1W2BU

Trigger factor ribosome binding domain in complex with 50s
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1w2bU00
3I55V 1VQOV 3G6EV 3CXCU 1VQMV 3CCLV 1VQLV 1W2BU 1QVFU 3CD6V 1VQNV 3CMAV 4WF9V 3CC4V 1R73A 4WCEV 4WFAV 3OW2U 1KC8W 1N8RW 3CCEV 1YI2V 1YIJV 3I56V 3CCUV 3G71V 1YJNV 1S72V 1Q7YW 1Q82W 1Q86W 1JJ2U 1VQ4V 1VQ8V 3CCRV 3CMEV 3CC7V 1QVGU 2OTLV 1KQSU 3CPWU 1VQPV 1YITV 3CCMV 1K73W 1M90W 1VQ5V 3CCVV 2QEXV 3CC2V 1YJ9V 1Q81W 1NJIW 1YJWV 1KD1W 1VQKV 1YHQV 5DM6V 1VQ7V 1K8AW 1K9MW 3CCSV 3CCQV 2OTJV 1M1KW 1VQ9V 2QA4V 3CCJV 3G4SV 4WFBV 2D3OW 1VQ6V
chains in the Genus database with same CATH superfamily
3TJTA 4TWKA 4BR6A 1QVFU 3DC5A 3ZJZA 2QM4A 3ZRWA 3W7TA 5CA1A 3AG2B 3UQ8A 3STZC 5LP6A 4DV1B 2OTLV 3T4ZA 4DRXB 2AGAA 4X62O 3H01A 1AJQA 2RCVA 3SR2C 2OCHA 1ZWIC 4B3SB 4DO2A 3K06A 3OMNB 1SZTA 4PHZA 4N21A 3E2EA 3RWRD 2PI5A 2BCCH 4NTXA 3CXCU 2JEXA 1QBZA 3ABKB 2QTSA 2M6YA 3ZHQA 4FFBB 1QU7A 4KUMA 1H2KA 2ZXWC 4DR6B 2G38A 4X1YB 2C2AA 2QWRB 3UT5A 2AHZA 4LF8B 3EVKA 1EBOA 1RSOA 3JAWA 5JVDB 4B3TO 4ABMA 1Y4MA 3JCUZ 5L3FA 3GVMA 4ZI7B 3WFVA 2H8PC 2Y0PA 1SC5B 1XILA 5EK0A 2ZT9B 3WG7B 4O4LA 4NXMO 2ZR2A 2O57A 3L72H 1FS0G 2CDYA 2EULA 1ZTEA 4ZHQA 2DWEC 3CPWU 3ZHVA 3QNEA 4CS3A 3SYPA 3JD1A 1NVPB 1Q90D 4GKJB 3IC9A 4JZGA 2KG7A 4AQYB 1Q6UA 5D5PA 1MMMA 5EYPA 4K8ZA 2L35A 3JALA 5IY5C 4ZIBA 3ZRWB 2R70A 2HHHB 4DR7B 5LYJB 4I0XA 2YI8A 2YEVB 2CTWA 2JEUA 3RYCB 1KMIZ 5IYZB 5EBWC 1AROP 1BSMA 2FL4A 4YHHO 2LGWA 1NZ6A 5BY1A 1NQTA 1BZKA 4CBCA 1NJIW 1AI7A 4PA6A 1K97A 2HVJC 5J9PC 1VQOV 3G6EV 1QLEB 4HBNA 3GWOA 2NLJC 2KSDA 5LMNB 2GHYA 2YUAA 4X66O 3BCCH 3TGUH 3A0RA 1XMOO 2WLLB 2ZIOA 3ABLC 1ORQC 2VRZA 4NB5A 1N32O 1VQ7V 3ETDA 1M5IA 4GX0A 4ZBMA 4O2BA 3LSSA 5A9GA 4LFAB 1GM9A 3H9VA 3W7WA 1M56C 2KQXA 2ZDIC 4W4KA 3U11A 1X59A 2VWKA 5EYPB 4H13B 3M7MX 4DR2O 4LFBO 3OGIB 4QPJA 4EEQA 5BZBA 5LOVA 4J41A 3IJ4A 2OYQA 4X66B 1OCZB 1PL4A 2YEVA 5TISZ 2QJ1A 4UCOA 2QTOA 1W0KG 2XASA 2PF4E 2W0XA 1Y74B 1WLEA 4RO2A 5J2UA 1S0VA 2Q69A 1RPOA 4PI0A 3OD4A 2R9AA 4KHPO 3RBZA 2ZE6A 1YZBA 5JH7A 3ICXA 5LMNO 1M56B 4G27B 4I50B 1JOYA 5KUKA 1VQ6V 2UUAO 3W7SA 2DJVA 3BAAA 4GT1A 3ZMZA 3CC4V 4UV8A 3ASNB 3LNNA 2PI4A 2ZE8A 2AHYA 3QF7A 4X20B 2H94A 4YY3B 3H1IH 1ZSPA 1ZUQA 3Q4HA 4I50A 3OMAB 4YJ3B 1I7FA 5CA3A 5KHGA 1P7GA 4LF9O 1EFRG 3SPGA 4AQYO 3LDDA 3D8CA 1QR8A 3L70H 1CXZB 4JAVA 4HZ3A 1VMGA 1I0HA 