1W2BF

Trigger factor ribosome binding domain in complex with 50s
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 32
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w2bF00
3VI6A 1N8RH 1SDSA 3LWVC 2VGNA 1ZWZA 1K9MH 5IT9M 3CCEF 3NK7A 2AIFA 1VQ9F 1YJNF 1VQKF 3CCSF 3SIUA 2LBWA 5GANK 1GO0A 1VQ7F 3SIVA 3AGKA 1VQOF 3CPWF 3G71F 3RA5A 3E20B 3J80M 2OTJF 2CZWA 1KC8H 2OTLF 2FC3A 5FLXM 3IR9A 3CCUF 1W42A 3G6EF 3NK6A 3O85A 1M90H 2HVYD 3CCVF 1W41A 3OBWA 1YJWF 1W40A 1NMUB 1RA4A 2QI2A 3NVKE 5FJ4C 3JCMM 2KG4A 3CG6A 2KTVA 5G4VC 3J81M 5G4UC 1VQ4F 1CK2A 3RA6A 1VQ6F 3CCQF 2OHWA 1XBIA 5EO3A 4LCKA 1X52A 1QVFF 1VQ8F 3NMUC 1K8AH 3CC7F 3CCMF 1VQPF 1YJ9F 1QVGF 1W3EX 5GINC 2ALEA 1KD1H 1KQSF 3G4SF 2QEXF 2LBXA 4BW0B 3GYQA 2BO1A 3CXCF 3LWQC 3J7AR 3CMAF 3LWPC 3CCJF 3E1YA 4NUTA 1Q82H 3HJWC 4C4WC 3ON1A 2I6DA 3LFOA 3FFMA 1M1KH 3CCRF 4BY9D 3WXMB 1W2BF 5GAPK 3CPQA 1S72F 3V7EA 3N4YA 2KTUA 3V7QA 1YI2F 5DCVA 2WALA 3PLAC 1DT9A 1K73H 1VQNF 4TZZA 3I55F 1X7PA 1VQMF 1Q7YH 2OZBA 3N4ZA 3CCLF 1YIJF 1Q86H 3OBYA 3VMFB 3LWOC 1GZ0A 1RLGA 1IPAA 3HAXD 4X3MA 3MCAB 3CMEF 3CD6F 4X3LA 1YHQF 5GIPC 2JNBA 3NVIB 3LWRC 3CC2F 5EWRA 5A2QM 3OW2F 1VQLF 1Q81H 1T0KB 5GIOC 1NJIH 1E7KA 3I56F 2QA4F 3CC4F 1YITF 1GO1A 1X7OA 1PXWA 1JJ2F 3JAMM 1CN7A 1VQ5F 3PAFA 1H7MA 2VGMA
chains in the Genus database with same CATH superfamily
1OFUA 5LXTA 5HP8A 1JFFB 3OONA 1Z5VA 2UYKA 4C8IA 2H8CA 1W5FA 2NMUA 1FNKA 4O4JB 3CCEF 3NK7A 1VQ9F 1YJNF 1VQKF 3S02A 2VAWA 3ZO8A 2Z1UA 2DT4A 3SIUA 1W5EA 1VQ7F 3SIVA 4TV9B 3AGKA 3HTNA 4FFBB 4I55A 3G71F 3J80M 2FC3A 5FLXM 3WGLA 1W42A 3HKDA 3JARA 3CB2A 5C8YA 1W41A 3C9UA 2Z1EA 5IJ0B 2HQSC 3K2XA 4ZOLA 3NVKE 5FJ4C 5LP6C 2UYNB 1U3PA 1J7HA 3CCQF 3JALA 4X20A 4IHJB 5FNVB 3K14A 2VAPA 3MQWA 5EO3A 4E6EA 5MN4A 4LCKA 3HKBB 1H48A 4C8GA 1XRGA 4F6RA 3CC7F 5J2UB 3CCMF 5LOVB 3ESJA 4I4TB 2CWJA 2LBXA 3B6NA 1U40A 3GYQA 5KMGA 4B46A 4C8EA 3CXCF 4IIJA 4C81A 5CA1B 3WPWA 3WJPA 3CCJF 1KNJA 4B5CA 3E1YA 3HJWC 4C4WC 3ON1A 3HWUA 2HS0A 4LNUB 3FFMA 1M1KH 5EZYB 3K12A 3UT5B 1FFXA 2RHLA 1SA0B 1S72F 3V7EA 5HY2A 2PHNA 3PLAC 