 3K2XA 5EB0A 4X1KB 4BW0B 3F0FA 3F0DA 3IKEA 3MCQA 3MQWA 2CWJA 5JQGA 5HP8A 1KD1H 3LWPC 2KTVA 1Z5VA 3S02A 2OTJF 4X20A 3PAFA 4O4JB 1YITF 4X1YB 1CLIA 5KMGB 2R751 2UYJA 5IYZB 3LWOC 5EIBD 5J2UB 2B33A 3CPWF 3C9UA 3LYBA 1XV2A 4RQOA 4B46A 3JAWB 3P4EA 1YI2F 1Q8RA 5CA1A 2HX0A 3CCEF 1NJIH 3S0WA 3CB2A 5CB4B 1W2BF 3CCMF 3VCZA 3QUWA 3B6NA 1VQPF 5DCVA 1NMUB 2OTLF 5MN5A 1U40A 3KJKA 2LBWA 3I3FA 1N8RH 1JD1A 2CSLA 2ZODA 5IJ9A 5IJ0A 1KNKA 3CMAF 3CCVF 2HRUA 3JAKB 4O4IB 1VQ6F 3LWRC 4M8IA 2I6RA 3ZO8A 5LYJA 2BO1A 3UT5A 1VQOF 4U39A 1W55A 3V7QA 3LWQC 1SZQA 4NUTA 1CN7A 3G6EF 5C8YB 1K8AH 3PLAC 2ZOVA 2UYNA 1Q81H 3FD6A 1W57A 4TV8A 3RA5A 5C8YA 1W42A 4C81A 5CB4A 5JVDB 1Q7YH 3LMEA 1GO0A 1TUBA 5FNVA 3KIZA 5AVMA 1FSZA 3IR9A 4G4VA 3J81M 3JAWA 3HWUA 2VXYA 4XCQA 2UZHA 3N2GB 1X52A 1VHAA 3DDNA 1NQ3A 2RHLA 3CCUF 3MCAB 3VTIC 2GLZA 3WPWA 2BTUA 5IT9M 5EYPA 2RHHA 2UYKA 3T80A 2V9YA 4IIJB 3DC2A 4YJ2B 3TD5A 3KE1A 1E7KA 4O4HA 1W5BA 5KX5B 5EYPB 4FFBB 4BT5A 1M90H 4PWTA 3S03A 5EO3A 3HAXD 1QVGF 4O2BA 2QTPA 4DRXB 4E6EA 5KX5A 1S72F 3JALB 5HY0A 5JCOC 4X1KA 3WJPA 3RYCB 1T0KB 5HXUA 5JH7A 3WXMB 3WGLA 4TUYB 3CYPB 4BT2A 3S06A 4ZHQB 3OBWA 1CK2A 3IKFA 4O4JA 4X3LA 3LWVC 1U3LA 3RYHB 4X20B 5EZYA 1X7OA 5LOVB 3J80M 2HS3A 3JATA 5LP6C 1OFUA 3N2GA 1VQ8F 5IYZA 3N2KB 4IHJB 3VOBA 4DXDA 1UFYA 5LXTB 1JFFA 3IEQA 3JATB 1W41A 1IV2A 3QHDA 1RA4A 2ALEA 4ZOLB 3LFOA 4FFBA 2N48A 3NK7A 4O2BB 3IMPA 3ERNA 1GO1A 1QU9A 5GIOC 1K9MH 3VYUC 2H6LA 5ITZB 3HKEB 4BT3A 3GYQA 3V4DA 4RHAA 1VQ5F 3JAKA 2PHNA 3MBMA 1COMA 5GAPK 1IV3A 3C9RA 5GONB 5LOVA 1TVKB 3ZP7A 5EB1B 1UI9A 2DT4A 3SIVA 3JASB 4C8GA 1ODEA 5BMVB 2BTOA 2Z1UA 4TUYA 2HQSC 4X1YA 5KMGA 3JVHA 4TV9A 1YJNF 4G88A 3KHNA 5HY4A 3C8LA 1XRGA 1RLUA 1TUBB 1VH8A 1KC8H 3CG6A 3S0HA 3WGNA 3O85A 4F6RA 3JCMM 2Z01A 1JFFB 3P10A 3I56F 1X7PA 5GINC 3HKCB 4YJ3A 3VIUA 2HP3A 1T0AA 2LCAA 3FBAA 4G4WA 3RYIA 1YGYA 5IJ0B 2F9ZC 5MN4A 4NQ3A 4YJ2A 1JJ2F 4ZI7B 5GANK 3I55F 4EI9A 