1W2BU

Trigger factor ribosome binding domain in complex with 50s
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1w2bU00
1R73A 2OTLV 1K9MW 3CC7V 3CMEV 1VQ4V 4WFBV 3CPWU 1W2BU 2D3OW 3I55V 3G6EV 1YI2V 1Q82W 1QVGU 3G4SV 1N8RW 1NJIW 1M90W 1YJNV 4WCEV 1KC8W 1QVFU 5DM6V 3CXCU 1VQOV 1VQLV 3CCEV 1YJWV 3I56V 3CCRV 3CCLV 3G71V 1K73W 1KQSU 1KD1W 1VQ6V 4WF9V 2QEXV 3CCMV 1VQMV 3OW2U 1VQ5V 1YJ9V 1VQPV 1VQKV 3CC4V 1YITV 3CD6V 1Q81W 1Q7YW 3CC2V 1YHQV 1K8AW 1JJ2U 2OTJV 3CCUV 3CCSV 1S72V 1VQ7V 3CCVV 1VQ9V 1YIJV 1VQNV 1VQ8V 1Q86W 1M1KW 3CMAV 4WFAV 3CCJV 3CCQV 2QA4V
chains in the Genus database with same CATH superfamily
3OR6C 4KFMA 2GBOA 3AG7A 4DV3O 1NR7A 3SJBC 1KC8W 2N05A 1Z2GA 3K59A 4ZI7B 1M9NA 1SZTA 4BW9A 3AK3A 3U11A 4I0XB 3L74H 4TV8B 5JWPA 1AP6A 2KKWA 1O9GA 3CYOA 3ABUA 3RFRA 5ITZB 3J7AU 1XNQB 4BIUA 3ZRVA 1N36B 2DYRB 3ETQA 2F43G 4DUZB 1PL4A 4LF7O 2V4DA 4O4LB 1LR1A 2E74B 4MVRA 3A0HZ 1NH2D 2F4VB 1WN7A 2OYQA 4XBFA 1BHBA 5L3CA 1R1BA 1RP3B 4U7NA 1H2LA 3G71V 2FB5A 1TGOA 1JPXA 2VQEO 5IJ9B 3ETDA 3WG7B 4DR5B 1FAFA 1Q7YW 3THOA 4CS4A 1BZKA 1S3JA 1P7BA 4PI2A 4PDMA 3CRRA 3L72H 2WLMA 3ASNC 3CPWU 3IAYA 5CB4B 3RN4A 4J80A 4IYHA 2EIKB 2OCCC 1Q5OA 2JGDA 2Z0AA 2O57A 3RYHA 2N74A 4LFCB 4TV9B 3ZN0A 3AG1C 1ZL8A 1YXBA 2KG7B 3JATB 4MVZA 1F4NA 1QHTA 3B40A 1RPOA 1BT8A 1GMGA 1N33B 3JSLA 1HNXO 3MHHC 3CCQV 4DR4B 3G67A 1GN6A 1YI2V 4GUNA 1SQXH 1PL0A 1RM1B 1SRYA 4EEQA 3F7VC 4AILC 1N34O 2Q9LA 1AI6A 1AROP 4JTAB 4B3MB 4I0XA 2IJKA 3AG2B 3CRCA 2RCVA 4B3TB 4MVUA 3ASOB 2F95B 4K8ZA 4B3SO 3NR7A 1WAZA 1NT2B 3QTCA 1FFXB 3E8BA 1Y66A 1LUVA 5B66Z 4DV4O 4DW1A 1XMOO 2JS3A 4WFGA 1K33A 1UFIA 3JALB 4DYLA 4OXSA 2AZ2A 4JZ2A 1SQPH 4EFEA 5LGTA 4FLYA 4QE9A 4PA7A 3TJTA 2QTSA 4PDVA 1EFRG 5BY1A 2V1DA 1YTFD 1IURA 1IXMA 2BOCC 1AR4A 1WP7A 4X88A 1DK1A 1RPRA 4JF3A 3FB6C 2ZM6B 3WB2A 1EBOA 3HKDB 1BQ0A 2Z5UA 1PM9A 4BW5A 3OGCC 2JRIA 1M57B 5L3DA 1Q86W 1OCOC 4I9WA 5FL7G 4DR2B 4UB6Z 1AI7A 4UXNA 3D36C 2LFSA 4LH6A 3BCCH 2UUCB 1M5IA 1V9PA 3G6BA 3TK1A 1RFYA 2GTSA 4GCZA 4TV9A 2HJFC 2JDIG 2KG7A 3JATA 3OAAG 3D3IA 2HP8A 5TISZ 5BMVB 1IBLO 1H2SB 1HNZB 2A06H 4CS2A 2HKOA 3E8GA 4G27B 2HEPA 3KZIZ 3SDLA 3R65A 2P7TC 2VRZA 4I7ZB 3CXCU 3ZJZA 4LF6B 3F5WC 2MK3A 3K58A 2HHHO 3RYCB 4JYBA 4PA6A 3CX5F 5CN0A 2XAQA 2UXCB 3ZN1A 4EFBA 5BR8B 4FM0A 1KP3A 4Z1MG 3MDSA 4KHPB 1AJQA 2IJJA 5GW7A 2EZPA 3ZHUA 3CRMA 4JI2B 3SPHA 3QVNA 1K3EA 4PELA 5LGNA 3O65A 4H0LB 4MTFA 4J10A 2OIEA 1FFTB 4E2LA 2F66C 1F23A 4X62O 1OJHA 1FFXA 3LNMB 5IY5C 4LH7A 3UCSC 4FLUA 3BABA 2YDEA 3UT5B 4RUEA 3JALA 2QDOA 2AXTZ 3JAMN 4DV1O 2QKAA 3K9SA 1CPYA 1BQZA 1XQ8A 4NXMO 3RYIB 3QO8A 1K9MW 4MVSA 1WA8B 4YY3O 4C7UA 2YEVB 2EULA 3BEHA 4P9PA 3HKDA 5L3FA 2BOBC 4WFFA 4RWUA 4K0KO 3CCUV 3P3PA 5CA0B 2QSAA 1S0VA 5BXZA 4CS3A 3H1LH 4FLVA 2UUAO 4LF9B 4B3RO 1IBKB 2JEXA 5B1BC 1KYOF 3CCRV 5EK0A 3UM7A 2AGAA 4I5SA 3VQWA 2E5LO 2QKSA 2AHZA 2W6JG 4LWSB 4CZZA 4O2AB 1H2MA 3E22B 5BMVA 1GN4A 3CCSV 1ZX3A 1K5QA 1KB9F 2WLHA 1SC5B 2QA4V 4A5UB 1Y74B 5FPOA 2DWDC 2UXBO 4GX0A 5IT9N 3HPLC 3RYCA 4EB6B 1Z5VA 4H44B 1W0JG 2DYSC 1S72V 3CCVV 1YIJV 5JCOA 2K1EA 4G28B 1I08A 3ZMVA 1D5AA 2PYLA 2IU0A 3LSUA 3M7MX 3T1YB 4PHZA 4LR3A 1IBMO 3W7UA 4NXNB 1Q6HA 1PNKA 3LDEA 4EKWA 4LF4B 5B3SB 3LDDA 3ZRXA 2EILC 3H1KH 1Q6UA 5IE9A 4NTWA 3RVYA 2EJ7A 1J5EB 5IWAO 4FIPC 4JTCB 4DR6O 3RYIA 3GVMA 4GX1A 4CH6A 3DXRB 1NJIW 1P7GA 2QWNB 4DR7O 3CP1A 1R3IC 3U10A 1GKFA 3UO3A 1WA8A 1XL4A 4Q6GA 1L0NH 4LFAO 4DV6O 3FB8C 4FM1A 2JIZG 5LP6C 1TUEB 3B4SA 1T5EA 4KXRA 1HNWB 2ZDIC 3JAWB 2CTWA 4E4EA 2QWPB 2LJ2A 1FKAO 5CA0A 3ZEDA 1GH6A 1U96A 3K5LA 1DF4A 4JYAB 2AW9A 4JI8B 2ETNA 4LCUC 2EINB 2JS5A 3GWKC 1FXVA 3B09A 4O2AA 1G1XB 4J42A 3H9VA 4UCTA 2DW4A 4J9ZB 4JI5B 1VQ4V 2LW1A 1Y74A 2EIJC 3WFVA 2QM7A 1XILA 3DTUB 3VQVA 1QR9A 2GTAA 1VMGA 1VQLV 2FTKA 2BTOA 5LMNO 3L71H 2IH3C 4F4LA 1B06A 3VQYA 3ZHTA 5IJ0A 2PI5A 2QKCA 1JVMA 3H1HH 4JI7O 3GB7C 2JEUA 1SQQH 3ZRSA 4JYCA 2P4VA 3ZMUA 4YIPA 3OD4A 1GK9A 1S76D 2L35A 2Q0OC 4X65O 2FKXA 4NR1A 5KLVH 3T1HB 2DOSA 1M93A 3DXRA 4IGGA 1YJNV 1KUQA 4UCSA 1B6QA 3AK2A 5KAIZ 3NXSA 4ZIBA 3K0GA 1WP8A 4QJFB 3CSXA 1TA8A 1FXKC 3JAWA 4WFAV 4DV2O 2P4KA 1COWG 4X66B 1OCRB 2X7RB 3QF7A 3AG3C 4Q20A 4X64O 1XNRO 1FYJA 1Y6XA 1F51A 2VQFO 4X1KB 3P32A 1OCZB 4PA4A 1Q6IA 4HNAB 4X9QA 1SQGA 3F5TA 1H2GA 5LA6B 3ZBHA 4JI1O 1FPOA 1MG1A 4CC6A 1MA1A 4BR6A 2WSSG 1EZJA 1V55C 4AQYO 1Q81W 1M56B 3ZHQA 2YSUB 1L0LH 2UXDO 5KHGA 4PD4F 4JI6B 1V54B 4NB5A 2JJ1G 4PA3A 5IYBO 1HWYA 4GKKB 3H1JH 4AHCA 2ZCEA 3ZS8C 1OCCB 1VQ8V 4JAUA 2EZOA 1IXBA 2YXLA 2PUSA 1WJZA 3ABMB 3B77A 5GTHZ 5FLXN 4P9OA 2IJIA 2CE4A 2Q7HA 4DV5O 5CBGA 2IM9A 4DV7B 2E75B 3OGIB 4I50B 1QLNA 1MZFA 2QR4A 1XREA 3OTFA 3X2QC 1K7DA 4CBCA 4YJ3A 4PDLA 5DN6G 4OPAA 1IBLB 1BS3A 4TWKA 1PNMA 3OTOO 1D2DA 4LBEC 1VQPV 3ZMTA 4X1KA 1DLBA 2GDSA 4DK0A 4DUYO 4MS2A 2ZKOA 4J11A 2YI9A 3ZRWB 4HNAA 4TT3G 1NVPB 4RO2A 2YIBD 4K3AA 3E2EA 1JX9A 4QPKA 5LA6A 2GV9A 3MD0A 3SYCA 1X4TA 1KQSU 1YZBA 3LSQA 1JR9A 2EIMC 3SYQA 1EN4A 4MW3A 3STLC 5F2VO 2XAGA 3ASNB 1AJNA 4FVMA 2W0FC 4DR1O 2P67A 3HR0A 4JZGA 3JD0A 1X59A 2OCCB 1K4CC 3ZX6A 4F6RB 4NXMB 3ZHVA 1GM7A 3BAAA 4LFBB 3AG1B 4RQEA 4MTGA 4JI3O 4X8AA 1P84F 3AG2C 4YY3B 4DV0B 1IDSA 2H8PC 5H6QA 4JI0O 3C3SA 2CAZC 4NVPA 1NBMG 2GUZB 3JAKA 1IVSA 1SF9A 2F23A 2BTQB 2A0LA 4OX9B 3FX7A 2ZE7A 4JASA 4J7JA 1EZVH 4CC5A 1H38A 1YJWV 3T2MA 5J9PC 5GONB 