1DT9A 3JVHA 1K73H 4R40B 3FD6A 1CLIA 4TZZA 4BT2A 1Q7YH 3RYCB 2Z1TA 3N4ZA 3I3FA 4TV8A 2HP0A 3OBYA 2RB9A 5BMVA 2R751 3KHNA 2BTOA 4X1IB 4X3MA 3FBAA 1H7MA 1H47A 2CSLA 3N2GB 5GIPC 3DDNA 1IV4A 2VAMA 5A2QM 5J2TB 1JFFA 3MCQA 2CHTA 3JASA 4O4JA 4YJ3B 1E7KA 1YITF 4I50A 4EB6A 3JAMM 1COMA 4DRXB 3PAFA 1VQ5F 5IJ9A 5ITZB 3VI6A 4O4LA 1N8RH 4FFBA 1SDSA 4ZHYB 5AVMA 1NQ3A 2Z01A 1K9MH 5IT9M 2AIFA 4BVTA 4HNAB 2FGYA 4BVQA 1QD9A 3IKFA 3WGJA 1JN1A 2F9ZC 4O4HB 3QTYA 3TD4A 2GLZA 1KC8H 2UYNA 2OTLF 3IR9A 2HVYD 2QTPA 3HKCA 3O85A 4B45A 3CCVF 3T80A 3VYSC 4G4XA 5JCOC 5LA6A 4IHJA 5FNVA 3L7QA 2KG4A 4EI9A 2KTVA 4M8IA 2Z1FA 5KX5B 1RQ2A 3J81M 3S06A 1Z5WA 1VQ4F 2B33A 5G4UC 1CK2A 2IQQA 3RYHB 5LOVA 4I4TA 5JH7B 1XHOA 4WBNB 5JQGA 5EIBD 4X1YB 5EYPA 5HP7A 1TUBB 2LCAA 2HRYA 3NMUC 1K8AH 3M1XA 5CA1A 5EAZA 4EI7A 1QVGF 3MBMA 5EIBC 5GONB 4G4YA 2IG8A 1DBFA 5EZYA 3LWQC 3IKEA 1X25A 1SA0A 4O4IA 2BTUA 3R0PA 5LP6A 1R1MA 2I6DA 3LFOA 3C8LA 3RYIB 3CCRF 4BY9D 2W8BC 1W2BF 3RYFA 3CYPB 4ZI7B 5JVDB 3VOBA 3VO8A 1UI9A 4ZK7A 3CPQA 4O2AA 3E22A 3N4YA 3V7QA 3K0TA 2P6YA 1YI2F 1UFYA 2WALA 4U3JB 3N2GA 1JY8A 3I55F 3FPIA 2ZVZA 2OZBA 2EWCA 3TD3A 1YIJF 1U3LA 2CHSA 3ERNA 4O2BB 3VMFB 4ZHVA 1GZ0A 3HAXD 3HKEA 4BT6A 3MCAB 5LYJB 5CA0B 3VCZA 1VHAA 4DRXA 3LWRC 5ITZA 3S0WA 5IYZA 3CC2F 3F0GA 1QAHA 4KWEA 2BTQB 3S0YA 1T0KB 3VOAA 2KGWA 1PXWA 3WPXA 1CN7A 4I55B 5HWEA 2OTMA 3ZOPA 2IAFA 5HY0A 3LWVC 1GX1A 3KE1A 2VGNA 4BT5A 2PMPA 5B8FA 1JD1A 5C8YB 3BYQA 3IEQA 4ZOLB 1GO0A 2VXYA 3QHDA 2LBTA 2K1SA 2Q1XA 3V3TA 3E20B 2CZWA 1FSZA 4G4WA 1M90H 3JALB 2I6RA 4X20B 4XCQA 3G6EF 2HP3A 3OBWA 1YJWF 1RA4A 2QI2A 3P10A 3F0EA 5JH7A 4NQ3A 2DYYA 4WBNA 4TV9A 4U39A 3JCMM 1ODEA 3C9RA 3CG6A 4F6RB 1TUBA 1W5AA 5G4VC 3RA6A 1T0AA 3N2KB 4X1KB 3D54A 2H6LA 4IIJB 5IJ0A 1W5BA 1X52A 1QVFF 4ZHQB 4TUYB 3MDOA 4ZHWA 3TD5A 4G4ZA 2ZAUA 5GINC 1KD1H 1XV2A 4PWTA 3U0OA 2QEXF 1IV3A 4EI8A 2N48A 2BO1A 1FFXB 3J7AR 2R6R1 2RHJA 3CMAF 4DXDA 4ZI7A 3LWPC 3HKBA 1KNKA 2HS4A 3JAWB 5JCOA 3LYBA 5J2UA 3ELCA 1VH8A 1W581 3C9SA 2HP0B 3I7TA 5EB0A 5GAPK 2L26A 1Q8RA 5DCVA 5LYJA 3IEWA 1W55A 2AIZP 3F0DA 