3N4YA 2NMUA 2UYPA 3RYFB 3FD5A 4ZHWA 4O4LA 4ZHYB 5HP7A 3V3TA 5JCOA 2YXZA 3P0ZA 1IV4A 1RLGA 3CCJF 3WJQA 3JAMM 2EWCA 2RHOA 3HKBA 4G4XA 4F6RB 4I55A 4ZHQA 1W3EX 4TV8B 4B62A 1JY8A 2ZVYA 3G71F 3NVKE 2CHSA 1X25A 1PF5A 5G4VC 3RYHA 1Q82H 2FC3A 3CC4F 5GIPC 1H48A 4BT7A 2H8CA 1W5FA 5LA6B 3JARB 1IV1A 5LXTA 3R0PA 1VQLF 5A2QM 2KGWA 1RQ2A 2DYYA 2YYEA 5J2UA 2QEXF 3CCQF
chains in the Genus database with same CATH topology
1KQSF 4LCKA 1W2BF 3LFOA 1YJ9F 3CCMF 1VQPF 2OZBA 5DCVA 1NMUB 2OTLF 1YIJF 1DT9A 3NK7A 3NVIB 2LBWA 1W40A 2CZWA 1N8RH 1GO1A 5HXZA 5GIOC 1K9MH 4BVSA 1SDSA 1GZ0A 4BVRA 1XBIA 3CMAF 3CCVF 3GYQA 5HY2A 3V7EA 1VQ5F 1VQ6F 3LWRC 4BVTA 3SIUA 2WALA 5GAPK 1VQMF 2BO1A 1PXWA 2OHWA 3CCEF 1YJWF 2JNBA 1VQOF 3VMFB 2HVYD 3RA6A 3V7QA 3LWQC 4NUTA 1CN7A 1VQNF 3G6EF 3SIVA 1K73H 1K8AH 2QA4F 5EWRA 2FGYA 3PLAC 1VQ4F 4BVQA 1Q81H 1YJNF 3J7AR 3CCSF 4EI8A 3RA5A 1W42A 3E20B 3E1YA 3OBYA 5HY1A 5HY4A 3OW2F 1Q7YH 2VGMA 1ZWZA 4BY9D 1GO0A 1KC8H 1Q86H 3CG6A 3IR9A 3N4ZA 3O85A 3J81M 3JCMM 3I56F 3NMUC 4XCQA 1X7PA 5GINC 2KTUA 5HWEA 1X52A 3CC7F 2LBXA 3CCUF 3MCAB 2GLZA 3CD6F 3ON1A 3CC2F 5IT9M 1VQ9F 4EI7A 2F9ZC 1YHQF 4NQ3A 3CMEF 3FFMA 1JJ2F 1QVFF 5GANK 3I55F 1E7KA 4EI9A 3N4YA 3CPQA 1M1KH 1M90H 2I6DA 5EO3A 3HAXD 1H7MA 3D00A 2QI2A 1QVGF 2AIFA 4TZZA 3NK6A 3V3TA 5FJ4C 1S72F 3AGKA 5HY0A 2VGNA 4BW0B 1T0KB 5HXUA 1RLGA 3G4SF 3CCJF 3WXMB 3JAMM 1VQKF 3HJWC 4X3MA 1KD1H 3LWPC 5FLXM 2KTVA 1W3EX 1CK2A 1IPAA 3OBWA 3NVKE 3G71F 2OTJF 4X3LA 3PAFA 3LWVC 5G4VC 1VQ7F 1X7OA 1YITF 5G4UC 3J80M 1Q82H 2FC3A 3CC4F 5GIPC 1VQ8F 4C4WC 3LWOC 3CCRF 3CCLF 3CPWF 1YI2F 2KG4A 3VI6A 1VQLF 1W41A 5A2QM 3CXCF 1RA4A 2ALEA 1NJIH 2QEXF 3CCQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQS F;  4LCK A;  1W2B F;  3LFO A;  1YJ9 F;  3CCM F;  1VQP F;  2OZB A;  5DCV A;  1NMU B;  2OTL F;  1YIJ F;  1DT9 A;  3NK7 A;  3NVI B;  2LBW A;  1W40 A;  2CZW A;  1N8R H;  1GO1 A;  5GIO C;  1K9M H;  