4MVSA 4U3JA 1XHXA 1Y76B 2IJIA 2P06A 5CB4B 2WLMA 1OCRB 1VQKV 3DXRA 2IH1C 4WFEA 2CAZC 3K08A 4ICGA 3O9OA 2X6AA 1M93A 4FPPA 1Y66A 2P22C 4L87A 4GKJO 1BHAA 2ZE5A 1GN4A 4HNAB 5B1NA 2X6CA 2A06H 3R65A 1SQXH 2Q7GA 5IJ0A 4GUNA 4NR1A 4UFZA 1GN6A 2KKWA 2F4VO 2ATKC 3CHXA 1TGOA 1HNXB 2EJ7A 2XAGA 4MVRA 3CCQV 1J5EB 1NTMH 2ADQB 4NVPA 1XEQA 2DYSC 5IJ9A 2W0FC 3T4DA 2XAQA 3DGEA 4JPRA 3SYAA 3OEHG 1JR9A 4RQEA 3E35A 3JARA 1Q86W 3IGAC 1VF7A 1GO3F 2LO1A 1AI6A 1HW7A 2FTKA 4X1IB 1AVMA 4B3RB 1EN4A 3APOA 4LP8A 1M9NA 2QWOB 3RYIB 3RN4A 4D6TH 1JCHA 2B5UA 2ZD9A 4OPHA 4J9ZB 2ZNJA 1Y6XA 1HWYA 1PM9A 2X6BA 4BIUA 4O2AA 3G80A 4J7KA 4CC6A 3F7VC 3MAQA 1H2LA 4FLYA 5H2FZ 1Z2GA 3OR7C 2YS8A 1QCEA 1KECA 4P30A 1PNKA 1FXKB 1H38A 3BVOA 4UVAA 3AG4C 4EFBA 1COWG 3L71H 2UXCB 3ZIAG 4RQFA 1N33B 3ABMC 4B3RO 2ITDC 4FMTA 1L8DA 1AR1B 1TA8A 1D5NA 3BRCA 5KX5A 4RWUA 1YTFB 5IJ0B 4CH4A 1OCOC 4JV5B 4H33A 5HFLA 2VS0A 2RJZA 5ITZB 5IY5B 3FB5C 3CB2A 3CMAV 2F4VB 3FYIB 3WB0A 3J7AU 2EIJC 4JYBA 5FNVB 3SPJA 2XOKG 1I94O 3CX5F 2QGNA 1XOUA 4DV7O 2A3QA 1KB9F 3VQXA 3HKCB 5L3CA 2LFSA 2OTJV 1KYOF 3I55V 4O4LB 1GKFA 4E4EA 3K58A 1VQNV 3G6BA 1XNQB 4G2KA 2ZNIA 5LA6A 3BY6A 4GX2A 1OHHG 4H37A 2HR3A 4UB8Z 4JI0B 1CPYA 4K0KO 2E74B 5L3DA 4DR3O 5IE9A 5IT9N 4I0XB 2Y4UA 3QTCA 1QNMA 4YY3O 3K5LA 1XL6A 2IU0A 2CGNA 3ZHUA 5LA6B 5B1BC 3JALB 3K5NA 4IIJB 5KUMA 5BXZA 3HKDB 3ETGA 3E8HA 1NTZH 4GKKB 4U3FH 4IT5A 4TSFG 3FKSG 4CZZA 2ZIMA 1M90W 1TUBB 3K03A 3THOA 2JIZG 3UT5B 3ZX6A 4KHPB 2JS3A 1GH6A 1Q6HA 1S5JA 3E8GA 1RM1B 2IM9A 5KHIA 5H6QA 3L74H 2P7TC 5FL7G 3LSUA 4MW8A 2CUGA 4N23A 4UCRA 5BMVB 4RAIA 1EN5A 3CYOA 4DW0A 2WPDG 3MDSA 4NTYA 1K5QA 4P9OA 3P3PA 1RFYA 1KP3A 1HR0O 3HKCA 3JATA 4PV1B 4X88A 1R6KA 3BA9A 3VOUA 4YIOA 4CH3A 2ZQMA 1WPXA 2UXNA 3ABUA 4AHCA 4MW3A 1WP8A 2MW2B 3O65A 1YJ9V 2PUSA 1JVMA 3GWKC 3WU2Z 2YIBA 1GAXA 3CCJV 5EBLC 4MTOA 3AG2C 4X89A 1AILA 1IDSA 1FXKC 1G1XB 1HR0B 4PJ0Z 2ODMA 1P49A 2ZM6O 2P67A 3ZN1A 3E8BA 3JAMN 3NXSA 5JJJB 2ZKOA 4LF8O 4DK0A 4PDVA 1LUWA 1G8MA 1V54B 2YSUB 4J80A 2HFEC 4DV2B 1BQ0A 3H1JH 3F5TA 4YHHB 2JRIA 4LH6A 2UXCO 1ZL8B 3A0BZ 2UUCB 4NXNB 1GK9A 5JJNB 1H2MA 1IBMB 4DV6O 1K7DA 2QKAA 4DR7O 2FYUH 1TVKB 2EZOA 2GTAA 2XAFA 2DQ3A 2A7WA 2PZSA 3ZMUA 1SQBH 3M8AA 4EKWA 1YSCA 4O4JB 1W2BU 1SKVA 1FFXB 3SPCA 4WBNA 3JD4A 1GM7A 4JI6O 3OT7A 4JI8O 4UVCA 2OCCB 4JI0O 2AZ0A 2UXBO 2GSMB 4KL1A 4JASA 3A2FA 5B66Z 