3WGNA 1RQ7A 3LDTA 1VQNF 2V9YA 1X7PA 4LNUA 3JAKB 3JASB 3VYTC 3JATB 2YXZA 3GHZA 1Q86H 4I50B 3LWOC 3UT5A 4EB6B 1RLGA 3CD6F 4X3LA 4BVSA 5IJ9B 5CB4B 2JNBA 4O4LB 4RHAA 4YJ2B 3WGKA 3WGMA 5EWRA 3OW2F 3KJKA 3RYCA 5GIOC 2QA4F 2Q1YA 1X7OA 3ZP7A 4X1IA 3M84A 1YQNA 3KJJA 4BVRA 1PF5A 3QUWA 2GZLA 1OAPA 1VK3A 1VQVA 1ZWZA 2AMTA 3EORA 3HKCB 5J2TA 2MQEA 1IV1A 2ZVYA 1TVKB 3CCSF 5LA6B 4YJ3A 3S03A 2LBWA 4ERHA 5GANK 1W57A 5LXTB 1VQOF 4B62A 4BT7A 2CW4A 3CPWF 1IV2A 3RA5A 2OTJF 3CCUF 3NK6A 3WJQA 5HXZA 4HNAA 5JQGB 1W40A 1NMUB 3N2KA 4X1KA 5EB1B 4NWOB 5EYPB 5HY4A 5MN5A 2UYPA 2ZF8A 2RHOA 3CYQA 4O4HA 3P0ZA 2UZHA 4ZHQA 1SZQA 4TUYA 2GVIA 3HKDB 3S0HA 5HY1A 3JARB 5MN6A 1VQ6F 2OHWA 3FD5A 1XBIA 3F6MA 3D00A 2HX0A 3KIZA 3ZP4A 4O4IB 1VQ8F 4BT4A 4G4VA 2G9IA 3VIUA 1VQPF 5KX5A 1YJ9F 3C9TA 3JAWA 5LP6B 1W3EX 2ALEA 3VTIC 3RYHA 1KQSF 5HXUA 3G4SF 3IMPA 3RYFB 2ZODA 4BW0B 1QU9A 4C82A 4X1YA 4O2AB 3E22B 3D01A 4NUTA 1Q82H 2ZOVA 3V4DA 2RHHA 5KMGB 5GONA 3WXMB 3RE3A 3F0FA 3Q8HA 3JAKA 2HRUA 3HKEB 3JATA 2CVLA 3WJRA 3GTZA 2KTUA 1FNJA 3M4SA 5IYZB 5CB4A 2UYJA 1YGYA 4YJ2A 1VQMF 4BT3A 3CCLF 3RYIA 4G88A 1U43A 5JVDA 1IPAA 1RLUA 3LMEA 3CMEF 3VYUC 1YHQF 4RQOA 3NVIB 4U3JA 2HS3A 4TV8B 3DC2A 1VQLF 1Q81H 1ONIA 5BMVB 1NJIH 3I56F 3CC4F 1GO1A 4O2BA 1TVKA 3P4EA 1JJ2F 1W59A 2YYEA 5CA0A 2H8EA 2VGMA
chains in the Genus database with same CATH topology
3VI6A 4BVRA 1N8RH 5HY0A 1SDSA 3LWVC 2VGNA 1ZWZA 1K9MH 5IT9M 3CCEF 3NK7A 2AIFA 4BVTA 1YJNF 1VQ9F 1VQKF 2FGYA 3CCSF 3SIUA 2LBWA 5GANK 4BVQA 1GO0A 1VQ7F 3SIVA 3AGKA 1VQOF 2F9ZC 3CPWF 3V3TA 3G71F 3RA5A 3E20B 3J80M 2GLZA 2OTJF 2CZWA 1KC8H 2OTLF 2FC3A 5FLXM 3IR9A 4XCQA 1W42A 3G6EF 3NK6A 3O85A 3CCUF 1M90H 3CCVF 2HVYD 5HXZA 1W41A 3OBWA 1YJWF 1W40A 1NMUB 1RA4A 2QI2A 5HY4A 4NQ3A 3NVKE 5FJ4C 3JCMM 2KG4A 4EI9A 3CG6A 2KTVA 5G4VC 3J81M 5G4UC 5HY1A 1VQ4F 1CK2A 3RA6A 1VQ6F 3CCQF 2OHWA 1XBIA 3D00A 5EO3A 4LCKA 1X52A 1QVFF 1VQ8F 3NMUC 1K8AH 3CC7F 3CCMF 1VQPF 1YJ9F 4EI7A 1QVGF 1W3EX 5GINC 2ALEA 1KD1H 1KQSF 5HXUA 3G4SF 2QEXF 2LBXA 4EI8A 4BW0B 3GYQA 2BO1A 3CXCF 3LWQC 3J7AR 3CMAF 3LWPC 3CCJF 3E1YA 