1I94B 1TVKA 4I50A 1NS1A 1XHZA 1MMMA 1JJ2U 1HP8A 2IW5A 1NH2B 3O9OA 3D8CA 4IIJA 1AILA 5DECA 4ASUG 1MNGA 5KA6A 2NR5A 3UO2A 5KX5B 2E3CA 1Q8IA 1VQOV 3JD4A 5L3GA 1EN6A 1IX9A 1ENVA 1KECA 4BAYA 1VQNV 3VBBA 3ZRWA 2P6JA 5KUMA 2IBZH 3E35A 1PKXA 1B3QA 2DN9A 3N2GB 1NKDA 1AB3A 3CCLV 2KB1A 3SPGA 1DTOA 1XNQO 4B7KA 2A79B 3JARB 2RDCA 4NYKA 1N36O 2B1IA 4DUZO 4FK5C 1U97A 3BPZA 4UUJC 4ZKIA 1OCOB 3CRQA 1JFFA 3W7TA 2V7QG 4UVCA 1Q82W 3A0RA 2LFRA 2F4VO 4JI4B 3C90A 5EC2C 5DM6V 3K08A 2NN4A 2C2AA 2PGGA 4H37A 4F6RA 2JK5C 3DC6A 1VQKV 5J2TB 1SETA 5FPRA 4BIOA 1QU7A 2QJ1A 5LMUB 5EIBC 4IHJB 3UQ8A 2H94A 1QLEB 2GUZA 4N23A 4O4JB 2B1GA 3E86A 4YJ2B 4DR5O 2BTQA 1Z5WA 2ZNIA 4NTXA 5GONA 4JPRA 1YITV 2Z3YA 1SERA 1G8MA 1KP2A 1WPXA 1BHAA 3FFQA 2WLKA 4IYIA 4UCOA 1NZ6A 1WNSA 2P06A 2KQXA 3ICXA 4WFBV 3BFRA 5KX5A 3SPIA 1KKDA 2CH7B 1S5LZ 3K79A 4J7ZA 5IY5B 1YTFB 5KMGB 4DR4O 4U3JA 3IGAC 3FYIB 3APQA 5IYZB 1WB7A 1SESA 4CH5A 2BSKB 4B08A 4LF8B 2WWWA 3AEIA 4GKJO 1VQ7V 1SQVH 4PV1B 2ARHA 5LMNB 1G6UA 3I55V 4P2ZA 2WLLB 3FB7C 2YIBA 3N2GA 4B3MO 1K97A 4B3TO 2P22C 1VQ6V 1G4YB 3QG5A 1NR1A 1PD3A 3K57A 3L70H 3OT7A 4QPJA 3JARA 3AG4B 5JJEB 5KHJA 1VF6C 2OTLV 2R72A 2X6CA 1FJGB 2WA3A 3D36A 5LGUA 5LL6Y 5B1BB 2ZIMA 1KD1W 2R70A 5LYJA 1KKCA 4DK1A 3QNEA 1VEWA 5J2TA 5IJ0B 3JD3A 3K0DA 3B8NA 4UB8Z 3ZHSA 1N32B 4IHJA 5K1PA 5AG2A 2HG5C 4TSFG 1DF5A 3P3NA 1R6TA 3LSSA 4O4JA 3ABLC 4YJ2A 3W7SA 2ITCC 3HKCB 2OCHA 4DR3B 2WLJA 2XT9A 1D5NA 1XOUA 3RVZA 2WPDG 4D7TA 4DR2O 1XDCA 1BL8A 2DYSB 4X64B 1XNRB 2KSDA 2UU9B 3MHSC 2UUCO 2YUAA 1AP5A 3EFFK 4LF5B 3QO5A 4I55B 3RYFB 1NI8A 1BCCH 1XHXA 3ABKC 2CH7A 1K4DC 1HNZO 4KL1A 2WA4A 5KMGA 3LNNA 5KHKA 5KA5A 1MZEA 1GN3A 5IYZA 3SJCC 1I7FA 5JH7B 2EILB 3BY6A 2Q4PA 1SKVA 2BSKA 3HKEA 4LF6O 4X1YA 4FFKA 1KMIZ 2YICA 4NTYA 1UJWB 1A32A 2UXCO 3OEHG 2Y69B 4G2KA 5BR8O 4KHPO 2WLLA 2ZXWC 2FMLA 2UUBB 1OHHG 4UVAA 2OIGA 2AHYA 5KHIA 3BVOA 4DV3B 5B1AC 4J41A 3F7YC 3WB1A 1Q43A 4RAIA 4XDJA 3T4DA 3E8HA 1JQ0A 1IZ3A 1SA0B 2P90A 2ODMA 3RWRD 1GAXA 4HZ3A 4MSWC 1GTOA 1W59A 1JA8A 2YC0A 2YIDA 3U0ZA 3AK1A 4LF7B 4GZRB 3E89A 3WB0A 2EIJB 2PYJA 4MT8A 4PA9A 3A2FA 1JMKC 5L3EA 3JASA 3HKCA 1QQCA 4WFEA 1NTKH 1YDXA 5EBWC 3SPJA 5KUKA 1OZ0A 3VOUA 3QO7A 2ZNJA 4PDRA 4HAMA 4N21A 1VQ9V 3OTOB 1IBKO 3GWOA 2VQEB 4TQFA 3K03A 1CP9A 1TUBB 4I55A 3RYFA 3K5OA 3SYPA 1E79G 1AJPA 4FZ1A 4RUFA 2XAFA 5JH7A 3RGBA 1I5XA 2HVJC 4YJ3B 3H1IH 3BA9A 4LNUB 1HNXB 4O4IB 2HR3A 4FFBB 1PNLA 3CHXA 5JJJB 2Q67A 1AI4A 3E83A 5LP6A 3CD6V 1OCZC 2ZDIA 5LHGA 1FXKB 3SGIA 3T1YO 4GLXA 2CTRA 3CJHB 1N34B 1H2KA 4NXNO 1Q90D 3HKBA 1SA0A 2BCCH 4LF4O 1QVGU 2W0XA 3CRAA 2Q69A 3AG3B 1JOYA 2FL4A 3LDCA 2IU3A 4WF9V 2ZE8A 3OUFA 4B3SB 1XBLA 2VWJA 4MVOA 4H33A 2Q73A 3JSNA 2QM4A 3L9DA 4JTDB 4DV4B 3PJSK 1XMOB 4WBNB 5DEDA 3SR2C 4RQFA 3G4SV 1W0KG 3FKSG 3ZCCA 3MAQA 2DQ0A 1HNWO 2A7WA 1WLEA 2Y0PA 1V55B 4ZOLB 4W4LA 1K8AW 4JYAO 2Q0AA 5BZBA 5C93A 1ZTEA 2JJ2G 4LC1A 2PI4A 3JAKB 1W2BU 1HW7A 3T4ZA 1N8RW 1TUBA 2ZT9B 4YXWG 2DYRC 2Y4TA 2NNUA 1I5YA 1NTZH 4JYYA 2ZE6A 2ZD9A 1TVKB 4UFZA 5H2FZ 4JI5O 4X20B 4ICGA 2FYUH 1E1QG 2CK3G 2PZSA 1NQTA 3TXQA 3H01A 4O4HB 4CH3A 2JVDA 4QNHB 4IIJB 2EJRA 5KHHA 2HLDG 2XOKG 3L75H 4LNUA 4D7SA 3OE7G 1S77D 1R3JC 4O4IA 4FFBA 4UV9A 3J81N 3KCYA 5CA1B 1XUQA 2QEXV 3WG7C 4YIOA 1AR5A 1GN2A 3EVKA 4JV5O 2X0LA 1MSDA 2Q7GA 2HHHB 4D6TH 5IYCO 2R9AA 4DXWA 1VARA 2NLJC 1M4UA 1FXKA 3X2QB 2LO1A 1CXZB 3CJHA 3FB5C 1SQFA 1VF7A 2CTPA 3N2KA 2EIKC 5HFMA 3T1HO 3I5DA 5EBMC 3T1CA 4UV8A 1TAEA 3DC5A 3RBZA 1HR0O 4X62B 4HYOA 1J95A 4FZ0A 2ZE5A 1UPGA 5EBLC 2HVKC 4WBNA 1JFFB 3CE2A 4OPHA 1JCHA 2CUGA 2Q7EA 5B1OA 4DV1B 2F93B 1R3KC 4ZHQB 1RM1C 4R50A 4YHHO 2GHYA 1I0HA 1DGSA 2QTOA 4R7CA 3S3XA 2EIMB 4I4TB 4X66O 4AI8A 4ZOLA 4U3FH 3ASOC 1Q3EA 1EM1A 2DE0X 2R9RB 4FPPA 1XMQO 5C8YB 5CMUA 1QNMA 4K0KB 4GKJB 5LHHA 2YXYA 2LQTA 3DSQA 4TUYB 4ZI7A 2XASA 5D5QA 2UUAB 4JGSA 4UCRA 4X20A 2PY5A 4B3RB 4TV8A 5E1AC 5EIBD 2OTJV 3A0BZ 4O4HA 2E5LB 4GX5A 2EX3A 5ITZA 1P49A 3KKYA 2UXXA 5LHIA 4O4LA 4DRXB 4U3JB 5CA1A 3CC4V 1LUWA 4O2BB 5E79Z 1M57C 2UXBB 2ILMA 4TQDA 4QIWF 4JI6O 4IL6Z 2XTAA 1EN5A 3CC2V 2UXNA 4PI0A 3W7WA 3M99B 4GKKO 1US6A 1F7YA 3J80N 3HB3B 5IJ9A 4J9YB 3B2EE 2N04A 1URFA 1IBMB 4DV7O 4PJ0Z 5CB4A 3L73H 1XL6A 5L3BA 3IC9A 5IWAB 4ZHQA 1THZA 3R66A 5LYJB 4DR6B 2RNBA 2B5UA 3ETGA 2Y4UA 4DR7B 4XDKA 4I4TA 4KUMA 3FD9A 5JCOC 4LFAB 4DV6B 2QM8A 3ZIAG 2Q68A 2XHBA 1L8DA 1QLEC 3K5NA 5C8YA 4X1IB 1R6NA 3KG2A 1L1FA 4L8JA 3E8FA 4TUYA 1KU9A 3P30A 3DGEA 3KCXA 1R6KA 2YI8A 1K34A 1JJOA 4GT1A 2VWKA 4LFCO 3OMAB 3CWBH 3ETEA 1N33O 3CCEV 4JAVA 1NU1H 1N0NA 1ZAUA 2LW7A 4WFHA 1K92A 4DRXA 3CS5A 4O2BA 1XEQA 3EHBB 1GRJA 3HKEB 3K3WA 4Z2WA 3JCUZ 3ZMZA 4X1YB 5JJNB 2ADPA 1BSMA 5JVDB 4LFBO 3CC7V 1NTMH 4TOIA 5LBQA 5LOVB 3SPCA 4WCEV 1N4CA 1VIBA 4DV0O 1CEZA 3TETA 1AI5A 1BMFG 2DJVA 1AR1B 1MOFA 1YCIA 3ABTA 4JI7B 2Q5ZA 4FLZA 4K35A 3JCZA 4OX9O 4OGQB 3AG4C 4R6ZA 3CMAV 1I94O 2OWOA 3PN1A 4X65B 2XNDG 3CMEV 2Y0IA 1ZSPA 3OR7C 3K9AA 3EXAA 1F4MA 2WAMA 3K06A 3I56V 1K73W 3BA8A 5EYPB 3SYAA 1YJ9V 1YF2A 2HFEC 3D3QA 4MVQA 1HDJA 4BIZA 4IT5A 4FLXA 2W6IG 3RT3C 2ZM6O 1FS0G 2JGUA 4X89A 2D3OW 4X1IA 2GSMB 2VS0A 2A3QA 4GX2A 4ABMA 3OM3B 4MVMA 5J2UB 2BE3A 3JASB 3OMNB 4DV2B 3TGUH 3TCUA 3RW0A 5LXTB 1Y76B 5B3SC 1E1RG 4CH4A 5CBFA 2CGNA 4QGPA 2VQFB 4LP8A 2M7WA 4HBNA 5H6RA 1R73A 2X6BA 1Y67A 3JYCA 2ZQMA 3A8TA 3ZHRA 5IYDO 3ABLB 