4LFCO 2E5LB 4UV9A 1OCCB 4K3AA 2DYRB 3FAVA 3SPIA 1OZ0A 4B3MO 3UKMA 3OTOO 4BW5A 4IHJA 5B5EZ 1J5EO 2NN4A 3ASNC 4FIPC 4J7JA 1BMFG 1UPGA 1AJNA 2EIJB 3CCVV 2GBOA 5IYBO 2DQ0A 1SQPH 2KB1A 1K8AW 1K9MW 1VARA 2NNUA 4O4HB 4QNHB 4JV5O 1KC8W 3AK2A 2WLNA 1SETA 2B9ZA 2JDIG 3SJBC 3CRQA 2IH3C 3EXAA 3OUSA 3UCSC 3K9AA 1E1QG 2JGDB 3FB6C 4JI5O 4X65O 2PY5A 3L73H 3T1CA 1AR4A 3FB7C 4FZ0A 3CE2A 5CA1B 3B77A 2UU9B 2QDOA 4QJFB 1D5AA 3BEHA 1H8HG 4X65B 1SA0B 1KUQA 4WBNB 5LP6B 4TQFA 5LMUB 3OAAG 5JWPA 1FXKA 3ZEDA 3CWBH 3PJSK 3KCYA 3KKYA 3RT3C 2L6LA 2RQ6A 3DXRB 4QPKA 4BIZA 2UUAB 2F43G 4JI4O 4JAUA 1T5EA 2YIAA 4JI5B 1YTFD 2EJRA 4IHJB 1V55C 4TOIA 1J95A 5B1AB 1K4DC 3D36C 2FB5A 3G67A 2QEXV 3JASB 5A2QN 1DLBA 3K59A 1G6UA 3H1KH 4MTXA 1XNRB 5EBMC 1D2DA 1K92A 3SYQA 1WPBA 2JK5C 3JYCA 2UUBB 5GONB 1YJNV 4JI7B 3I56V 1S72V 2XUMA 4ZHQB 4I9WA 1TUEB 3N27A 4DV5B 1FKAO 2ZR3A 3VQVA 4F6RA 1XMQO 4PA7A 1NU1H 4W4LA 4ZKIA 5KHHA 5EIBD 1I5XA 1IVSA 1AP5A 3MHSC 1PNMA 4GCZA 3R66A 1AP6A 4NTWA 5KAFZ 4P2ZA 3EFFK 1OCZC 3LUTB 4JI6B 2P4VA 5LYJA 1MOFA 3QO5A 2CH7B 4MTGA 4R6ZA 1BCCH 1P7BA 1VEWA 4NYKA 3B40A 2VQEO 3RYCA 1SQFA 4OXSA 2CGOA 4XDKA 1S5LZ 3CCUV 5LL6Y 1OJHA 2VWJA 1JJ2U 3BABA 3IFXA 4FFKA 5JQGB 1QQCA 3AG7A 4IYHA 3EHBB 1NR7A 3CCSV 4DR4B 5B1AC 5IYCO 2YXHA 3ABMB 1DF4A 5LGNA 4JI1B 4DV2O 2XNDG 4JTAB 5ITZA 5JQGA 2WLLA 3AG1C 4XBFA 3UO3A 4I55A 1RP3B 2EX3A 3T1YB 4FLWA 1JQ0A 1G4YB 4LH7A 4AI8A 4DR1B 3BHPA 4ASUG 4CS2A 4FLUA 4LBEC 1VIBA 3U0ZA 3B8MA 2ILMA 1YCIA 2CTQA 1KP2A 2Y4TA 4I9QA 5GTIZ 4A5UB 4D7TA 5KLVH 2BE3A 1SRYA 1WJZA 2BSKB 4IGGA 5C93A 2QKSA 1SS3A 2Q0OC 4GX5A 2YI9A 2YDEA 3OM3B 1L1FA 4R8CA 3E22A 1Y74A 1V55B 4G28B 4DR5B 1VQPV 3CRRA 4BW9A 3N2GB 2ZE7A 4PA3A 1IBKB 5JH7B 4OPAA 4WFFA 1Q3EA 2Q5ZA 3FFQA 2CE4A 2F93B 3D3IA 5HFMA 4E2LA 1XHZA 4JTDB 5L3GA 3CC2V 3SJAC 4QE7A 1CP9A 4X20A 2Q9LA 2CK3G 4DV0O 4MVOA 3OFNG 1PP9H 2EINB 4DR5O 2DE0X 3BPZA 3E83A 2RN9A 4JTCB 5H5NA 5EZYA 1V54C 1YI2V 1K3EA 4EFEA 4F4LA 1BQZA 5DEDA 4DV3B 5CBHA 2DMXA 1NR1A 1NKDA 3TXQA 3RYFA 1AI4A 3ZS8C 5FLXN 3IAYA 2Q67A 4MVUA 5LHGA 4JI2O 4WFBV 4OX9O 1NH2D 4JI7O 3LNMB 4HYOA 1VF6A 5KMGB 2Z5UA 1Q5OA 4WF9V 1BGYH 3E86A 3C3SA 1U96A 2Y0IA 1YIJV 5LGUA 2K9PA 3ML0A 5CA0A 3D36A 2R9RB 4JI3B 4Z2WA 3T1HO 1MABG 4I7ZB 4UCTA 4BIOA 4O4HA 2X7RB 2P5OA 1VF5B 1V9PA 4JF3A 1LR1A 3CCLV 1IURA 3JARB 1ZL8A 1QLNA 4B3TB 2OIGA 1QLEC 2EIKC 4X1KB 1HNWB 