1SDS A;  1GZ0 A;  1XBI A;  3CMA F;  3CCV F;  3GYQ A;  3V7E A;  1VQ5 F;  1VQ6 F;  3LWR C;  3SIU A;  2WAL A;  5GAP K;  1VQM F;  2BO1 A;  1PXW A;  2OHW A;  3CCE F;  1YJW F;  2JNB A;  1VQO F;  3VMF B;  2HVY D;  3RA6 A;  3V7Q A;  3LWQ C;  4NUT A;  1CN7 A;  1VQN F;  3G6E F;  3SIV A;  1K73 H;  1K8A H;  2QA4 F;  5EWR A;  3PLA C;  1VQ4 F;  1Q81 H;  1YJN F;  3J7A R;  3CCS F;  3RA5 A;  1W42 A;  3E20 B;  3E1Y A;  3OBY A;  3OW2 F;  1Q7Y H;  2VGM A;  1ZWZ A;  4BY9 D;  1GO0 A;  1KC8 H;  1Q86 H;  3CG6 A;  3IR9 A;  3N4Z A;  3O85 A;  3J81 M;  3JCM M;  3I56 F;  3NMU C;  1X7P A;  5GIN C;  2KTU A;  1X52 A;  3CC7 F;  2LBX A;  3CCU F;  3MCA B;  3CD6 F;  3ON1 A;  3CC2 F;  5IT9 M;  1VQ9 F;  1YHQ F;  3CME F;  3FFM A;  1JJ2 F;  1QVF F;  5GAN K;  3I55 F;  1E7K A;  3N4Y A;  3CPQ A;  1M1K H;  1M90 H;  2I6D A;  5EO3 A;  3HAX D;  1H7M A;  2QI2 A;  1QVG F;  2AIF A;  4TZZ A;  3NK6 A;  5FJ4 C;  1S72 F;  3AGK A;  2VGN A;  4BW0 B;  1T0K B;  1RLG A;  3G4S F;  3CCJ F;  3WXM B;  3JAM M;  1VQK F;  3HJW C;  4X3M A;  1KD1 H;  3LWP C;  5FLX M;  2KTV A;  1W3E X;  1CK2 A;  1IPA A;  3OBW A;  3NVK E;  3G71 F;  2OTJ F;  4X3L A;  3PAF A;  3LWV C;  5G4V C;  1VQ7 F;  1X7O A;  1YIT F;  5G4U C;  3J80 M;  1Q82 H;  2FC3 A;  3CC4 F;  5GIP C;  1VQ8 F;  4C4W C;  3LWO C;  3CCR F;  3CCL F;  3CPW F;  1YI2 F;  2KG4 A;  3VI6 A;  1VQL F;  1W41 A;  5A2Q M;  3CXC F;  1RA4 A;  2ALE A;  1NJI H;  2QEX F;  3CCQ F; 
#chains in the Genus database with same CATH topology
 1KQS F;  1YJ9 F;  2OZB A;  3F0G A;  3GTZ A;  1DT9 A;  3NVI B;  1ONI A;  5MN6 A;  1W40 A;  2CZW A;  5HXZ A;  1GX1 A;  4O4I A;  3BYQ A;  4BVS A;  3MDO A;  4G4Y A;  1QAH A;  5HY2 A;  3V7E A;  5IJ9 B;  2Z1F A;  5J2T A;  3RE3 A;  5LP6 A;  4ERH A;  2WAL A;  3VO8 A;  3RYC A;  1PXW A;  2OHW A;  3EOR A;  2Z1E A;  4G4Z A;  1YJW F;  2JNB A;  3U0O A;  2RHJ A;  3FPI A;  4R40 B;  2P6Y A;  3CYQ A;  1VQN F;  3WGK A;  