1ORQC 2YS8A 1GO3F 3FAVB 3IC7A 1QBZA 2ATKC 4FM2A 1WB8A 5B1NA 1YSCA 2WLIB 3UT5A 3OW2U 1BGYH 5A9GA 3K5MA 4J7KA 4DO2A 1SS3A 4JI4O 2MW2B 4JI1B 2A9HA 3OFNG 1QR8A 1SQBH 5HFLA 2EBOA 3UKMA 4FMTA 4NKGB 1K5SA 4Z1VA 5JVDA 2Y69C 3ZMSA 4DW0A 4AQYB 2ZIOA 1ZLZA 4UVBA 4XDLA 5LOVA 5H5NA 1VP7A 2L6LA 3ABKB 4JI2O 1OV9A 2QGNA 3APOA 5JQGB 3SJAC 2DMXA 2YEVA 3Q4HB 5LMUO 1S5JA 2EINC 2Q8VA 5LP6B 2X6AA 3W7XA 1SZXA 2YIAA 2UXDB 2YXHA 2AZ0A 5EZYB 1M1KW 2H3OA 2QWRB 3HKBB 3VQXA 1QVFU 2ZXWB 1BE3H 2RJZA 2HJDA 5D5PA 1S5HC 3CCMV 5EYPA 2QWQB 1GM8A 1Y4MA 4GYCB 4LWSA 3B8MA 3TXSA 3JD2A 5B1AB 2ZINA 2Y48A 3E22A 4DV5B 1PV0A 3C3TA 1PPJH 1RSOB 2ITDC 3CCJV 2K9PA 3ML0A 2P5OA 3OMIB 1VF6A 1FD9A 5FNVB 1M90W 3G6EV 2CTQA 2IJHA 1ROPA 2XAHA 1O9HA 4LF8O 5J2UA 2LGWA 4MTOA 1GM9A 1YEWA 4EB6A 3SJQC 5CA3A 2QWOB 3IJ4A 3LUTB 4F6EA 2F1MA 4JAAA 5CBHA 5LXTA 1Y76A 4LF9O 4H13B 3N27A 1LNQA 3K04A 2ZR2A 3OEEG 1FXHA 3WU2Z 4DUYB 1KBHA 3CXHF 4FLWA 4JV5B 3M8AA 2RMKB 3SYOA 5EC1C 4BWAA 2IH1C 1YVWA 3FYEB 3FAVA 2CGOA 1VQ5V 2WLIA 5H9CA 1MABG 2RN9A 5GTIZ 1FJGO 1VF5B 3BRCA 4W4KA 2G38A 4K8XA 2WLNA 2Q6AA 4UCVA 4MTXA 2PTMA 2QE7G 1B04A 3S3WA 1HR0B 1QCEA 1OCRC 4MW8A 5JQGA 2LGQA 5B5EZ 2DWEC 2ZR3A 3Q4HA 3CEIA 4U7OA 1N32O 4DR1B 4L87A 4QE7A 4UCUA 1XI1A 3IFXA 1H8EG 1ZUQA 4YHHB 5EZYA 4P30A 4DR3O 2R9IA 3N2KB 4FLTA 1AVMA 4JI3B 2XAJA 2ADQB 4JI0B 2UU9O 1H8HG 1XMQB 1J5EO 5A2QN 2RQ6A 4I9QA 4KP4A 1NVPD 4LF5O 1M56C 4FJCC 3G80A 5K1XA 4ZBMA 2PF4E 1R3LC 3JD1A 2XUMA 1RSOA 2CDYA 1ZWIC 3STZC 2OT5A 1P4RA 5FNVA 2B9ZA 3BHPA 2DQ3A 2D2CB 1PP9H 2LP7A 2JGDB 2M6YA 1V54C 3CB2A 3RYHB 2E76B 1ZL8B 5IDJA 1VQMV 4R8CA 1WPBA 1N0JA 1H2NA 1YHQV 1OCCC 3OUSA 1MSWD 2UUBO 4JI8O 5KAFZ 3ABMC 4B7EA
chains in the Genus database with same CATH topology
1VQ4V 3OR6C 3WFVA 2EIJC 4KFMA 3I55V 4P2ZA 2QM7A 1NR7A 3DTUB 1KC8W 2WLLB 1QR9A 3FB7C 2UXXA 5LHIA 1VQLV 1K97A 2FTKA 1M9NA 1VQ6V 1SZTA 1G4YB 1NR1A 1PD3A 3CC4V 2IH3C 4F4LA 1M57C 2PI5A 4QPJA 4QIWF 3AG4B 3CYOA 3ABUA 1JVMA 2OTLV 3CC2V 2UXNA 3GB7C 4BIUA 3W7WA 2X6CA 3M99B 2JEUA 3ZRVA 3D36A 3ZRSA 2DYRB 4JYCA 2F43G 5LGUA 5B1BB 3ZMUA 1KD1W 3HB3B 1GK9A 4MVRA 4J9YB 1NH2D 1S76D 3QNEA 3JD3A 4XBFA 1BHBA 3K0DA 3B8NA 5L3CA 2HG5C 4TSFG 1DF5A 1XL6A 3LSSA 4U7NA 3ABLC 3W7SA 1YJNV 2ITCC 5L3BA 3G71V 1THZA 2WLJA 1JPXA 1B6QA 3RVZA 2B5UA 3ETGA 3ETDA 2WPDG 3WG7B 3NXSA 3K0GA 4XDKA 1Q7YW 4KUMA 1BL8A 2DYSB 4QJFB 1S3JA 1P7BA 3MHSC 1FXKC 2QM8A 3ZIAG 4PDMA 2Q68A 4WFAV 2WLMA 3ASNC 1QLEC 3EFFK 1COWG 3QO5A 3CPWU 1R6NA 1OCRB 2X7RB 3KG2A 2EIKB 3AG3C 2OCCC 3ABKC 4Q20A 1L1FA 1K4DC 3E8FA 1F51A 3ZN0A 3P30A 5KA5A 3AG1C 4MVZA 3P32A 3DGEA 1F4NA 1RPOA 1OCZB 2EILB 3BY6A 1GMGA 1R6KA 4PA4A 1K34A 4GT1A 3MHHC 3CCQV 1UJWB 3OEHG 1H2GA 2Y69B 1YI2V 4G2KA 3OMAB 1PL0A 2WLLA 2ZXWC 3ETEA 1RM1B 3CCEV 1SRYA 4JAVA 1OHHG 4UVAA 1MG1A 3F7VC 4WFHA 1K92A 2WSSG 1EZJA 2AHYA 1V55C 1AI6A 1AROP 4JTAB 5B1AC 1Q81W 1M56B 3EHBB 3F7YC 2IJKA 2YSUB 3AG2B 3K3WA 4RAIA 4XDJA 3T4DA 3E8HA 1JQ0A 3ZMZA 4MVUA 3ASOB 2P90A 3CC7V 5LBQA 3SPCA 4WCEV 1CEZA 3E8BA 3TETA 1V54B 1Y66A 2JJ1G 1AI5A 1BMFG 1AR1B 4HZ3A 4PA3A 1MOFA 3ABTA 5IYBO 4MSWC 1HWYA 1GTOA 4WFGA 1K33A 4OXSA 3JCZA 1OCCB 3AG4C 1VQ8V 4JAUA 2EZOA 5LGTA 4R6ZA 4QE9A 3CMAV 4PA7A 1SERA 4PDVA 1EFRG 3ABMB 2XNDG 3E89A 3CMEV 3B77A 2V1DA 1YTFD 2EIJB 4P9OA 2IJIA 4MT8A 4PA9A 1IXMA 2BOCC 3OR7C 5L3EA 4X88A 5CBGA 3K9AA 3K06A 1F4MA 1RPRA 2WAMA 4JF3A 4WFEA 3I56V 3FB6C 1K73W 5EBWC 3SPJA 5KUKA 1EBOA 1OZ0A 3SYAA 1YJ9V 2HFEC 2Z5UA 3VOUA 4BW5A 3OGCC 3QO7A 1QLNA 4PDRA 4MVQA 1M57B 4HAMA 4N21A 4BIZA 1VQ9V 3GWOA 5L3DA 1Q86W 3X2QC 2W6IG 1K7DA 1OCOC 4I9WA 4CBCA 5FL7G 1FS0G 4PDLA 5DN6G 3K03A 1AI7A 4UXNA 1CP9A 4X89A 2D3OW 2GSMB 4GX2A 2LFSA 3OM3B 4TWKA 4MVMA 3SYPA 3OMNB 1E79G 1AJPA 1PNMA 4RUFA 2XAFA 3TK1A 3TCUA 4GCZA 3RW0A 4LBEC 1VQPV 2HJFC 2JDIG 3ZMTA 3OAAG 1DLBA 5B3SC 3D3IA 4MS2A 1E1RG 5CBFA 3ZRWB 4TT3G 1NVPB 2HKOA 2M7WA 4LP8A 3E8GA 4RO2A 1I5XA 4G27B 5H6RA 3E2EA 1R73A 2HVJC 2X6BA 3R65A 1JX9A 2ZQMA 2P7TC 3JYCA 4QPKA 5IYDO 3ABLB 1ORQC 3MD0A 3CXCU 2HR3A 1GO3F 3ZJZA 3F5WC 3IC7A 1PNLA 1QBZA 2ATKC 2MK3A 3SYCA 4JYBA 4PA6A 1KQSU 5CN0A 2Q67A 1AI4A 3LSQA 5B1NA 1YSCA 2XAQA 3E83A 2WLIB 3ZN1A 3OW2U 3CD6V 1OCZC 1KP3A 4Z1MG 2EIMC 1AJQA 3SYQA 2IJJA 4DO2A 5GW7A 2EZPA 2ZDIA 3SPHA 2A9HA 4MW3A 3OFNG 3STLC 5LHGA 1K3EA 1FXKB 1QR8A 4PELA 2XAGA 5HFLA 5LGNA 2EBOA 3UKMA 4FMTA 1K5SA 3ASNB 1AJNA 2W0FC 2Y69C 3ZMSA 4MTFA 1QVGU 4UVBA 2P67A 4XDLA 1FFTB 3JD0A 2Q69A 4E2LA 3AG3B 1F23A 2OCCB 3ABKB 1K4CC 1JOYA 3LDCA 2IU3A 3LNMB 5IY5C 2YEVA 1GM7A 4WF9V 3OUFA 3W7XA 2EINC 3AG1B 2X6AA 4MVOA 4RUEA 4RQEA 4MTGA 4H33A 3AG2C 4X8AA 2H8PC 5H6QA 1CPYA 4JTDB 1M1KW 3PJSK 3QO8A 4RQFA 1NBMG 1K9MW 3G4SV 1W0KG 3FKSG 4MVSA 3ZCCA 2A0LA 1QVFU 2DQ0A 4JASA 2ZXWB 1H38A 1YJWV 3T2MA 5J9PC 2YEVB 1S5HC 3BEHA 3CCMV 1WLEA 1GM8A 1Y4MA 4P9PA 3B8MA 1V55B 5L3FA 3JD2A 5B1AB 2BOBC 4WFFA 2Y48A 1JJ2U 1K8AW 3CCUV 5BZBA 2IW5A 1NH2B 5C93A 2ITDC 3CCJV 4ASUG 3ML0A 2JJ2G 4LC1A 1S0VA 3OMIB 5KA6A 2PI4A 1W2BU 1M90W 3G6EV 3T4ZA 1N8RW 2IJHA 1ROPA 2XAHA 4YXWG 2DYRC 1VQOV 2NNUA 2JEXA 5B1BC 1I5YA 3CCRV 4MTOA 1GM9A 3JD4A 5EK0A 5L3GA 3UM7A 4I5SA 3SJQC 2ZD9A 2QKSA 5CA3A 1ENVA 2AHZA 2W6JG 3LUTB 1KECA 1E1QG 2CK3G 5CBHA 4CZZA 1NQTA 4BAYA 1VQNV 3CCSV 1LNQA 3K04A 3H01A 3VBBA 2ZR2A 3ZRWA 1K5QA 2WLHA 3OEEG 4QNHB 2P6JA 5KUMA 1FXHA 2QA4V 3E35A 1PKXA 2EJRA 2HLDG 2XOKG 3OE7G 5EC1C 