1O9GA 4LF7O 4JYYA 1W59A 2FKXA 3SJQC 1FJGB 2WA3A 4LF6B 1H2SB 3HKEB 1ROPA 4PDMA 3JSLA 1PV0A 5GTHZ 4O2AB 4EB6A 4O4JA 2VQEB 1N8RW 1U97A 1JJOA 1Q82W 1K4CC 1R1BA 1QR9A 1Q8IA 3MD0A 1FD9A 4X8AA 2Q0AA 3RVZA 1DF5A 1SESA 1GMGA 4YJ3A 1NTKH 1YVWA 2V1DA 4JAAA 3ASOB 2VQFO 2HG5C 2Z3YA 1F4NA 1NT2B 5LHHA 3LDCA 5J2TB 1OCOB 3CRMA 3AG3C 1A32A 2E76B 4WCEV 3JD2A 1MNGA 3J81N 4O4IB 3G71V 1X4TA 5B1BB 2Z0AA 1HNXO 4WFHA 4JI3O 1ZX3A 5CB4A 1MA1A 1B3QA 4IL6Z 4GX1A 2X0LA 5H6RA 4TUYB 3D3QA 1GN2A 3SJCC 2RNBA 2F66C 4DYLA 4LR3A 3JSNA 1PKXA 3CC7V 1H2NA 4MVZA 4PA9A 4X1KA 4MSWC 3C90A 2N74A 3VBBA 2XTAA 2PGGA 1DTOA 1NI8A 4B3MB 3ZCCA 2HLDG 3H1HH 3OR6C 1KBHA 2DN9A 1JA8A 3K9SA 3K5OA 4JI2B 3WB2A 1OV9A 4OX9B 1N33O 5JCOA 5E1AC 2ZINA 1FPOA 1HP8A 2VQFB 1IXMA 4D7SA 1R3KC 4LWSB 1NH2B 1KD1W 1FAFA 3CJHA 2LQTA 3FB8C 2OIEA 1DGSA 2AW9A 1AJPA 3QO7A 5FPRA 4Z1VA 3B4SA 1H8EG 3N2KB 5EC1C 3CMEV 3ZHTA 2H3OA 3B09A 1ENVA 3X2QB 1I5YA 1TUBA 4TQDA 5LXTA 1CEZA 5EC2C 4IYIA 3K5MA 4FVMA 5BMVA 1YEWA 3N2KA 3DC6A 4ZOLB 1Y67A 2M7WA 4DUYB 5KA6A 1R3IC 2EILB 1W0JG 3QVNA 5F2VO 2WAMA 4B08A 4LF4O 1S77D 1HNWO 5LXTB 3RFRA 1L0LH 5JVDA 3TETA 4I4TA 2ZM6B 4ZI7A 1SERA 1FXVA 3RW0A 5LHIA 2YC0A 4JYAO 1YXBA 3ZHRA 1MZEA 3CSXA 4ZOLA 2F1MA 3OTOB 3F7YC 3T1HB 1K5SA 3UM7A 3KZIZ 4LFAO 3K79A 3ZHSA 2AXTZ 2EILC 1IBLB 4R7CA 3HB3B 1XI1A 1XUQA 1URFA 4YJ2B 2QSAA 5LBQA 1FFTB 1H2GA 1RPRA 2Q68A 3JD0A 4PA4A 2QWNB 1AB3A 2AZ2A 5CN0A 2IBZH 1P4RA 2A0LA 1B6QA 2WWWA 5LP6C 4FJCC 4PDLA 2WLIA 4DW1A 4DUYO 4TT3G 1BS3A 3OE7G 4MT8A 4DV0B 3RVYA 3ABLB 4JI1O 1FXHA 3ZRSA 4NXNO 1SQVH 4IIJA 1XREA 1WN7A 4UCSA 1Z5VA 2WLIB 3W7UA 4J10A 1K33A 3SGIA 1BT8A 1PPJH 2B1IA 5CBFA 2UXXA 1TVKA 3SDLA 4F6EA 3K04A 2HJDA 1XBLA 4H44B 2W6JG 4MVMA 1B06A 1XNQO 2Y69B 1FFXA 1OCRC 2ETNA 1UFIA 2YXLA 2UXDB 2HJFC 1N4CA 2QWQB 1NS1A 3I5DA 2QWPB 3RYFB 2JGUA 2E3CA 2Q7EA 4JYCA 4X64B 3RGBA 3SYOA 4FLXA 2XT9A 4DR1O 2UUBO 1WA8A 3OW2U 1F7YA 3OGCC 3KCXA 4DUZO 1LUVA 2EZPA 4Q6GA 2FMLA 3E22B 4DV5O 2QM8A 3AG4B 4Z1MG 1IBLO 4OGQB 3P3NA 3ZN0A 1Q6IA 2LP7A 3S3WA 5C8YB 4LF5B 1YDXA 2WLHA 1DK1A 2EIMB 3OTFA 2ZXWB 4UVBA 1WA8B 4I5SA 2YIBD 2A9HA 2LW1A 5K1XA 1WB8A 3CD6V 3ABKC 1N0JA 3CRCA 3ZRVA 1TAEA 1Z5WA 4LNUA 5KHJA 2WA4A 2XAJA 4P9PA 1OCCC 4DR6O 4X1IA 3ZMSA 1L0NH 1VQ9V 3ZMVA 1QHTA 3OMIB 2IJHA 4EB6B 1GM8A 2B1GA 1EZJA 2F23A 4J9YB 5EZYB 1VP7A 1M4UA 1SA0A 1HNZB 3JCZA 4X62B 1MSDA 2HEPA 