4NUTA 1Q82H 3HJWC 4C4WC 3ON1A 2I6DA 3LFOA 3FFMA 1M1KH 3CCRF 4BY9D 3WXMB 1W2BF 5GAPK 3CPQA 1S72F 3V7EA 3N4YA 2KTUA 3V7QA 1YI2F 5HY2A 5DCVA 2WALA 3PLAC 1DT9A 1K73H 1VQNF 4TZZA 3I55F 1X7PA 1VQMF 1Q7YH 2OZBA 3N4ZA 3CCLF 1YIJF 1Q86H 3OBYA 3VMFB 3LWOC 1GZ0A 1RLGA 1IPAA 3HAXD 4X3MA 3MCAB 3CMEF 3CD6F 4X3LA 4BVSA 1YHQF 5GIPC 2JNBA 3NVIB 3LWRC 3CC2F 5EWRA 5A2QM 3OW2F 1VQLF 1Q81H 1T0KB 5GIOC 1NJIH 1E7KA 3I56F 2QA4F 3CC4F 1YITF 1GO1A 1X7OA 1PXWA 1JJ2F 3JAMM 1CN7A 5HWEA 1VQ5F 3PAFA 1H7MA 2VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VI6 A;  1N8R H;  1SDS A;  3LWV C;  2VGN A;  1ZWZ A;  1K9M H;  5IT9 M;  3CCE F;  3NK7 A;  2AIF A;  1VQ9 F;  1YJN F;  1VQK F;  3CCS F;  3SIU A;  2LBW A;  5GAN K;  1GO0 A;  1VQ7 F;  3SIV A;  3AGK A;  1VQO F;  3CPW F;  3G71 F;  3RA5 A;  3E20 B;  3J80 M;  2OTJ F;  2CZW A;  1KC8 H;  2OTL F;  2FC3 A;  5FLX M;  3IR9 A;  3CCU F;  1W42 A;  3G6E F;  3NK6 A;  3O85 A;  1M90 H;  2HVY D;  3CCV F;  1W41 A;  3OBW A;  1YJW F;  1W40 A;  1NMU B;  1RA4 A;  2QI2 A;  3NVK E;  5FJ4 C;  3JCM M;  2KG4 A;  3CG6 A;  2KTV A;  5G4V C;  3J81 M;  5G4U C;  1VQ4 F;  1CK2 A;  3RA6 A;  1VQ6 F;  3CCQ F;  2OHW A;  1XBI A;  5EO3 A;  4LCK A;  1X52 A;  1QVF F;  1VQ8 F;  3NMU C;  1K8A H;  3CC7 F;  3CCM F;  1VQP F;  1YJ9 F;  1QVG F;  1W3E X;  5GIN C;  2ALE A;  1KD1 H;  1KQS F;  3G4S F;  2QEX F;  2LBX A;  4BW0 B;  3GYQ A;  2BO1 A;  3CXC F;  3LWQ C;  3J7A R;  3CMA F;  3LWP C;  3CCJ F;  3E1Y A;  4NUT A;  1Q82 H;  3HJW C;  4C4W C;  3ON1 A;  2I6D A;  3LFO A;  3FFM A;  1M1K H;  3CCR F;  4BY9 D;  3WXM B;  1W2B F;  5GAP K;  3CPQ A;  1S72 F;  3V7E A;  3N4Y A;  2KTU A;  3V7Q A;  1YI2 F;  5DCV A;  2WAL A;  3PLA C;  1DT9 A;  1K73 H;  1VQN F;  4TZZ A;  3I55 F;  1X7P A;  1VQM F;  1Q7Y H;  2OZB A;  3N4Z A;  3CCL F;  1YIJ F;  1Q86 H;  3OBY A;  3VMF B;  3LWO C;  1GZ0 A;  1RLG A;  1IPA A;  3HAX D;  4X3M A;  3MCA B;  3CME F;  3CD6 F;  4X3L A;  1YHQ F;  5GIP C;  2JNB A;  3NVI B;  3LWR C;  3CC2 F;  5EWR A;  5A2Q M;  3OW2 F;  1VQL F;  1Q81 H;  1T0K B;  5GIO C;  1NJI H;  1E7K A;  3I56 F;  2QA4 F;  3CC4 F;  1YIT F;  1GO1 A;  1X7O A;  1PXW A;  1JJ2 F;  3JAM M;  1CN7 A;  1VQ5 F;  3PAF A;  1H7M A;  2VGM A; 