3SYOA 2IH1C 1S77D 2DWDC 1R3JC 1NKDA 3FYEB 4GX0A 4UV9A 3HPLC 3CCLV 2KB1A 2QEXV 1VQ5V 2WLIA 3WG7C 5H9CA 1MABG 3SPGA 1DTOA 1W0JG 2A79B 2DYSC 2X0LA 1S72V 5IYCO 2B1IA 3CCVV 4DXWA 1YIJV 2NLJC 4FK5C 2K1EA 4G28B 1FXKA 2Q6AA 2WLNA 4UUJC 3X2QB 4ZKIA 4MTXA 3ZMVA 1OCOB 3FB5C 3W7TA 2QE7G 2V7QG 4UVCA 1Q82W 3A0RA 2LFRA 1QCEA 1OCRC 4MW8A 5EC2C 2IU0A 5DM6V 2EIKC 3K08A 2C2AA 5HFMA 4H37A 3W7UA 5EBMC 2DWEC 2ZR3A 4UV8A 3T1CA 2JK5C 4U7OA 1PNKA 3LDEA 4EKWA 1VQKV 4L87A 5B3SB 3LDDA 3ZRXA 4QE7A 2EILC 3RBZA 1SETA 3IFXA 1H8EG 3RVYA 4HYOA 1J95A 4FIPC 5EBLC 2HVKC 4JTCB 2H94A 4P30A 1QLEB 2R9IA 4GX1A 1JCHA 4N23A 1NJIW 2B1GA 3E86A 2XAJA 3CP1A 5B1OA 1R3IC 1GKFA 1R3KC 1RM1C 4R50A 1XL4A 1H8HG 3FB8C 2JIZG 2GHYA 1TUEB 4JPRA 1YITV 2QTOA 2Z3YA 4KP4A 1G8MA 1KP2A 2EIMB 1M56C 4R7CA 4FJCC 1NVPD 2ZDIC 1WPXA 1BHAA 2WLKA 4ZBMA 3ASOC 1R3LC 3JD1A 2R9RB 4FPPA 1ZWIC 3STZC 2OT5A 1P4RA 4WFBV 5CMUA 1DF4A 3SPIA 2DQ3A 5LHHA 1KKDA 2LP7A 3K79A 1V54C 1YTFB 5IY5B 2XASA 4LCUC 4JGSA 5IDJA 1VQMV 3IGAC 2EINB 3FYIB 4R8CA 1FXVA 1SESA 5E1AC 1YHQV 2OTJV 2WWWA 3AEIA 1VQ7V 1OCCC 3OUSA 1MSWD 2DW4A 4GX5A 3ABMC 4J9ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R73 A;  2OTL V;  1K9M W;  3CC7 V;  3CME V;  1VQ4 V;  4WFB V;  3CPW U;  1W2B U;  2D3O W;  3I55 V;  3G6E V;  1YI2 V;  1Q82 W;  1QVG U;  3G4S V;  1N8R W;  1NJI W;  1M90 W;  1YJN V;  4WCE V;  1KC8 W;  1QVF U;  5DM6 V;  3CXC U;  1VQO V;  1VQL V;  3CCE V;  1YJW V;  3I56 V;  3CCR V;  3CCL V;  3G71 V;  1K73 W;  1KQS U;  1KD1 W;  1VQ6 V;  4WF9 V;  2QEX V;  3CCM V;  1VQM V;  3OW2 U;  1VQ5 V;  1YJ9 V;  1VQP V;  1VQK V;  3CC4 V;  1YIT V;  3CD6 V;  1Q81 W;  1Q7Y W;  3CC2 V;  1YHQ V;  1K8A W;  1JJ2 U;  2OTJ V;  3CCU V;  3CCS V;  1S72 V;  1VQ7 V;  3CCV V;  1VQ9 V;  1YIJ V;  1VQN V;  1VQ8 V;  1Q86 W;  1M1K W;  3CMA V;  4WFA V;  3CCJ V;  3CCQ V;  2QA4 V; 
#chains in the Genus database with same CATH topology
 3OR6 C;  4KFM A;  2GBO A;  3AG7 A;  4DV3 O;  1NR7 A;  3SJB C;  1KC8 W;  2N05 A;  1Z2G A;  3K59 A;  4ZI7 B;  1M9N A;  1SZT A;  4BW9 A;  3AK3 A;  3U11 A;  4I0X B;  3L74 H;  4TV8 B;  5JWP A;  1AP6 A;  2KKW A;  1O9G A;  3CYO A;  3ABU A;  3RFR A;  5ITZ B;  3J7A U;  1XNQ B;  4BIU A;  3ZRV A;  1N36 B;  2DYR B;  3ETQ A;  2F43 G;  4DUZ B;  1PL4 A;  4LF7 O;  2V4D A;  4O4L B;  1LR1 A;  2E74 B;  4MVR A;  3A0H Z;  1NH2 D;  2F4V B;  1WN7 A;  2OYQ A;  4XBF A;  1BHB A;  5L3C A;  1R1B A;  1RP3 B;  4U7N A;  1H2L A;  3G71 V;  2FB5 A;  1TGO A;  1JPX A;  2VQE O;  5IJ9 B;  3ETD A;  3WG7 B;  4DR5 B;  1FAF A;  1Q7Y W;  3THO A;  4CS4 A;  1BZK A;  1S3J A;  1P7B A;  4PI2 A;  4PDM A;  3CRR A;  3L72 H;  2WLM A;  3ASN C;  3CPW U;  3IAY A;  5CB4 B;  3RN4 A;  4J80 A;  4IYH A;  2EIK B;  2OCC C;  1Q5O A;  2JGD A;  2Z0A A;  2O57 A;  3RYH A;  2N74 A;  4LFC B;  4TV9 B;  3ZN0 A;  3AG1 C;  1ZL8 A;  1YXB A;  2KG7 B;  3JAT B;  4MVZ A;  1F4N A;  1QHT A;  3B40 A;  1RPO A;  1BT8 A;  1GMG A;  1N33 B;  3JSL A;  1HNX O;  3MHH C;  3CCQ V;  4DR4 B;  3G67 A;  1GN6 A;  1YI2 V;  4GUN A;  1SQX H;  1PL0 A;  1RM1 B;  1SRY A;  4EEQ A;  3F7V C;  4AIL C;  1N34 O;  2Q9L A;  1AI6 A;  1ARO P;  4JTA B;  4B3M B;  4I0X A;  2IJK A;  3AG2 B;  3CRC A;  2RCV A;  4B3T B;  4MVU A;  3ASO B;  2F95 B;  4K8Z A;  4B3S O;  3NR7 A;  1WAZ A;  1NT2 B;  3QTC A;  1FFX B;  3E8B A;  1Y66 A;  1LUV A;  5B66 Z;  4DV4 O;  4DW1 A;  1XMO O;  2JS3 A;  4WFG A;  1K33 A;  1UFI A;  3JAL B;  4DYL A;  4OXS A;  2AZ2 A;  4JZ2 A;  1SQP H;  4EFE A;  5LGT A;  4FLY A;  4QE9 A;  4PA7 A;  3TJT A;  2QTS A;  4PDV A;  1EFR G;  5BY1 A;  2V1D A;  1YTF D;  1IUR A;  1IXM A;  2BOC C;  1AR4 A;  1WP7 A;  4X88 A;  1DK1 A;  1RPR A;  4JF3 A;  3FB6 C;  2ZM6 B;  3WB2 A;  1EBO A;  3HKD B;  1BQ0 A;  2Z5U A;  1PM9 A;  4BW5 A;  3OGC C;  2JRI A;  1M57 B;  5L3D A;  1Q86 W;  1OCO C;  4I9W A;  5FL7 G;  4DR2 B;  4UB6 Z;  1AI7 A;  4UXN A;  3D36 C;  2LFS A;  4LH6 A;  3BCC H;  2UUC B;  1M5I A;  1V9P A;  3G6B A;  3TK1 A;  1RFY A;  2GTS A;  4GCZ A;  4TV9 A;  2HJF C;  2JDI G;  2KG7 A;  3JAT A;  3OAA G;  3D3I A;  2HP8 A;  5TIS Z;  5BMV B;  1IBL O;  1H2S B;  1HNZ B;  2A06 H;  4CS2 A;  2HKO A;  3E8G A;  4G27 B;  2HEP A;  3KZI Z;  3SDL A;  3R65 A;  2P7T C;  2VRZ A;  4I7Z B;  3CXC U;  3ZJZ A;  4LF6 B;  3F5W C;  2MK3 A;  3K58 A;  2HHH O;  3RYC B;  4JYB A;  4PA6 A;  3CX5 F;  5CN0 A;  2XAQ A;  2UXC B;  3ZN1 A;  4EFB A;  5BR8 B;  4FM0 A;  1KP3 A;  4Z1M G;  3MDS A;  4KHP B;  1AJQ A;  2IJJ A;  5GW7 A;  2EZP A;  3ZHU A;  3CRM A;  4JI2 B;  3SPH A;  3QVN A;  1K3E A;  4PEL A;  5LGN A;  3O65 A;  4H0L B;  4MTF A;  4J10 A;  2OIE A;  1FFT B;  4E2L A;  2F66 C;  1F23 A;  4X62 O;  1OJH A;  1FFX A;  3LNM B;  5IY5 C;  4LH7 A;  3UCS C;  4FLU A;  3BAB A;  2YDE A;  3UT5 B;  4RUE A;  3JAL A;  2QDO A;  2AXT Z;  3JAM N;  4DV1 O;  2QKA A;  3K9S A;  1CPY A;  1BQZ A;  1XQ8 A;  4NXM O;  3RYI B;  3QO8 A;  1K9M W;  4MVS A;  1WA8 B;  4YY3 O;  4C7U A;  2YEV B;  2EUL A;  3BEH A;  4P9P A;  3HKD A;  5L3F A;  2BOB C;  4WFF A;  4RWU A;  4K0K O;  3CCU V;  3P3P A;  5CA0 B;  2QSA A;  1S0V A;  5BXZ A;  4CS3 A;  3H1L H;  4FLV A;  2UUA O;  4LF9 B;  4B3R O;  1IBK B;  2JEX A;  5B1B C;  1KYO F;  3CCR V;  5EK0 A;  3UM7 A;  2AGA A;  4I5S A;  3VQW A;  2E5L O;  2QKS A;  2AHZ A;  2W6J G;  4LWS B;  4CZZ A;  4O2A B;  1H2M A;  3E22 B;  5BMV