3A8TA 1SQGA 4PI2A 3T2MA 4FZ1A 2MK3A 3F5WC 2UU9O 3UO2A 2XHBA 1VF6C 4KFMA 3AEIA 4CH5A 5JJEB 4GZRB 3E8FA 1N34B 5DN6G 5K1PA 1JMKC 4U7NA 4L8JA 2PYJA 3B2EE 3K0DA 5KMGA 5EIBC 4KXRA 4J7ZA 5AG2A 1SQQH 4U3JB 3ABTA 3APQA 5CMUA 2DWDC 5KX5B 3P32A 5DM6V 4PD4F 4K35A 2DW4A 3IC7A 1WP7A 2QA4V 2D3OW 2GTSA 2V4DA 4TUYA 1WNSA 2EBOA 4FFBA 2R72A 5JCOC 3FYEB 3LSQA 2BOCC 4DK1A 3STLC 2Y48A 4LNUB 3W7XA 5FPOA 2LJ2A 2IW5A 4DUZB 2GDSA 4F6RB 5H9CA 2IJKA 1AR5A 1Q43A 2EINC 3ZMTA 3CP1A 1N34O 4JGSA 1BL8A 2UXBB 3CS5A 4CC5A 3TK1A 3JD3A 2W6IG 4XDJA 2UXDO 3NR7A 1HNZO 1UJWB 1R3JC 4JI4B 3HPLC 1P84F 4GLXA 3J80N 1R73A 1M57B 5BR8B 2QE7G 2BTQB 5B3SB 2YXYA 3MHHC 3CCRV 1K34A 3AG1B 4UCVA 1VQ5V 4FM2A 2JJ2G 1ZAUA 3WG7C 1RM1C 1IBMO 3AK1A 4Q20A 3AG3B 3SPHA 2UUCO 5IYZA 3GB7C 2EIMC 4PDRA 4QGPA 4FLVA 2BTQA 3PN1A 1E1RG 1FJGO 2WLJA 1ZLZA 5KHKA 4X1YA 3U10A 4J42A 4LF7B 1XDCA 4UUJC 4I55B 1YJWV 2P6JA 3JAWB 1LNQA 1R6TA 4JZ2A 3C3TA 3X2QC 2YICA 2PYLA 1I08A 3G4SV 3JAKA 2ZCEA 1AI5A 1S5HC 2ZDIA 3K0GA 4WFAV 2ARHA 4LF5O 4FM0A 4X64O 1O9HA 1N36O 4DR2B 5FNVA 5IWAB 2WSSG 2N04A 3FD9A 4R50A 1MG1A 4JI8B 1F23A 2WLKA 4CS4A 2CTPA 3SYCA 1B04A 3ZRXA 3FX7A 2E5LO 2DOSA 3HKBB 4LFCB 3LDEA 4RUFA 1BHBA 3AK3A 4YJ2A 1WAZA 1QVGU 1K73W 3N2GA 3ASOC 1XMOB 3BFRA 2GUZA 2CH7A 2N05A 4K8XA 2F95B 4TV8B 4BWAA 3E89A 4FLTA 3ETQA 4MVQA 3HKBA 1US6A 2V7QG 3P30A 2PTMA 1WB7A 2Q4PA 3BA8A 3K57A 1KKDA 2GV9A 4B7EA 3S3XA 3HKDA 2BTOA 4DV4O 1IBKO 1M57C 1MSWD 2LW7A 4TV8A 1GRJA 2Q73A 4DV6B 5GW7A 4U7OA 5L3EA 4TV9B 4I4TB 2IU3A 5IDJA 2Q6AA 1IXBA 3WB1A 5IYDO 3JAKB 1FYJA 4GYCB 4X9QA 1VQ8V 4CH6A 2IJJA 2HHHO 1YF2A 2HVKC 3L9DA 4K0KB 2XAHA 4LFBB 4DV7B 2RDCA 1SZXA 1YHQV 4WFGA 1N36B 1I94B 3JATB 5LOVB 2BOBC 3QG5A 1SF9A 4O2BB 2ADPA 4LCUC 2Q8VA 3B8NA 2E75B 3CCEV 1GTOA 4B7KA 2HP8A 3L75H 1Y76A 4FLZA 5CA0B 2EIKB 1N32B 5J2UB 3CCMV 4XDLA 4LC1A 1Q81W 2JS5A 5C8YA 2A79B 4C7UA 4NXMB 2GUZB 3M99B 1IZ3A 2BSKA 5E79Z 1JX9A 2P90A 1PD3A 4UB6Z 4JYAB 3ZBHA 3T1YO 1IX9A 4YIPA 1EZVH 3RYHA 1Q7YW 1VQ4V 3CXHF 5LGTA 4DR4O 5D5QA 4LF4B 2DYRC 1YITV 4B3SO 3QO8A 3Q4HB 4DV4B 2OCCC 3HKEA 5IJ9B 4AILC 1HDJA 1NBMG 4MTFA 5B1OA 3HR0A 3TCUA 2JJ1G 4FM1A 3RYHB 1VQMV 4TV9A 2R9IA 3K3WA 3ETEA 1GN3A 5B3SC 5DECA 5L3BA 4DR3B 4GKKO 5BR8O 2RMKB 1F51A 1F4MA 3RYIA 4NKGB 5J2TA 2P4KA 1MZFA 3VQWA 1S3JA 2YIDA 1N0NA 1NVPD 2Y69C 4LF6O 4FK5C 3TXSA 3CRAA 5KA5A 4O4IA 2Q7HA 4HNAA 1KQSU 2OWOA 