5LYJ B;  3Q8H A;  2QA4 F;  4I4T A;  5EWR A;  2HP0 A;  2CVL A;  3J7A R;  4TV9 B;  4EI8 A;  3CCS F;  3F6M A;  2OTM A;  4HNA B;  3E20 B;  3OBY A;  4I50 B;  2VGM A;  1QD9 A;  4BY9 D;  5CA0 A;  3N4Z A;  3IEW A;  2PMP A;  5JVD A;  4C8I A;  3HKC A;  1KNJ A;  3NMU C;  4B5C A;  2KTU A;  5HWE A;  1OAP A;  4WBN A;  1W59 A;  3CC7 F;  1SA0 A;  2R6R 1;  3WPX A;  2Z1T A;  3M84 A;  3CC2 F;  3K14 A;  1VQ9 F;  5LP6 B;  4BT6 A;  1YHQ F;  3HKE A;  3CME F;  1FNJ A;  1JN1 A;  3ESJ A;  4LNU B;  2Q1X A;  2ZF8 A;  1W58 1;  5EAZ A;  3CPQ A;  2GVI A;  1M1K H;  1Z5W A;  2I6D A;  2LBT A;  2IAF A;  3RYF A;  4IIJ A;  2QI2 A;  4KWE A;  1DBF A;  4EB6 B;  4U3J A;  2BTQ B;  1TVK A;  2IQQ A;  3AGK A;  2K1S A;  2VGN A;  3M1X A;  4NWO B;  4X1I A;  4I50 A;  3G4S F;  1VQK F;  5EZY B;  3HJW C;  4X3M A;  5FNV B;  3HKB B;  5FLX M;  3QTY A;  3VOA A;  1IPA A;  4I55 B;  1W5A A;  1VQ7 F;  5G4U C;  1H47 A;  2UYN B;  4WBN B;  4C4W C;  1XHO A;  2HS4 A;  1SA0 B;  4BT4 A;  3CCR F;  2RB9 A;  3CCL F;  3ZP4 A;  5CA1 B;  3HKD B;  2KG4 A;  3VI6 A;  1U3P A;  4YJ3 B;  5CA0 B;  3K12 A;  2MQE A;  3CXC F;  1YQN A;  4LCK A;  5EIB C;  3S0Y A;  3OON A;  4O2A B;  1YIJ F;  3E22 B;  1U43 A;  4ZOL A;  4EB6 A;  3F0E A;  2ZVZ A;  1SDS A;  4O2A A;  1GZ0 A;  4BVR A;  1XBI A;  4LNU A;  1FFX B;  3LDT A;  5GON A;  3RYI B;  3VYS C;  1R1M A;  1VQV A;  2ZAU A;  4BVT A;  3SIU A;  1FNK A;  3TD3 A;  3D54 A;  1FFX A;  1VQM F;  3UT5 B;  3KJJ A;  4B45 A;  5JQG B;  3JAL A;  2CHT A;  3VMF B;  2HVY D;  3RA6 A;  2H8E A;  3N2K A;  4IHJ A;  4ZK7 A;  3C9T A;  2AMT A;  4X1I B;  1K73 H;  5JH7 B;  3WGM A;  2VAM A;  2HP0 B;  2FGY A;  2G9I A;  4I4T B;  1VQ4 F;  4BVQ A;  1W5E A;  2IG8 A;  4HNA A;  3ELC A;  3JAS A;  3E1Y A;  3M4S A;  5HY1 A;  4ZHV A;  2VAW A;  2L26 A;  3OW2 F;  3WGJ A;  1ZWZ A;  5LA6 A;  3TD4 A;  1J7H A;  1Q86 H;  3C9S A;  3L7Q A;  3GHZ A;  3HKD A;  5ITZ A;  3I7T A;  3WJR A;  2W8B