A;  1GN4 A;  3CCS V;  1ZX3 A;  1K5Q A;  1KB9 F;  2WLH A;  1SC5 B;  2QA4 V;  4A5U B;  1Y74 B;  5FPO A;  2DWD C;  2UXB O;  4GX0 A;  5IT9 N;  3HPL C;  3RYC A;  4EB6 B;  1Z5V A;  4H44 B;  1W0J G;  2DYS C;  1S72 V;  3CCV V;  1YIJ V;  5JCO A;  2K1E A;  4G28 B;  1I08 A;  3ZMV A;  1D5A A;  2PYL A;  2IU0 A;  3LSU A;  3M7M X;  3T1Y B;  4PHZ A;  4LR3 A;  1IBM O;  3W7U A;  4NXN B;  1Q6H A;  1PNK A;  3LDE A;  4EKW A;  4LF4 B;  5B3S B;  3LDD A;  3ZRX A;  2EIL C;  3H1K H;  1Q6U A;  5IE9 A;  4NTW A;  3RVY A;  2EJ7 A;  1J5E B;  5IWA O;  4FIP C;  4JTC B;  4DR6 O;  3RYI A;  3GVM A;  4GX1 A;  4CH6 A;  3DXR B;  1NJI W;  1P7G A;  2QWN B;  4DR7 O;  3CP1 A;  1R3I C;  3U10 A;  1GKF A;  3UO3 A;  1WA8 A;  1XL4 A;  4Q6G A;  1L0N H;  4LFA O;  4DV6 O;  3FB8 C;  4FM1 A;  2JIZ G;  5LP6 C;  1TUE B;  3B4S A;  1T5E A;  4KXR A;  1HNW B;  2ZDI C;  3JAW B;  2CTW A;  4E4E A;  2QWP B;  2LJ2 A;  1FKA O;  5CA0 A;  3ZED A;  1GH6 A;  1U96 A;  3K5L A;  1DF4 A;  4JYA B;  2AW9 A;  4JI8 B;  2ETN A;  4LCU C;  2EIN B;  2JS5 A;  3GWK C;  1FXV A;  3B09 A;  4O2A A;  1G1X B;  4J42 A;  3H9V A;  4UCT A;  2DW4 A;  4J9Z B;  4JI5 B;  1VQ4 V;  2LW1 A;  1Y74 A;  2EIJ C;  3WFV A;  2QM7 A;  1XIL A;  3DTU B;  3VQV A;  1QR9 A;  2GTA A;  1VMG A;  1VQL V;  2FTK A;  2BTO A;  5LMN O;  3L71 H;  2IH3 C;  4F4L A;  1B06 A;  3VQY A;  3ZHT A;  5IJ0 A;  2PI5 A;  2QKC A;  1JVM A;  3H1H H;  4JI7 O;  3GB7 C;  2JEU A;  1SQQ H;  3ZRS A;  4JYC A;  2P4V A;  3ZMU A;  4YIP A;  3OD4 A;  1GK9 A;  1S76 D;  2L35 A;  2Q0O C;  4X65 O;  2FKX A;  4NR1 A;  5KLV H;  3T1H B;  2DOS A;  1M93 A;  3DXR A;  4IGG A;  1YJN V;  1KUQ A;  4UCS A;  1B6Q A;  3AK2 A;  5KAI Z;  3NXS A;  4ZIB A;  3K0G A;  1WP8 A;  4QJF B;  3CSX A;  1TA8 A;  1FXK C;  3JAW A;  4WFA V;  4DV2 O;  2P4K A;  1COW G;  4X66 B;  1OCR B;  2X7R B;  3QF7 A;  3AG3 C;  4Q20 A;  4X64 O;  1XNR O;  1FYJ A;  1Y6X A;  1F51 A;  2VQF O;  4X1K B;  3P32 A;  1OCZ B;  4PA4 A;  1Q6I A;  4HNA B;  4X9Q A;  1SQG A;  3F5T A;  1H2G A;  5LA6 B;  3ZBH A;  4JI1 O;  1FPO A;  1MG1 A;  4CC6 A;  1MA1 A;  4BR6 A;  2WSS G;  1EZJ A;  1V55 C;  4AQY O;  1Q81 W;  1M56 B;  3ZHQ A;  2YSU B;  1L0L H;  2UXD O;  5KHG A;  4PD4 F;  4JI6 B;  1V54 B;  4NB5 A;  2JJ1 G;  4PA3 A;  5IYB O;  1HWY A;  4GKK B;  3H1J H;  4AHC A;  2ZCE A;  3ZS8 C;  1OCC B;  1VQ8 V;  4JAU A;  2EZO A;  1IXB A;  2YXL A;  2PUS A;  1WJZ A;  3ABM B;  3B77 A;  5GTH Z;  5FLX N;  4P9O A;  2IJI A;  2CE4 A;  2Q7H A;  4DV5 O;  5CBG A;  2IM9 A;  4DV7 B;  2E75 B;  3OGI B;  4I50 B;  1QLN A;  1MZF A;  2QR4 A;  1XRE A;  3OTF A;  3X2Q C;  1K7D A;  4CBC A;  4YJ3 A;  4PDL A;  5DN6 G;  4OPA A;  1IBL B;  1BS3 A;  4TWK A;  1PNM A;  3OTO O;  1D2D A;  4LBE C;  1VQP V;  3ZMT A;  4X1K A;  1DLB A;  2GDS A;  4DK0 A;  4DUY O;  4MS2 A;  2ZKO A;  4J11 A;  2YI9 A;  3ZRW B;  4HNA A;  4TT3 G;  1NVP B;  4RO2 A;  2YIB D;  4K3A A;  3E2E A;  1JX9 A;  4QPK A;  5LA6 A;  2GV9 A;  3MD0 A;  3SYC A;  1X4T A;  1KQS U;  1YZB A;  3LSQ A;  1JR9 A;  2EIM C;  3SYQ A;  1EN4 A;  4MW3 A;  3STL C;  5F2V O;  2XAG A;  3ASN B;  1AJN A;  4FVM A;  2W0F C;  4DR1 O;  2P67 A;  3HR0 A;  4JZG A;  3JD0 A;  1X59 A;  2OCC B;  1K4C C;  3ZX6 A;  4F6R B;  4NXM B;  3ZHV A;  1GM7 A;  3BAA A;  4LFB B;  3AG1 B;  4RQE A;  4MTG A;  4JI3 O;  4X8A A;  1P84 F;  3AG2 C;  4YY3 B;  4DV0 B;  1IDS A;  2H8P C;  5H6Q A;  4JI0 O;  3C3S A;  2CAZ C;  4NVP A;  1NBM G;  2GUZ B;  3JAK A;  1IVS A;  1SF9 A;  2F23 A;  2BTQ B;  2A0L A;  4OX9 B;  3FX7 A;  2ZE7 A;  4JAS A;  4J7J A;  1EZV H;  4CC5 A;  1H38 A;  1YJW V;  3T2M A;  5J9P C;  5GON B;  1I94 B;  1TVK A;  4I50 A;  1NS1 A;  1XHZ A;  1MMM A;  1JJ2 U;  1HP8 A;  2IW5 A;  1NH2 B;  3O9O A;  3D8C A;  4IIJ A;  1AIL A;  5DEC A;  4ASU G;  1MNG A;  5KA6 A;  2NR5 A;  3UO2 A;  5KX5 B;  2E3C A;  1Q8I A;  1VQO V;  3JD4 A;  5L3G A;  1EN6 A;  1IX9 A;  1ENV A;  1KEC A;  4BAY A;  1VQN V;  3VBB A;  3ZRW A;  2P6J A;  5KUM A;  2IBZ H;  3E35 A;  1PKX A;  1B3Q A;  2DN9 A;  3N2G B;  1NKD A;  1AB3 A;  3CCL V;  2KB1 A;  3SPG A;  1DTO A;  1XNQ O;  4B7K A;  2A79 B;  3JAR B;  2RDC A;  4NYK A;  1N36 O;  2B1I A;  4DUZ O;  4FK5 C;  1U97 A;  3BPZ A;  4UUJ C;  4ZKI A;  1OCO B;  3CRQ A;  1JFF A;  3W7T A;  2V7Q G;  4UVC A;  1Q82 W;  3A0R A;  2LFR A;  2F4V O;  4JI4 B;  3C90 A;  5EC2 C;  5DM6 V;  3K08 A;  2NN4 A;  2C2A A;  2PGG A;  4H37 A;  4F6R A;  2JK5 C;  3DC6 A;  1VQK V;  5J2T B;  1SET A;  5FPR A;  4BIO A;  1QU7 A;  2QJ1 A;  5LMU B;  5EIB C;  4IHJ B;  3UQ8 A;  2H94 A;  1QLE B;  2GUZ A;  4N23 A;  4O4J B;  2B1G A;  3E86 A;  4YJ2 B;  4DR5 O;  2BTQ A;  1Z5W A;  2ZNI A;  4NTX A;  5GON A;  4JPR A;  1YIT V;  2Z3Y A;  1SER A;  1G8M A;  1KP2 A;  1WPX A;  1BHA A;  3FFQ A;  2WLK A;  4IYI A;  4UCO A;  1NZ6 A;  1WNS A;  2P06 A;  2KQX A;  3ICX A;  4WFB V;  3BFR A;  5KX5 A;  3SPI A;  1KKD A;  2CH7 B;  1S5L Z;  3K79 A;  4J7Z A;  5IY5 B;  1YTF B;  5KMG B;  4DR4 O;  4U3J A;  3IGA C;  3FYI B;  3APQ A;  5IYZ B;  1WB7 A;  1SES A;  4CH5 A;  2BSK B;  4B08 A;  4LF8 B;  2WWW A;  3AEI A;  4GKJ O;  1VQ7 V;  1SQV H;  4PV1 B;  2ARH A;  5LMN B;  1G6U A;  3I55 V;  4P2Z A;  2WLL B;  3FB7 C;  2YIB A;  3N2G A;  4B3M O;  1K97 A;  4B3T O;  2P22 C;  1VQ6 V;  1G4Y B;  3QG5 A;  1NR1 A;  1PD3 A;  3K57 A;  3L70 H;  3OT7 A;  4QPJ A;  3JAR A;  3AG4 B;  