4YXWG 1EM1A 3JASA 5KAIZ 2DYSB 2QR4A 5IWAO 4BAYA 1PL0A 2JVDA 1E79G 3FAVB 4DXWA 2ITCC 2D2CB 1XQ8A 2HKOA 2CTRA 1S76D 5CBGA 4QIWF 5GONA 2NR5A 1XMQB 3DSQA 3OEEG 3DTUB 1RSOB 1KKCA 3A0HZ 3H1LH 4HAMA 1KU9A 1BE3H 2OT5A 3KG2A 3OUFA 1EN6A 1THZA 1JPXA 1M1KW 4J11A 4MS2A 3VQYA 1R3LC 4PELA 1JFFA 2LFRA 1VQLV 4H0LB 4RUEA 1XNRO 1XL4A 1PNLA 4UXNA 3CEIA 4KP4A 4DV3O 4UCUA 4LWSA 4QE9A 2JGDA 5LMUO 4DRXA 2LGQA 1R6NA 4DV1O 2KG7B 2QM7A 3CJHB 1JFFB 2K1EA 4LF9B 2QKCA
chains in the Genus database with same CATH topology
3D3IA 2IU0A 3OMIB 2IJHA 4TWKA 5B1BC 5HFMA 1QVFU 3ZJZA 5KUMA 4E2LA 1GM8A 2B1GA 4JTDB 3ZRWA 3W7TA 5L3GA 1EZJA 3CC2V 3AG2B 3ETGA 3E8HA 4QE7A 1CP9A 4J9YB 4TSFG 3STZC 3JCZA 2OTLV 2CK3G 3FKSG 4CZZA 3T4ZA 1M90W 3H01A 1AJQA 3K03A 4MVOA 3T2MA 3OFNG 2JIZG 2MK3A 3F5WC 2EINB 1ZWIC 3E8GA 4DO2A 3K06A 1RM1B 3E83A 3OMNB 1SZTA 4KFMA 4N21A 3E2EA 2PI5A 3AEIA 5H6QA 2P7TC 3E8FA 3CXCU 5DN6G 5FL7G 4JTCB 4U7NA 2JEXA 4MW8A 1QBZA 3ABKB 4N23A 3K0DA 1V54C 4RAIA 1YI2V 3CYOA 4KUMA 2ZXWC 2WPDG 1K3EA 2C2AA 2AHZA 3ABTA 1K5QA 1EBOA 4F4LA 5CMUA 2DWDC 5CBHA 1NR1A 4P9OA 3P32A 5DM6V 1NKDA 2DW4A 1AI4A 1Y4MA 1KP3A 3IC7A 2Q67A 4MVUA 5L3FA 5LHGA 4WFBV 2QA4V 2D3OW 1NH2D 3WFVA 4X88A 2H8PC 3LNMB 1R6KA 4HYOA 2EBOA 2Z5UA 5EK0A 3FYEB 4WF9V 3WG7B 3E86A 3LSQA 3VOUA 2BOCC 1YIJV 2ZR2A 5LGUA 3ML0A 2ZQMA 1FS0G 1WPXA 2UXNA 3ABUA 3STLC 2Y48A 3D36A 2DWEC 3CPWU 3W7XA 4MW3A 2R9RB 3QNEA 1YJ9V 1JVMA 3SYPA 2IW5A 5H9CA 3JD1A 1NVPB 1MABG 2IJKA 2X7RB 3CCJV 5EBLC 4MTOA 3AG2C 4X89A 4JF3A 1FXKC 2EINC 3ZMTA 3CCLV 3CP1A 2P67A 4JGSA 3ZN1A 1BL8A 3E8BA 1QLNA 3NXSA 5IY5C 1QLEC 2EIKC 3ZRWB 4PDVA 3TK1A 3JD3A 1G8MA 3SJQC 1V54B 2W6IG 2YSUB 4XDJA 2HFEC 2YEVB 1UJWB 1ROPA 1R3JC 2JEUA 3HPLC 4PDMA 5EBWC 1AROP 1R73A 1GK9A 1N8RW 1M57B 2QE7G 1Q82W 5B3SB 1K4CC 3CCRV 3MHHC 1K34A 1K7DA 1QR9A 3AG1B 1VQ5V 3MD0A 1NQTA 2JJ2G 4X8AA 3WG7C 1RM1C 4CBCA 3RVZA 1NJIW 1DF5A 1AI7A 2EZOA 1SESA 1GMGA 2XAFA 2DQ3A 1K97A 4PA6A 4Q20A 2V1DA 3AG3B 3SPHA 3ASOB 2HG5C 2HVJC 1F4NA 2Z3YA 5LHHA 3LDCA 3GB7C 1OCOB 3ZMUA 2EIMC 4EKWA 3AG3C 4PDRA 5J9PC 1VQOV 1YSCA 1QLEB 3G6EV 3GWOA 2NLJC 1W2BU 4WCEV 3JD2A 2GHYA 1E1RG 3SPCA 3G71V 3JD4A 5B1BB 3A0RA 2WLJA 1GM7A 2WLLB 4WFHA 3ABLC 4UVCA 1ORQC 2OCCB 4UUJC 1YJWV 2GSMB 2P6JA 1LNQA 4JASA 1VQ7V 3ETDA 3X2QC 4GX0A 4UV9A 1OCCB 4ZBMA 2DYRB 3G4SV 4GX1A 2X0LA 3SPIA 3LSSA 5H6RA 1AI5A 1GM9A 1OZ0A 