#chains in the Genus database with same CATH topology
 1OFU A;  5LXT A;  5HP8 A;  1JFF B;  3OON A;  1Z5V A;  2UYK A;  4C8I A;  2H8C A;  1W5F A;  2NMU A;  1FNK A;  4O4J B;  3CCE F;  3NK7 A;  1VQ9 F;  1YJN F;  1VQK F;  3S02 A;  2VAW A;  3ZO8 A;  2Z1U A;  2DT4 A;  3SIU A;  1W5E A;  1VQ7 F;  3SIV A;  4TV9 B;  3AGK A;  3HTN A;  4FFB B;  4I55 A;  3G71 F;  3J80 M;  2FC3 A;  5FLX M;  3WGL A;  1W42 A;  3HKD A;  3JAR A;  3CB2 A;  5C8Y A;  1W41 A;  3C9U A;  2Z1E A;  5IJ0 B;  2HQS C;  3K2X A;  4ZOL A;  3NVK E;  5FJ4 C;  5LP6 C;  2UYN B;  1U3P A;  1J7H A;  3CCQ F;  3JAL A;  4X20 A;  4IHJ B;  5FNV B;  3K14 A;  2VAP A;  3MQW A;  5EO3 A;  4E6E A;  5MN4 A;  4LCK A;  3HKB B;  1H48 A;  4C8G A;  1XRG A;  4F6R A;  3CC7 F;  5J2U B;  3CCM F;  5LOV B;  3ESJ A;  4I4T B;  2CWJ A;  2LBX A;  3B6N A;  1U40 A;  3GYQ A;  5KMG A;  4B46 A;  4C8E A;  3CXC F;  4IIJ A;  4C81 A;  5CA1 B;  3WPW A;  3WJP A;  3CCJ F;  1KNJ A;  4B5C A;  3E1Y A;  3HJW C;  4C4W C;  3ON1 A;  3HWU A;  2HS0 A;  4LNU B;  3FFM A;  1M1K H;  5EZY B;  3K12 A;  3UT5 B;  1FFX A;  2RHL A;  1SA0 B;  1S72 F;  3V7E A;  5HY2 A;  2PHN A;  3PLA C;  1DT9 A;  3JVH A;  1K73 H;  4R40 B;  3FD6 A;  1CLI A;  4TZZ A;  4BT2 A;  1Q7Y H;  3RYC B;  2Z1T A;  3N4Z A;  3I3F A;  4TV8 A;  2HP0 A;  3OBY A;  2RB9 A;  5BMV A;  2R75 1;  3KHN A;  2BTO A;  4X1I B;  4X3M A;  3FBA A;  1H7M A;  1H47 A;  2CSL A;  3N2G B;  5GIP C;  3DDN A;  1IV4 A;  2VAM A;  5A2Q M;  5J2T B;  1JFF A;  3MCQ A;  2CHT A;  3JAS A;  4O4J A;  4YJ3 B;  1E7K A;  1YIT F;  4I50 A;  4EB6 A;  3JAM M;  1COM A;  4DRX B;  3PAF A;  1VQ5 F;  5IJ9 A;  5ITZ B;  3VI6 A;  4O4L A;  1N8R H;  4FFB A;  1SDS A;  4ZHY B;  5AVM A;  1NQ3 A;  2Z01 A;  1K9M H;  5IT9 M;  2AIF A;  4BVT A;  4HNA B;  2FGY A;  4BVQ A;  1QD9 A;  3IKF A;  3WGJ A;  1JN1 A;  2F9Z C;  4O4H B;  3QTY A;  3TD4 A;  2GLZ A;  1KC8 H;  2UYN A;  2OTL F;  3IR9 A;  2HVY D;  2QTP A;  3HKC A;  3O85 A;  