5JJE B;  5KHJ A;  1VF6 C;  2OTL V;  2R72 A;  2X6C A;  1FJG B;  2WA3 A;  3D36 A;  5LGU A;  5LL6 Y;  5B1B B;  2ZIM A;  1KD1 W;  2R70 A;  5LYJ A;  1KKC A;  4DK1 A;  3QNE A;  1VEW A;  5J2T A;  5IJ0 B;  3JD3 A;  3K0D A;  3B8N A;  4UB8 Z;  3ZHS A;  1N32 B;  4IHJ A;  5K1P A;  5AG2 A;  2HG5 C;  4TSF G;  1DF5 A;  3P3N A;  1R6T A;  3LSS A;  4O4J A;  3ABL C;  4YJ2 A;  3W7S A;  2ITC C;  3HKC B;  2OCH A;  4DR3 B;  2WLJ A;  2XT9 A;  1D5N A;  1XOU A;  3RVZ A;  2WPD G;  4D7T A;  4DR2 O;  1XDC A;  1BL8 A;  2DYS B;  4X64 B;  1XNR B;  2KSD A;  2UU9 B;  3MHS C;  2UUC O;  2YUA A;  1AP5 A;  3EFF K;  4LF5 B;  3QO5 A;  4I55 B;  3RYF B;  1NI8 A;  1BCC H;  1XHX A;  3ABK C;  2CH7 A;  1K4D C;  1HNZ O;  4KL1 A;  2WA4 A;  5KMG A;  3LNN A;  5KHK A;  5KA5 A;  1MZE A;  1GN3 A;  5IYZ A;  3SJC C;  1I7F A;  5JH7 B;  2EIL B;  3BY6 A;  2Q4P A;  1SKV A;  2BSK A;  3HKE A;  4LF6 O;  4X1Y A;  4FFK A;  1KMI Z;  2YIC A;  4NTY A;  1UJW B;  1A32 A;  2UXC O;  3OEH G;  2Y69 B;  4G2K A;  5BR8 O;  4KHP O;  2WLL A;  2ZXW C;  2FML A;  2UUB B;  1OHH G;  4UVA A;  2OIG A;  2AHY A;  5KHI A;  3BVO A;  4DV3 B;  5B1A C;  4J41 A;  3F7Y C;  3WB1 A;  1Q43 A;  4RAI A;  4XDJ A;  3T4D A;  3E8H A;  1JQ0 A;  1IZ3 A;  1SA0 B;  2P90 A;  2ODM A;  3RWR D;  1GAX A;  4HZ3 A;  4MSW C;  1GTO A;  1W59 A;  1JA8 A;  2YC0 A;  2YID A;  3U0Z A;  3AK1 A;  4LF7 B;  4GZR B;  3E89 A;  3WB0 A;  2EIJ B;  2PYJ A;  4MT8 A;  4PA9 A;  3A2F A;  1JMK C;  5L3E A;  3JAS A;  3HKC A;  1QQC A;  4WFE A;  1NTK H;  1YDX A;  5EBW C;  3SPJ A;  5KUK A;  1OZ0 A;  3VOU A;  3QO7 A;  2ZNJ A;  4PDR A;  4HAM A;  4N21 A;  1VQ9 V;  3OTO B;  1IBK O;  3GWO A;  2VQE B;  4TQF A;  3K03 A;  1CP9 A;  1TUB B;  4I55 A;  3RYF A;  3K5O A;  3SYP A;  1E79 G;  1AJP A;  4FZ1 A;  4RUF A;  2XAF A;  5JH7 A;  3RGB A;  1I5X A;  2HVJ C;  4YJ3 B;  3H1I H;  3BA9 A;  4LNU B;  1HNX B;  4O4I B;  2HR3 A;  4FFB B;  1PNL A;  3CHX A;  5JJJ B;  2Q67 A;  1AI4 A;  3E83 A;  5LP6 A;  3CD6 V;  1OCZ C;  2ZDI A;  5LHG A;  1FXK B;  3SGI A;  3T1Y O;  4GLX A;  2CTR A;  3CJH B;  1N34 B;  1H2K A;  4NXN O;  1Q90 D;  3HKB A;  1SA0 A;  2BCC H;  4LF4 O;  1QVG U;  2W0X A;  3CRA A;  2Q69 A;  3AG3 B;  1JOY A;  2FL4 A;  3LDC A;  2IU3 A;  4WF9 V;  2ZE8 A;  3OUF A;  4B3S B;  1XBL A;  2VWJ A;  4MVO A;  4H33 A;  2Q73 A;  3JSN A;  2QM4 A;  3L9D A;  4JTD B;  4DV4 B;  3PJS K;  1XMO B;  4WBN B;  5DED A;  3SR2 C;  4RQF A;  3G4S V;  1W0K G;  3FKS G;  3ZCC A;  3MAQ A;  2DQ0 A;  1HNW O;  2A7W A;  1WLE A;  2Y0P A;  1V55 B;  4ZOL B;  4W4L A;  1K8A W;  4JYA O;  2Q0A A;  5BZB A;  5C93 A;  1ZTE A;  2JJ2 G;  4LC1 A;  2PI4 A;  3JAK B;  1W2B U;  1HW7 A;  3T4Z A;  1N8R W;  1TUB A;  2ZT9 B;  4YXW G;  2DYR C;  2Y4T A;  2NNU A;  1I5Y A;  1NTZ H;  4JYY A;  2ZE6 A;  2ZD9 A;  1TVK B;  4UFZ A;  5H2F Z;  4JI5 O;  4X20 B;  4ICG A;  2FYU H;  1E1Q G;  2CK3 G;  2PZS A;  1NQT A;  3TXQ A;  3H01 A;  4O4H B;  4CH3 A;  2JVD A;  4QNH B;  4IIJ B;  2EJR A;  5KHH A;  2HLD G;  2XOK G;  3L75 H;  4LNU A;  4D7S A;  3OE7 G;  1S77 D;  1R3J C;  4O4I A;  4FFB A;  4UV9 A;  3J81 N;  3KCY A;  5CA1 B;  1XUQ A;  2QEX V;  3WG7 C;  4YIO A;  1AR5 A;  1GN2 A;  3EVK A;  4JV5 O;  2X0L A;  1MSD A;  2Q7G A;  2HHH B;  4D6T H;  5IYC O;  2R9A A;  4DXW A;  1VAR A;  2NLJ C;  1M4U A;  1FXK A;  3X2Q B;  2LO1 A;  1CXZ B;  3CJH A;  3FB5 C;  1SQF A;  1VF7 A;  2CTP A;  3N2K A;  2EIK C;  5HFM A;  3T1H O;  3I5D A;  5EBM C;  3T1C A;  4UV8 A;  1TAE A;  3DC5 A;  3RBZ A;  1HR0 O;  4X62 B;  4HYO A;  1J95 A;  4FZ0 A;  2ZE5 A;  1UPG A;  5EBL C;  2HVK C;  4WBN A;  1JFF B;  3CE2 A;  4OPH A;  1JCH A;  2CUG A;  2Q7E A;  5B1O A;  4DV1 B;  2F93 B;  1R3K C;  4ZHQ B;  1RM1 C;  4R50 A;  4YHH O;  2GHY A;  1I0H A;  1DGS A;  2QTO A;  4R7C A;  3S3X A;  2EIM B;  4I4T B;  4X66 O;  4AI8 A;  4ZOL A;  4U3F H;  3ASO C;  1Q3E A;  1EM1 A;  2DE0 X;  2R9R B;  4FPP A;  1XMQ O;  5C8Y B;  5CMU A;  1QNM A;  4K0K B;  4GKJ B;  5LHH A;  2YXY A;  2LQT A;  3DSQ A;  4TUY B;  4ZI7 A;  2XAS A;  5D5Q A;  2UUA B;  4JGS A;  4UCR A;  4X20 A;  2PY5 A;  4B3R B;  4TV8 A;  5E1A C;  5EIB D;  2OTJ V;  3A0B Z;  4O4H A;  2E5L B;  4GX5 A;  2EX3 A;  5ITZ A;  1P49 A;  3KKY A;  2UXX A;  5LHI A;  4O4L A;  4DRX B;  4U3J B;  5CA1 A;  3CC4 V;  1LUW A;  4O2B B;  5E79 Z;  1M57 C;  2UXB B;  2ILM A;  4TQD A;  4QIW F;  4JI6 O;  4IL6 Z;  2XTA A;  1EN5 A;  3CC2 V;  2UXN A;  4PI0 A;  3W7W A;  3M99 B;  4GKK O;  1US6 A;  1F7Y A;  3J80 N;  3HB3 B;  5IJ9 A;  4J9Y B;  3B2E E;  2N04 A;  1URF A;  1IBM B;  4DV7 O;  4PJ0 Z;  5CB4 A;  3L73 H;  1XL6 A;  5L3B A;  3IC9 A;  5IWA B;  4ZHQ A;  1THZ A;  3R66 A;  5LYJ B;  4DR6 B;  2RNB A;  2B5U A;  3ETG A;  2Y4U A;  4DR7 B;  4XDK A;  4I4T A;  4KUM A;  3FD9 A;  5JCO C;  4LFA B;  4DV6 B;  2QM8 A;  3ZIA G;  2Q68 A;  2XHB A;  1L8D A;  1QLE C;  3K5N A;  5C8Y A;  4X1I B;  1R6N A;  3KG2 A;  1L1F A;  4L8J A;  3E8F A;  4TUY A;  1KU9 A;  3P30 A;  3DGE A;  3KCX A;  1R6K A;  2YI8 A;  1K34 A;  1JJO A;  4GT1 A;  2VWK A;  4LFC O;  3OMA B;  3CWB H;  3ETE A;  1N33 O;  3CCE V;  4JAV A;  1NU1 H;  1N0N A;  1ZAU A;  2LW7 A;  4WFH A;  1K92 A;  4DRX A;  3CS5 A;  4O2B A;  1XEQ A;  3EHB B;  1GRJ A;  3HKE B;  3K3W A;  4Z2W A;  3JCU Z;  3ZMZ A;  4X1Y B;  5JJN B;  2ADP A;  1BSM A;  5JVD B;  4LFB O;  3CC7 V;  1NTM H;  4TOI A;  