C;  2LBX A;  3D01 A;  2VAP A;  1VK3 A;  4ZI7 A;  3CD6 F;  2Q1Y A;  3ON1 A;  5B8F A;  3ZOP A;  3JAR A;  4EI7 A;  3E22 A;  2CW4 A;  3FFM A;  4O4L B;  4O4H B;  1QVF F;  4C8E A;  3HTN A;  4C82 A;  5J2T B;  2HRY A;  2AIZ P;  3VYT C;  5BMV A;  2GZL A;  3K0T A;  1H7M A;  3D00 A;  4DRX A;  2AIF A;  4TZZ A;  4U3J B;  3NK6 A;  2HS0 A;  5FJ4 C;  1RQ7 A;  3K2X A;  5EB0 A;  4X1K B;  4BW0 B;  3F0F A;  3F0D A;  3IKE A;  3MCQ A;  3MQW A;  2CWJ A;  5JQG A;  5HP8 A;  1KD1 H;  3LWP C;  2KTV A;  1Z5V A;  3S02 A;  2OTJ F;  4X20 A;  3PAF A;  4O4J B;  1YIT F;  4X1Y B;  1CLI A;  5KMG B;  2R75 1;  2UYJ A;  5IYZ B;  3LWO C;  5EIB D;  5J2U B;  2B33 A;  3CPW F;  3C9U A;  3LYB A;  1XV2 A;  4RQO A;  4B46 A;  3JAW B;  3P4E A;  1YI2 F;  1Q8R A;  5CA1 A;  2HX0 A;  3CCE F;  1NJI H;  3S0W A;  3CB2 A;  5CB4 B;  1W2B F;  3CCM F;  3VCZ A;  3QUW A;  3B6N A;  1VQP F;  5DCV A;  1NMU B;  2OTL F;  5MN5 A;  1U40 A;  3KJK A;  2LBW A;  3I3F A;  1N8R H;  1JD1 A;  2CSL A;  2ZOD A;  5IJ9 A;  5IJ0 A;  1KNK A;  3CMA F;  3CCV F;  2HRU A;  3JAK B;  4O4I B;  1VQ6 F;  3LWR C;  4M8I A;  2I6R A;  3ZO8 A;  5LYJ A;  2BO1 A;  3UT5 A;  1VQO F;  4U39 A;  1W55 A;  3V7Q A;  3LWQ C;  1SZQ A;  4NUT A;  1CN7 A;  3G6E F;  5C8Y B;  1K8A H;  3PLA C;  2ZOV A;  2UYN A;  1Q81 H;  3FD6 A;  1W57 A;  4TV8 A;  3RA5 A;  5C8Y A;  1W42 A;  4C81 A;  5CB4 A;  5JVD B;  1Q7Y H;  3LME A;  1GO0 A;  1TUB A;  5FNV A;  3KIZ A;  5AVM A;  1FSZ A;  3IR9 A;  4G4V A;  3J81 M;  3JAW A;  3HWU A;  2VXY A;  4XCQ A;  2UZH A;  3N2G B;  1X52 A;  1VHA A;  3DDN A;  1NQ3 A;  2RHL A;  3CCU F;  3MCA B;  3VTI C;  2GLZ A;  3WPW A;  2BTU A;  5IT9 M;  5EYP A;  2RHH A;  2UYK A;  3T80 A;  2V9Y A;  4IIJ B;  3DC2 A;  4YJ2 B;  3TD5 A;  3KE1 A;  1E7K A;  4O4H A;  1W5B A;  5KX5 B;  5EYP B;  4FFB B;  4BT5 A;  1M90 H;  4PWT A;  3S03 A;  5EO3 A;  3HAX D;  1QVG F;  4O2B A;  2QTP A;  4DRX B;  4E6E A;  5KX5 A;  1S72 