4B45 A;  3CCV F;  3T80 A;  3VYS C;  4G4X A;  5JCO C;  5LA6 A;  4IHJ A;  5FNV A;  3L7Q A;  2KG4 A;  4EI9 A;  2KTV A;  4M8I A;  2Z1F A;  5KX5 B;  1RQ2 A;  3J81 M;  3S06 A;  1Z5W A;  1VQ4 F;  2B33 A;  5G4U C;  1CK2 A;  2IQQ A;  3RYH B;  5LOV A;  4I4T A;  5JH7 B;  1XHO A;  4WBN B;  5JQG A;  5EIB D;  4X1Y B;  5EYP A;  5HP7 A;  1TUB B;  2LCA A;  2HRY A;  3NMU C;  1K8A H;  3M1X A;  5CA1 A;  5EAZ A;  4EI7 A;  1QVG F;  3MBM A;  5EIB C;  5GON B;  4G4Y A;  2IG8 A;  1DBF A;  5EZY A;  3LWQ C;  3IKE A;  1X25 A;  1SA0 A;  4O4I A;  2BTU A;  3R0P A;  5LP6 A;  1R1M A;  2I6D A;  3LFO A;  3C8L A;  3RYI B;  3CCR F;  4BY9 D;  2W8B C;  1W2B F;  3RYF A;  3CYP B;  4ZI7 B;  5JVD B;  3VOB A;  3VO8 A;  1UI9 A;  4ZK7 A;  3CPQ A;  4O2A A;  3E22 A;  3N4Y A;  3V7Q A;  3K0T A;  2P6Y A;  1YI2 F;  1UFY A;  2WAL A;  4U3J B;  3N2G A;  1JY8 A;  3I55 F;  3FPI A;  2ZVZ A;  2OZB A;  2EWC A;  3TD3 A;  1YIJ F;  1U3L A;  2CHS A;  3ERN A;  4O2B B;  3VMF B;  4ZHV A;  1GZ0 A;  3HAX D;  3HKE A;  4BT6 A;  3MCA B;  5LYJ B;  5CA0 B;  3VCZ A;  1VHA A;  4DRX A;  3LWR C;  5ITZ A;  3S0W A;  5IYZ A;  3CC2 F;  3F0G A;  1QAH A;  4KWE A;  2BTQ B;  3S0Y A;  1T0K B;  3VOA A;  2KGW A;  1PXW A;  3WPX A;  1CN7 A;  4I55 B;  5HWE A;  2OTM A;  3ZOP A;  2IAF A;  5HY0 A;  3LWV C;  1GX1 A;  3KE1 A;  2VGN A;  4BT5 A;  2PMP A;  5B8F A;  1JD1 A;  5C8Y B;  3BYQ A;  3IEQ A;  4ZOL B;  1GO0 A;  2VXY A;  3QHD A;  2LBT A;  2K1S A;  2Q1X A;  3V3T A;  3E20 B;  2CZW A;  1FSZ A;  4G4W A;  1M90 H;  3JAL B;  2I6R A;  4X20 B;  4XCQ A;  3G6E F;  2HP3 A;  3OBW A;  1YJW F;  1RA4 A;  2QI2 A;  3P10 A;  3F0E A;  5JH7 A;  4NQ3 A;  2DYY A;  4WBN A;  4TV9 A;  4U39 A;  3JCM M;  1ODE A;  3C9R A;  3CG6 A;  4F6R B;  1TUB A;  1W5A A;  5G4V C;  3RA6 A;  1T0A A;  3N2K B;  4X1K B;  3D54 A;  2H6L A;  4IIJ B;  5IJ0 A;  1W5B A;  1X52 A;  1QVF F;  4ZHQ B;  4TUY B;  3MDO A;  4ZHW A;  3TD5 A;  4G4Z A;  2ZAU A;  5GIN C;  1KD1 H;  1XV2 A;  4PWT A;  3U0O A;  2QEX F;  1IV3 A;  4EI8 A;  2N48 A;  2BO1 A;  1FFX B;  3J7A R;  2R6R 1;  2RHJ A;  3CMA F;  4DXD