5LBQ A;  5LOV B;  3SPC A;  4WCE V;  1N4C A;  1VIB A;  4DV0 O;  1CEZ A;  3TET A;  1AI5 A;  1BMF G;  2DJV A;  1AR1 B;  1MOF A;  1YCI A;  3ABT A;  4JI7 B;  2Q5Z A;  4FLZ A;  4K35 A;  3JCZ A;  4OX9 O;  4OGQ B;  3AG4 C;  4R6Z A;  3CMA V;  1I94 O;  2OWO A;  3PN1 A;  4X65 B;  2XND G;  3CME V;  2Y0I A;  1ZSP A;  3OR7 C;  3K9A A;  3EXA A;  1F4M A;  2WAM A;  3K06 A;  3I56 V;  1K73 W;  3BA8 A;  5EYP B;  3SYA A;  1YJ9 V;  1YF2 A;  2HFE C;  3D3Q A;  4MVQ A;  1HDJ A;  4BIZ A;  4IT5 A;  4FLX A;  2W6I G;  3RT3 C;  2ZM6 O;  1FS0 G;  2JGU A;  4X89 A;  2D3O W;  4X1I A;  2GSM B;  2VS0 A;  2A3Q A;  4GX2 A;  4ABM A;  3OM3 B;  4MVM A;  5J2U B;  2BE3 A;  3JAS B;  3OMN B;  4DV2 B;  3TGU H;  3TCU A;  3RW0 A;  5LXT B;  1Y76 B;  5B3S C;  1E1R G;  4CH4 A;  5CBF A;  2CGN A;  4QGP A;  2VQF B;  4LP8 A;  2M7W A;  4HBN A;  5H6R A;  1R73 A;  2X6B A;  1Y67 A;  3JYC A;  2ZQM A;  3A8T A;  3ZHR A;  5IYD O;  3ABL B;  1ORQ C;  2YS8 A;  1GO3 F;  3FAV B;  3IC7 A;  1QBZ A;  2ATK C;  4FM2 A;  1WB8 A;  5B1N A;  1YSC A;  2WLI B;  3UT5 A;  3OW2 U;  1BGY H;  5A9G A;  3K5M A;  4J7K A;  4DO2 A;  1SS3 A;  4JI4 O;  2MW2 B;  4JI1 B;  2A9H A;  3OFN G;  1QR8 A;  1SQB H;  5HFL A;  2EBO A;  3UKM A;  4FMT A;  4NKG B;  1K5S A;  4Z1V A;  5JVD A;  2Y69 C;  3ZMS A;  4DW0 A;  4AQY B;  2ZIO A;  1ZLZ A;  4UVB A;  4XDL A;  5LOV A;  5H5N A;  1VP7 A;  2L6L A;  3ABK B;  4JI2 O;  1OV9 A;  2QGN A;  3APO A;  5JQG B;  3SJA C;  2DMX A;  2YEV A;  3Q4H B;  5LMU O;  1S5J A;  2EIN C;  2Q8V A;  5LP6 B;  2X6A A;  3W7X A;  1SZX A;  2YIA A;  2UXD B;  2YXH A;  2AZ0 A;  5EZY B;  1M1K W;  2H3O A;  2QWR B;  3HKB B;  3VQX A;  1QVF U;  2ZXW B;  1BE3 H;  2RJZ A;  2HJD A;  5D5P A;  1S5H C;  3CCM V;  5EYP A;  2QWQ B;  1GM8 A;  1Y4M A;  4GYC B;  4LWS A;  3B8M A;  3TXS A;  3JD2 A;  5B1A B;  2ZIN A;  2Y48 A;  3E22 A;  4DV5 B;  1PV0 A;  3C3T A;  1PPJ H;  1RSO B;  2ITD C;  3CCJ V;  2K9P A;  3ML0 A;  2P5O A;  3OMI B;  1VF6 A;  1FD9 A;  5FNV B;  1M90 W;  3G6E V;  2CTQ A;  2IJH A;  1ROP A;  2XAH A;  1O9H A;  4LF8 O;  5J2U A;  2LGW A;  4MTO A;  1GM9 A;  1YEW A;  4EB6 A;  3SJQ C;  5CA3 A;  2QWO B;  3IJ4 A;  3LUT B;  4F6E A;  2F1M A;  4JAA A;  5CBH A;  5LXT A;  1Y76 A;  4LF9 O;  4H13 B;  3N27 A;  1LNQ A;  3K04 A;  2ZR2 A;  3OEE G;  1FXH A;  3WU2 Z;  4DUY B;  1KBH A;  3CXH F;  4FLW A;  4JV5 B;  3M8A A;  2RMK B;  3SYO A;  5EC1 C;  4BWA A;  2IH1 C;  1YVW A;  3FYE B;  3FAV A;  2CGO A;  1VQ5 V;  2WLI A;  5H9C A;  1MAB G;  2RN9 A;  5GTI Z;  1FJG O;  1VF5 B;  3BRC A;  4W4K A;  2G38 A;  4K8X A;  2WLN A;  2Q6A A;  4UCV A;  4MTX A;  2PTM A;  2QE7 G;  1B04 A;  3S3W A;  1HR0 B;  1QCE A;  1OCR C;  4MW8 A;  5JQG A;  2LGQ A;  5B5E Z;  2DWE C;  2ZR3 A;  3Q4H A;  3CEI A;  4U7O A;  1N32 O;  4DR1 B;  4L87 A;  4QE7 A;  4UCU A;  1XI1 A;  3IFX A;  1H8E G;  1ZUQ A;  4YHH B;  5EZY A;  4P30 A;  4DR3 O;  2R9I A;  3N2K B;  4FLT A;  1AVM A;  4JI3 B;  2XAJ A;  2ADQ B;  4JI0 B;  2UU9 O;  1H8H G;  1XMQ B;  1J5E O;  5A2Q N;  2RQ6 A;  4I9Q A;  4KP4 A;  1NVP D;  4LF5 O;  1M56 C;  4FJC C;  3G80 A;  5K1X A;  4ZBM A;  2PF4 E;  1R3L C;  3JD1 A;  2XUM A;  1RSO A;  2CDY A;  1ZWI C;  3STZ C;  2OT5 A;  1P4R A;  5FNV A;  2B9Z A;  3BHP A;  2DQ3 A;  2D2C B;  1PP9 H;  2LP7 A;  2JGD B;  2M6Y A;  1V54 C;  3CB2 A;  3RYH B;  2E76 B;  1ZL8 B;  5IDJ A;  1VQM V;  4R8C A;  1WPB A;  1N0J A;  1H2N A;  1YHQ V;  1OCC C;  3OUS A;  1MSW D;  2UUB O;  4JI8 O;  5KAF Z;  3ABM C;  4B7E A; 
#chains in the Genus database with same CATH homology
 1VQ4 V;  3OR6 C;  3WFV A;  2EIJ C;  4KFM A;  3I55 V;  4P2Z A;  2QM7 A;  1NR7 A;  3DTU B;  1KC8 W;  2WLL B;  1QR9 A;  3FB7 C;  2UXX A;  5LHI A;  1VQL V;  1K97 A;  2FTK A;  1M9N A;  1VQ6 V;  1SZT A;  1G4Y B;  1NR1 A;  1PD3 A;  3CC4 V;  2IH3 C;  4F4L A;  1M57 C;  2PI5 A;  4QPJ A;  4QIW F;  3AG4 B;  3CYO A;  3ABU A;  1JVM A;  2OTL V;  3CC2 V;  2UXN A;  3GB7 C;  4BIU A;  3W7W A;  2X6C A;  3M99 B;  2JEU A;  3ZRV A;  3D36 A;  3ZRS A;  2DYR B;  4JYC A;  2F43 G;  5LGU A;  5B1B B;  3ZMU A;  1KD1 W;  3HB3 B;  1GK9 A;  4MVR A;  4J9Y B;  1NH2 D;  1S76 D;  3QNE A;  3JD3 A;  4XBF A;  1BHB A;  3K0D A;  3B8N A;  5L3C A;  2HG5 C;  4TSF G;  1DF5 A;  1XL6 A;  3LSS A;  4U7N A;  3ABL C;  3W7S A;  1YJN V;  2ITC C;  5L3B A;  3G71 V;  1THZ A;  2WLJ A;  1JPX A;  1B6Q A;  3RVZ A;  2B5U A;  3ETG A;  3ETD A;  2WPD G;  3WG7 B;  3NXS A;  3K0G A;  4XDK A;  1Q7Y W;  4KUM A;  1BL8 A;  2DYS B;  4QJF B;  1S3J A;  1P7B A;  3MHS C;  1FXK C;  2QM8 A;  3ZIA G;  4PDM A;  2Q68 A;  4WFA V;  2WLM A;  3ASN C;  1QLE C;  3EFF K;  1COW G;  3QO5 A;  3CPW U;  1R6N A;  1OCR B;  2X7R B;  3KG2 A;  2EIK B;  3AG3 C;  2OCC C;  3ABK C;  4Q20 A;  1L1F A;  1K4D C;  3E8F A;  1F51 A;  3ZN0 A;  3P30 A;  5KA5 A;  3AG1 C;  4MVZ A;  3P32 A;  3DGE A;  1F4N A;  1RPO A;  1OCZ B;  2EIL B;  3BY6 A;  1GMG A;  1R6K A;  4PA4 A;  1K34 A;  4GT1 A;  3MHH C;  3CCQ V;  1UJW B;  3OEH G;  1H2G A;  2Y69 B;  1YI2 V;  4G2K A;  3OMA B;  1PL0 A;  2WLL A;  2ZXW C;  3ETE A;  1RM1 B;  3CCE V;  1SRY A;  4JAV A;  1OHH G;  4UVA A;  1MG1 A;  3F7V C;  4WFH A;  1K92 A;  2WSS G;  1EZJ A;  2AHY A;  1V55 C;  1AI6 A;  1ARO P;  4JTA B;  5B1A C;  1Q81 W;  1M56 B;  3EHB B;  3F7Y C;  2IJK A;  2YSU B;  3AG2 B;  3K3W A;  4RAI A;  4XDJ A;  3T4D A;  3E8H A;  1JQ0 