F;  3JAL B;  5HY0 A;  5JCO C;  4X1K A;  3WJP A;  3RYC B;  1T0K B;  5HXU A;  5JH7 A;  3WXM B;  3WGL A;  4TUY B;  3CYP B;  4BT2 A;  3S06 A;  4ZHQ B;  3OBW A;  1CK2 A;  3IKF A;  4O4J A;  4X3L A;  3LWV C;  1U3L A;  3RYH B;  4X20 B;  5EZY A;  1X7O A;  5LOV B;  3J80 M;  2HS3 A;  3JAT A;  5LP6 C;  1OFU A;  3N2G A;  1VQ8 F;  5IYZ A;  3N2K B;  4IHJ B;  3VOB A;  4DXD A;  1UFY A;  5LXT B;  1JFF A;  3IEQ A;  3JAT B;  1W41 A;  1IV2 A;  3QHD A;  1RA4 A;  2ALE A;  4ZOL B;  3LFO A;  4FFB A;  2N48 A;  3NK7 A;  4O2B B;  3IMP A;  3ERN A;  1GO1 A;  1QU9 A;  5GIO C;  1K9M H;  3VYU C;  2H6L A;  5ITZ B;  3HKE B;  4BT3 A;  3GYQ A;  3V4D A;  4RHA A;  1VQ5 F;  3JAK A;  2PHN A;  3MBM A;  1COM A;  5GAP K;  1IV3 A;  3C9R A;  5GON B;  5LOV A;  1TVK B;  3ZP7 A;  5EB1 B;  1UI9 A;  2DT4 A;  3SIV A;  3JAS B;  4C8G A;  1ODE A;  5BMV B;  2BTO A;  2Z1U A;  4TUY A;  2HQS C;  4X1Y A;  5KMG A;  3JVH A;  4TV9 A;  1YJN F;  4G88 A;  3KHN A;  5HY4 A;  3C8L A;  1XRG A;  1RLU A;  1TUB B;  1VH8 A;  1KC8 H;  3CG6 A;  3S0H A;  3WGN A;  3O85 A;  4F6R A;  3JCM M;  2Z01 A;  1JFF B;  3P10 A;  3I56 F;  1X7P A;  5GIN C;  3HKC B;  4YJ3 A;  3VIU A;  2HP3 A;  1T0A A;  2LCA A;  3FBA A;  4G4W A;  3RYI A;  1YGY A;  5IJ0 B;  2F9Z C;  5MN4 A;  4NQ3 A;  4YJ2 A;  1JJ2 F;  4ZI7 B;  5GAN K;  3I55 F;  4EI9 A;  3N4Y A;  2NMU A;  2UYP A;  3RYF B;  3FD5 A;  4ZHW A;  4O4L A;  4ZHY B;  5HP7 A;  3V3T A;  5JCO A;  2YXZ A;  3P0Z A;  1IV4 A;  1RLG A;  3CCJ F;  3WJQ A;  3JAM M;  2EWC A;  2RHO A;  3HKB A;  4G4X A;  4F6R B;  4I55 A;  4ZHQ A;  1W3E X;  4TV8 B;  4B62 A;  1JY8 A;  2ZVY A;  3G71 F;  3NVK E;  2CHS A;  1X25 A;  1PF5 A;  5G4V C;  3RYH A;  1Q82 H;  2FC3 A;  3CC4 F;  5GIP C;  1H48 A;  4BT7 A;  2H8C A;  1W5F A;  5LA6 B;  3JAR B;  1IV1 A;  5LXT A;  3R0P A;  1VQL F;  5A2Q M;  2KGW A;  1RQ2 A;  2DYY A;  2YYE A;  5J2U A;  2QEX F;  3CCQ F; 
#chains in the Genus database with same CATH homology