A;  4ZI7 A;  3LWP C;  3HKB A;  1KNK A;  2HS4 A;  3JAW B;  5JCO A;  3LYB A;  5J2U A;  3ELC A;  1VH8 A;  1W58 1;  3C9S A;  2HP0 B;  3I7T A;  5EB0 A;  5GAP K;  2L26 A;  1Q8R A;  5DCV A;  5LYJ A;  3IEW A;  1W55 A;  2AIZ P;  3F0D A;  3WGN A;  1RQ7 A;  3LDT A;  1VQN F;  2V9Y A;  1X7P A;  4LNU A;  3JAK B;  3JAS B;  3VYT C;  3JAT B;  2YXZ A;  3GHZ A;  1Q86 H;  4I50 B;  3LWO C;  3UT5 A;  4EB6 B;  1RLG A;  3CD6 F;  4X3L A;  4BVS A;  5IJ9 B;  5CB4 B;  2JNB A;  4O4L B;  4RHA A;  4YJ2 B;  3WGK A;  3WGM A;  5EWR A;  3OW2 F;  3KJK A;  3RYC A;  5GIO C;  2QA4 F;  2Q1Y A;  1X7O A;  3ZP7 A;  4X1I A;  3M84 A;  1YQN A;  3KJJ A;  4BVR A;  1PF5 A;  3QUW A;  2GZL A;  1OAP A;  1VK3 A;  1VQV A;  1ZWZ A;  2AMT A;  3EOR A;  3HKC B;  5J2T A;  2MQE A;  1IV1 A;  2ZVY A;  1TVK B;  3CCS F;  5LA6 B;  4YJ3 A;  3S03 A;  2LBW A;  4ERH A;  5GAN K;  1W57 A;  5LXT B;  1VQO F;  4B62 A;  4BT7 A;  2CW4 A;  3CPW F;  1IV2 A;  3RA5 A;  2OTJ F;  3CCU F;  3NK6 A;  3WJQ A;  5HXZ A;  4HNA A;  5JQG B;  1W40 A;  1NMU B;  3N2K A;  4X1K A;  5EB1 B;  4NWO B;  5EYP B;  5HY4 A;  5MN5 A;  2UYP A;  2ZF8 A;  2RHO A;  3CYQ A;  4O4H A;  3P0Z A;  2UZH A;  4ZHQ A;  1SZQ A;  4TUY A;  2GVI A;  3HKD B;  3S0H A;  5HY1 A;  3JAR B;  5MN6 A;  1VQ6 F;  2OHW A;  3FD5 A;  1XBI A;  3F6M A;  3D00 A;  2HX0 A;  3KIZ A;  3ZP4 A;  4O4I B;  1VQ8 F;  4BT4 A;  4G4V A;  2G9I A;  3VIU A;  1VQP F;  5KX5 A;  1YJ9 F;  3C9T A;  3JAW A;  5LP6 B;  1W3E X;  2ALE A;  3VTI C;  3RYH A;  1KQS F;  5HXU A;  3G4S F;  3IMP A;  3RYF B;  2ZOD A;  4BW0 B;  1QU9 A;  4C82 A;  4X1Y A;  4O2A B;  3E22 B;  3D01 A;  4NUT A;  1Q82 H;  2ZOV A;  3V4D A;  2RHH A;  5KMG B;  5GON A;  3WXM B;  3RE3 A;  3F0F A;  3Q8H A;  3JAK A;  2HRU A;  3HKE B;  3JAT A;  2CVL A;  3WJR A;  3GTZ A;  2KTU A;  1FNJ A;  3M4S A;  5IYZ B;  5CB4 A;  2UYJ A;  1YGY A;  4YJ2 A;  1VQM F;  4BT3 A;  3CCL F;  3RYI A;  4G88 A;  1U43 A;  5JVD A;  1IPA A;  1RLU A;  3LME A;  3CME F;  3VYU C;  1YHQ F;  4RQO A;  3NVI B;  4U3J A;  2HS3 A;  4TV8 B;  3DC2 A;  1VQL F;  1Q81 H;  1ONI A;  5BMV B;  1NJI H;  3I56 F;  3CC4 F;  1GO1 A;  4O2B A;  1TVK A;  3P4E A;  1JJ2 F;  1W59 A;  2YYE A;  5CA0 A;  2H8E A;  2VGM A; 