1S5HC 2ZDIA 3W7WA 3UKMA 1M56C 3K0GA 4BW5A 2ZDIC 4WFAV 3ASNC 4FIPC 1BMFG 1PKXA 3CC7V 1AJNA 2EIJB 2WSSG 4MVZA 4PA9A 3CCVV 4MSWC 5IYBO 2DQ0A 4R50A 4QPJA 2KB1A 1MG1A 3VBBA 5BZBA 1K8AW 1K9MW 1DTOA 1F23A 2HLDG 2YEVA 1OCZB 2NNUA 2WLKA 3OR6C 3ZCCA 4QNHB 3SYCA 3ZRXA 5E1AC 2QTOA 1KC8W 1W0KG 2XASA 3LDEA 4RUFA 2WLNA 1SETA 1WLEA 4RO2A 1BHBA 2JDIG 1S0VA 2Q69A 1IXMA 1RPOA 1QVGU 2IH3C 3OUSA 1R3KC 1K73W 3ASOC 3K9AA 3RBZA 1NH2B 1E1QG 3FB6C 1KD1W 1M56B 4G27B 1JOYA 3E89A 5KUKA 3FB8C 4MVQA 1VQ6V 3W7SA 3T1CA 1AJPA 3QO7A 3FB7C 2V7QG 3P30A 4GT1A 3ZMZA 3CC4V 4UV8A 3ASNB 3B77A 4QJFB 3BEHA 2PI4A 1KKDA 1H8HG 1H8EG 5EC1C 2AHYA 3CMEV 2H94A 1M57C 1MSWD 1ENVA 3X2QB 3OAAG 1I5YA 1FXKA 5GW7A 3PJSK 3OMAB 4U7OA 1CEZA 5L3EA 5EC2C 5CA3A 2IU3A 4QPKA 5IDJA 2Q6AA 4BIZA 2F43G 4JAUA 1EFRG 3SPGA 5IYDO 3LDDA 1QR8A 1VQ8V 1YTFD 2M7WA 2IJJA 4JAVA 2EJRA 1V55C 5KA6A 4HZ3A 1R3IC 1J95A 5B1AB 2EILB 1W0JG 4MVSA 1K4DC 2HVKC 2WAMA 2QEXV 1S77D 2XAHA 2IJIA 2WLMA 1DLBA 1OCRB 1VQKV 1YHQV 3TETA 4WFGA 4MTXA 5EBMC 1K92A 2IH1C 4WFEA 1SERA 3SYQA 3K08A 1FXVA 3RW0A 5LHIA 2BOBC 2JK5C 3JYCA 2X6AA 4FPPA 4L87A 1Y66A 4LCUC 3F7YC 1K5SA 3UM7A 1BHAA 3B8NA 3K79A 5B1NA 3CCEV 1GTOA 2X6CA 3I56V 1YJNV 1S72V 2EILC 4R7CA 3HB3B 3R65A 4I9WA 1TUEB 2EIKB 3CCMV 4XDLA 4LC1A 1Q81W 5LBQA 1FFTB 1H2GA 2ZR3A 1RPRA 2A79B 2ATKC 4PA7A 2XAGA 4MVRA 3CCQV 3M99B 4ZKIA 2Q68A 3JD0A 1JX9A 2P90A 4PA4A 1PD3A 1I5XA 5CN0A 2DYSC 2W0FC 1P4RA 2XAQA 3DGEA 4JPRA 3SYAA 3MHSC 3T4DA 2A0LA 1B6QA 1PNMA 2WWWA 3OEHG 4GCZA 4RQEA 1Q7YW 3E35A 1Q86W 1VQ4V 3IGAC 4FJCC 4PDLA 5LGTA 1GO3F 4P2ZA 1AI6A 1OCZC 3EFFK 3LUTB 2DYRC 1YITV 2FTKA 2WLIA 1MOFA 3QO5A 3QO8A 4TT3G 3OE7G 4MT8A 4MTGA 4LP8A 4R6ZA 1M9NA 3RVYA 1P7BA 3ABLB 1FXHA 2OCCC 3ZRSA 1NBMG 4MTFA 5B1OA 1JCHA 2B5UA 3TCUA 2JJ1G 2ZD9A 4J9ZB 1VQMV 4OXSA 1HWYA 4XDKA 2X6BA 4BIUA 3CCUV 2R9IA 3K3WA 3ETEA 1JJ2U 3F7VC 3IFXA 2WLIB 3W7UA 5B3SC 1K33A 3OR7C 1QCEA 3EHBB 1KECA 4P30A 5L3BA 1PNKA 2B1IA 5CBFA 1F51A 1FXKB 2UXXA 1F4MA 1NR7A 3CCSV 1H38A 4UVAA 3K04A 3AG4C 5B1AC 1COWG 5IYCO 4MVMA 2W6JG 1S3JA 2Y69B 1DF4A 3ABMB 5LGNA 1OCRC 3ZIAG 4RQFA 2XNDG 4JTAB 1NVPD 2Y69C 3ABMC 4FK5C 2HJFC 2ITDC 2WLLA 4FMTA 5KA5A 3AG1C 1AR1B 1KQSU 4YXWG 4XBFA 1YTFB 2DYSB 4BAYA 1PL0A 1E79G 1OCOC 4JYCA 4DXWA 1JQ0A 2ITCC 4H33A 1G4YB 5HFLA 3SYOA 2HKOA 5IY5B 3FB5C 3CMAV 4ASUG 3OW2U 1S76D 5CBGA 4QIWF 3OGCC 3FYIB 2EZPA 