 1KQS F;  4LCK A;  1W2B F;  3LFO A;  1YJ9 F;  3CCM F;  1VQP F;  2OZB A;  5DCV A;  1NMU B;  2OTL F;  1YIJ F;  1DT9 A;  3NK7 A;  3NVI B;  2LBW A;  1W40 A;  2CZW A;  1N8R H;  1GO1 A;  5HXZ A;  5GIO C;  1K9M H;  4BVS A;  1SDS A;  1GZ0 A;  4BVR A;  1XBI A;  3CMA F;  3CCV F;  3GYQ A;  5HY2 A;  3V7E A;  1VQ5 F;  1VQ6 F;  3LWR C;  4BVT A;  3SIU A;  2WAL A;  5GAP K;  1VQM F;  2BO1 A;  1PXW A;  2OHW A;  3CCE F;  1YJW F;  2JNB A;  1VQO F;  3VMF B;  2HVY D;  3RA6 A;  3V7Q A;  3LWQ C;  4NUT A;  1CN7 A;  1VQN F;  3G6E F;  3SIV A;  1K73 H;  1K8A H;  2QA4 F;  5EWR A;  2FGY A;  3PLA C;  1VQ4 F;  4BVQ A;  1Q81 H;  1YJN F;  3J7A R;  3CCS F;  4EI8 A;  3RA5 A;  1W42 A;  3E20 B;  3E1Y A;  3OBY A;  5HY1 A;  5HY4 A;  3OW2 F;  1Q7Y H;  2VGM A;  1ZWZ A;  4BY9 D;  1GO0 A;  1KC8 H;  1Q86 H;  3CG6 A;  3IR9 A;  3N4Z A;  3O85 A;  3J81 M;  3JCM M;  3I56 F;  3NMU C;  4XCQ A;  1X7P A;  5GIN C;  2KTU A;  5HWE A;  1X52 A;  3CC7 F;  2LBX A;  3CCU F;  3MCA B;  2GLZ A;  3CD6 F;  3ON1 A;  3CC2 F;  5IT9 M;  1VQ9 F;  4EI7 A;  2F9Z C;  1YHQ F;  4NQ3 A;  3CME F;  3FFM A;  1JJ2 F;  1QVF F;  5GAN K;  3I55 F;  1E7K A;  4EI9 A;  3N4Y A;  3CPQ A;  1M1K H;  1M90 H;  2I6D A;  5EO3 A;  3HAX D;  1H7M A;  3D00 A;  2QI2 A;  1QVG F;  2AIF A;  4TZZ A;  3NK6 A;  3V3T A;  5FJ4 C;  1S72 F;  3AGK A;  5HY0 A;  2VGN A;  4BW0 B;  1T0K B;  5HXU A;  1RLG A;  3G4S F;  3CCJ F;  3WXM B;  3JAM M;  1VQK F;  3HJW C;  4X3M A;  1KD1 H;  3LWP C;  5FLX M;  2KTV A;  1W3E X;  1CK2 A;  1IPA A;  3OBW A;  3NVK E;  3G71 F;  2OTJ F;  4X3L A;  3PAF A;  3LWV C;  5G4V C;  1VQ7 F;  1X7O A;  1YIT F;  5G4U C;  3J80 M;  1Q82 H;  2FC3 A;  3CC4 F;  5GIP C;  1VQ8 F;  4C4W C;  3LWO C;  3CCR F;  3CCL F;  3CPW F;  1YI2 F;  2KG4 A;  3VI6 A;  1VQL F;  1W41 A;  5A2Q M;  3CXC F;  1RA4 A;  2ALE A;  1NJI H;  2QEX F;  3CCQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...