#chains in the Genus database with same CATH homology
 3VI6 A;  4BVR A;  1N8R H;  5HY0 A;  1SDS A;  3LWV C;  2VGN A;  1ZWZ A;  1K9M H;  5IT9 M;  3CCE F;  3NK7 A;  2AIF A;  4BVT A;  1YJN F;  1VQ9 F;  1VQK F;  2FGY A;  3CCS F;  3SIU A;  2LBW A;  5GAN K;  4BVQ A;  1GO0 A;  1VQ7 F;  3SIV A;  3AGK A;  1VQO F;  2F9Z C;  3CPW F;  3V3T A;  3G71 F;  3RA5 A;  3E20 B;  3J80 M;  2GLZ A;  2OTJ F;  2CZW A;  1KC8 H;  2OTL F;  2FC3 A;  5FLX M;  3IR9 A;  4XCQ A;  1W42 A;  3G6E F;  3NK6 A;  3O85 A;  3CCU F;  1M90 H;  3CCV F;  2HVY D;  5HXZ A;  1W41 A;  3OBW A;  1YJW F;  1W40 A;  1NMU B;  1RA4 A;  2QI2 A;  5HY4 A;  4NQ3 A;  3NVK E;  5FJ4 C;  3JCM M;  2KG4 A;  4EI9 A;  3CG6 A;  2KTV A;  5G4V C;  3J81 M;  5G4U C;  5HY1 A;  1VQ4 F;  1CK2 A;  3RA6 A;  1VQ6 F;  3CCQ F;  2OHW A;  1XBI A;  3D00 A;  5EO3 A;  4LCK A;  1X52 A;  1QVF F;  1VQ8 F;  3NMU C;  1K8A H;  3CC7 F;  3CCM F;  1VQP F;  1YJ9 F;  4EI7 A;  1QVG F;  1W3E X;  5GIN C;  2ALE A;  1KD1 H;  1KQS F;  5HXU A;  3G4S F;  2QEX F;  2LBX A;  4EI8 A;  4BW0 B;  3GYQ A;  2BO1 A;  3CXC F;  3LWQ C;  3J7A R;  3CMA F;  3LWP C;  3CCJ F;  3E1Y A;  4NUT A;  1Q82 H;  3HJW C;  4C4W C;  3ON1 A;  2I6D A;  3LFO A;  3FFM A;  1M1K H;  3CCR F;  4BY9 D;  3WXM B;  1W2B F;  5GAP K;  3CPQ A;  1S72 F;  3V7E A;  3N4Y A;  2KTU A;  3V7Q A;  1YI2 F;  5HY2 A;  5DCV A;  2WAL A;  3PLA C;  1DT9 A;  1K73 H;  1VQN F;  4TZZ A;  3I55 F;  1X7P A;  1VQM F;  1Q7Y H;  2OZB A;  3N4Z A;  3CCL F;  1YIJ F;  1Q86 H;  3OBY A;  3VMF B;  3LWO C;  1GZ0 A;  1RLG A;  1IPA A;  3HAX D;  4X3M A;  3MCA B;  3CME F;  3CD6 F;  4X3L A;  4BVS A;  1YHQ F;  5GIP C;  2JNB A;  3NVI B;  3LWR C;  3CC2 F;  5EWR A;  5A2Q M;  3OW2 F;  1VQL F;  1Q81 H;  1T0K B;  5GIO C;  1NJI H;  1E7K A;  3I56 F;  2QA4 F;  3CC4 F;  1YIT F;  1GO1 A;  1X7O A;  1PXW A;  1JJ2 F;  3JAM M;  1CN7 A;  5HWE A;  1VQ5 F;  3PAF A;  1H7M A;  2VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...