A;  3ZMZ A;  4MVU A;  3ASO B;  2P90 A;  3CC7 V;  5LBQ A;  3SPC A;  4WCE V;  1CEZ A;  3E8B A;  3TET A;  1V54 B;  1Y66 A;  2JJ1 G;  1AI5 A;  1BMF G;  1AR1 B;  4HZ3 A;  4PA3 A;  1MOF A;  3ABT A;  5IYB O;  4MSW C;  1HWY A;  1GTO A;  4WFG A;  1K33 A;  4OXS A;  3JCZ A;  1OCC B;  3AG4 C;  1VQ8 V;  4JAU A;  2EZO A;  5LGT A;  4R6Z A;  4QE9 A;  3CMA V;  4PA7 A;  1SER A;  4PDV A;  1EFR G;  3ABM B;  2XND G;  3E89 A;  3CME V;  3B77 A;  2V1D A;  1YTF D;  2EIJ B;  4P9O A;  2IJI A;  4MT8 A;  4PA9 A;  1IXM A;  2BOC C;  3OR7 C;  5L3E A;  4X88 A;  5CBG A;  3K9A A;  3K06 A;  1F4M A;  1RPR A;  2WAM A;  4JF3 A;  4WFE A;  3I56 V;  3FB6 C;  1K73 W;  5EBW C;  3SPJ A;  5KUK A;  1EBO A;  1OZ0 A;  3SYA A;  1YJ9 V;  2HFE C;  2Z5U A;  3VOU A;  4BW5 A;  3OGC C;  3QO7 A;  1QLN A;  4PDR A;  4MVQ A;  1M57 B;  4HAM A;  4N21 A;  4BIZ A;  1VQ9 V;  3GWO A;  5L3D A;  1Q86 W;  3X2Q C;  2W6I G;  1K7D A;  1OCO C;  4I9W A;  4CBC A;  5FL7 G;  1FS0 G;  4PDL A;  5DN6 G;  3K03 A;  1AI7 A;  4UXN A;  1CP9 A;  4X89 A;  2D3O W;  2GSM B;  4GX2 A;  2LFS A;  3OM3 B;  4TWK A;  4MVM A;  3SYP A;  3OMN B;  1E79 G;  1AJP A;  1PNM A;  4RUF A;  2XAF A;  3TK1 A;  3TCU A;  4GCZ A;  3RW0 A;  4LBE C;  1VQP V;  2HJF C;  2JDI G;  3ZMT A;  3OAA G;  1DLB A;  5B3S C;  3D3I A;  4MS2 A;  1E1R G;  5CBF A;  3ZRW B;  4TT3 G;  1NVP B;  2HKO A;  2M7W A;  4LP8 A;  3E8G A;  4RO2 A;  1I5X A;  4G27 B;  5H6R A;  3E2E A;  1R73 A;  2HVJ C;  2X6B A;  3R65 A;  1JX9 A;  2ZQM A;  2P7T C;  3JYC A;  4QPK A;  5IYD O;  3ABL B;  1ORQ C;  3MD0 A;  3CXC U;  2HR3 A;  1GO3 F;  3ZJZ A;  3F5W C;  3IC7 A;  1PNL A;  1QBZ A;  2ATK C;  2MK3 A;  3SYC A;  4JYB A;  4PA6 A;  1KQS U;  5CN0 A;  2Q67 A;  1AI4 A;  3LSQ A;  5B1N A;  1YSC A;  2XAQ A;  3E83 A;  2WLI B;  3ZN1 A;  3OW2 U;  3CD6 V;  1OCZ C;  1KP3 A;  4Z1M G;  2EIM C;  1AJQ A;  3SYQ A;  2IJJ A;  4DO2 A;  5GW7 A;  2EZP A;  2ZDI A;  3SPH A;  2A9H A;  4MW3 A;  3OFN G;  3STL C;  5LHG A;  1K3E A;  1FXK B;  1QR8 A;  4PEL A;  2XAG A;  5HFL A;  5LGN A;  2EBO A;  3UKM A;  4FMT A;  1K5S A;  3ASN B;  1AJN A;  2W0F C;  2Y69 C;  3ZMS A;  4MTF A;  1QVG U;  4UVB A;  2P67 A;  4XDL A;  1FFT B;  3JD0 A;  2Q69 A;  4E2L A;  3AG3 B;  1F23 A;  2OCC B;  3ABK B;  1K4C C;  1JOY A;  3LDC A;  2IU3 A;  3LNM B;  5IY5 C;  2YEV A;  1GM7 A;  4WF9 V;  3OUF A;  3W7X A;  2EIN C;  3AG1 B;  2X6A A;  4MVO A;  4RUE A;  4RQE A;  4MTG A;  4H33 A;  3AG2 C;  4X8A A;  2H8P C;  5H6Q A;  1CPY A;  4JTD B;  1M1K W;  3PJS K;  3QO8 A;  4RQF A;  1NBM G;  1K9M W;  3G4S V;  1W0K G;  3FKS G;  4MVS A;  3ZCC A;  2A0L A;  1QVF U;  2DQ0 A;  4JAS A;  2ZXW B;  1H38 A;  1YJW V;  3T2M A;  5J9P C;  2YEV B;  1S5H C;  3BEH A;  3CCM V;  1WLE A;  1GM8 A;  1Y4M A;  4P9P A;  3B8M A;  1V55 B;  5L3F A;  3JD2 A;  5B1A B;  2BOB C;  4WFF A;  2Y48 A;  1JJ2 U;  1K8A W;  3CCU V;  5BZB A;  2IW5 A;  1NH2 B;  5C93 A;  2ITD C;  3CCJ V;  4ASU G;  3ML0 A;  2JJ2 G;  4LC1 A;  1S0V A;  3OMI B;  5KA6 A;  2PI4 A;  1W2B U;  1M90 W;  3G6E V;  3T4Z A;  1N8R W;  2IJH A;  1ROP A;  2XAH A;  4YXW G;  2DYR C;  1VQO V;  2NNU A;  2JEX A;  5B1B C;  1I5Y A;  3CCR V;  4MTO A;  1GM9 A;  3JD4 A;  5EK0 A;  5L3G A;  3UM7 A;  4I5S A;  3SJQ C;  2ZD9 A;  2QKS A;  5CA3 A;  1ENV A;  2AHZ A;  2W6J G;  3LUT B;  1KEC A;  1E1Q G;  2CK3 G;  5CBH A;  4CZZ A;  1NQT A;  4BAY A;  1VQN V;  3CCS V;  1LNQ A;  3K04 A;  3H01 A;  3VBB A;  2ZR2 A;  3ZRW A;  1K5Q A;  2WLH A;  3OEE G;  4QNH B;  2P6J A;  5KUM A;  1FXH A;  2QA4 V;  3E35 A;  1PKX A;  2EJR A;  2HLD G;  2XOK G;  3OE7 G;  5EC1 C;  3SYO A;  2IH1 C;  1S77 D;  2DWD C;  1R3J C;  1NKD A;  3FYE B;  4GX0 A;  4UV9 A;  3HPL C;  3CCL V;  2KB1 A;  2QEX V;  1VQ5 V;  2WLI A;  3WG7 C;  5H9C A;  1MAB G;  3SPG A;  1DTO A;  1W0J G;  2A79 B;  2DYS C;  2X0L A;  1S72 V;  5IYC O;  2B1I A;  3CCV V;  4DXW A;  1YIJ V;  2NLJ C;  4FK5 C;  2K1E A;  4G28 B;  1FXK A;  2Q6A A;  2WLN A;  4UUJ C;  3X2Q B;  4ZKI A;  4MTX A;  3ZMV A;  1OCO B;  3FB5 C;  3W7T A;  2QE7 G;  2V7Q G;  4UVC A;  1Q82 W;  3A0R A;  2LFR A;  1QCE A;  1OCR C;  4MW8 A;  5EC2 C;  2IU0 A;  5DM6 V;  2EIK C;  3K08 A;  2C2A A;  5HFM A;  4H37 A;  3W7U A;  5EBM C;  2DWE C;  2ZR3 A;  4UV8 A;  3T1C A;  2JK5 C;  4U7O A;  1PNK A;  3LDE A;  4EKW A;  1VQK V;  4L87 A;  5B3S B;  3LDD A;  3ZRX A;  4QE7 A;  2EIL C;  3RBZ A;  1SET A;  3IFX A;  1H8E G;  3RVY A;  4HYO A;  1J95 A;  4FIP C;  5EBL C;  2HVK C;  4JTC B;  2H94 A;  4P30 A;  1QLE B;  2R9I A;  4GX1 A;  1JCH A;  4N23 A;  1NJI W;  2B1G A;  3E86 A;  2XAJ A;  3CP1 A;  5B1O A;  1R3I C;  1GKF A;  1R3K C;  1RM1 C;  4R50 A;  1XL4 A;  1H8H G;  3FB8 C;  2JIZ G;  2GHY A;  1TUE B;  4JPR A;  1YIT V;  2QTO A;  2Z3Y A;  4KP4 A;  1G8M A;  1KP2 A;  2EIM B;  1M56 C;  4R7C A;  4FJC C;  1NVP D;  2ZDI C;  1WPX A;  1BHA A;  2WLK A;  4ZBM A;  3ASO C;  1R3L C;  3JD1 A;  2R9R B;  4FPP A;  1ZWI C;  3STZ C;  2OT5 A;  1P4R A;  4WFB V;  5CMU A;  1DF4 A;  3SPI A;  2DQ3 A;  5LHH A;  1KKD A;  2LP7 A;  3K79 A;  1V54 C;  1YTF B;  5IY5 B;  2XAS A;  4LCU C;  4JGS A;  5IDJ A;  1VQM V;  3IGA C;  2EIN B;  3FYI B;  4R8C A;  1FXV A;  1SES A;  5E1A C;  1YHQ V;  2OTJ V;  2WWW A;  3AEI A;  1VQ7 V;  1OCC C;  3OUS A;  1MSW D;  2DW4 A;  4GX5 A;  3ABM C;  4J9Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...