2EIJC 4JYBA 2XOKG 3DTUB 3OEEG 4LBEC 3SPJA 3B8MA 1KP2A 2QM8A 3AG4B 4Z1MG 3ZN0A 4HAMA 2LP7A 3KG2A 2OT5A 5L3CA 3OUFA 2LFSA 1THZA 2WLHA 2OTJV 1JPXA 1M1KW 2EIMB 1SRYA 4MS2A 2ZXWB 3I55V 4UVBA 1R3LC 4I5SA 1GKFA 4PELA 2QKSA 5C93A 2A9HA 2LFRA 4GX5A 1VQLV 3CD6V 4RUEA 1VQNV 3ABKC 3OM3B 4G2KA 1XL4A 1PNLA 1L1FA 4UXNA 3BY6A 4GX2A 3ZRVA 1OHHG 4R8CA 4KP4A 4H37A 2HR3A 1V55B 1CPYA 4QE9A 2XAJA 4G28B 4P9PA 1VQPV 1OCCC 5L3DA 1R6NA 4PA3A 3ZMSA 2QM7A 4WFFA 1VQ9V 1XL6A 3ZMVA 2K1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 V;  1VQO V;  3G6E V;  3CXC U;  1VQM V;  3CCL V;  1VQL V;  1W2B U;  1QVF U;  3CD6 V;  1VQN V;  3CMA V;  4WF9 V;  3CC4 V;  1R73 A;  4WCE V;  4WFA V;  3OW2 U;  1KC8 W;  1N8R W;  3CCE V;  1YI2 V;  1YIJ V;  3I56 V;  3CCU V;  3G71 V;  1YJN V;  1S72 V;  1Q7Y W;  1Q82 W;  1Q86 W;  1JJ2 U;  1VQ4 V;  1VQ8 V;  3CCR V;  3CME V;  3CC7 V;  1QVG U;  2OTL V;  1KQS U;  3CPW U;  1VQP V;  1YIT V;  3CCM V;  1K73 W;  1M90 W;  1VQ5 V;  3CCV V;  2QEX V;  3CC2 V;  1YJ9 V;  1Q81 W;  1NJI W;  1YJW V;  1KD1 W;  1VQK V;  1YHQ V;  5DM6 V;  1VQ7 V;  1K8A W;  1K9M W;  3CCS V;  3CCQ V;  2OTJ V;  1M1K W;  1VQ9 V;  2QA4 V;  3CCJ V;  3G4S V;  4WFB V;  2D3O W;  1VQ6 V; 
#chains in the Genus database with same CATH topology
 3TJT A;  4TWK A;  4BR6 A;  1QVF U;  3DC5 A;  3ZJZ A;  2QM4 A;  3ZRW A;  3W7T A;  5CA1 A;  3AG2 B;  3UQ8 A;  3STZ C;  5LP6 A;  4DV1 B;  2OTL V;  3T4Z A;  4DRX B;  2AGA A;  4X62 O;  3H01 A;  1AJQ A;  2RCV A;  3SR2 C;  2OCH A;  1ZWI C;  4B3S B;  4DO2 A;  3K06 A;  3OMN B;  1SZT A;  4PHZ A;  4N21 A;  3E2E A;  3RWR D;  2PI5 A;  2BCC H;  4NTX A;  3CXC U;  2JEX A;  1QBZ A;  3ABK B;  2QTS A;  2M6Y A;  3ZHQ A;  4FFB B;  1QU7 A;  4KUM A;  1H2K A;  2ZXW C;  4DR6 B;  2G38 A;  4X1Y B;  2C2A A;  2QWR B;  3UT5 A;  2AHZ A;  4LF8 B;  3EVK A;  1EBO A;  1RSO A;  3JAW A;  5JVD B;  4B3T O;  4ABM A;  1Y4M A;  3JCU Z;  5L3F A;  3GVM A;  4ZI7 B;  3WFV A;  2H8P C;  2Y0P A;  1SC5 B;  1XIL A;  5EK0 A;  2ZT9 B;  3WG7 B;  4O4L A;  4NXM O;  2ZR2 A;  2O57 A;  3L72 H;  1FS0 G;  2CDY A;  2EUL A;  1ZTE A;  4ZHQ A;  2DWE C;  3CPW U;  3ZHV A;  3QNE A;  4CS3 A;  3SYP A;  3JD1 A;  1NVP B;  1Q90 D;  4GKJ B;  3IC9 A;  4JZG A;  2KG7 A;  4AQY B;  1Q6U A;  5D5P A;  1MMM A;  5EYP A;  4K8Z A;  2L35 A;  3JAL A;  5IY5 C;  4ZIB A;  3ZRW B;  2R70 A;  2HHH B;  4DR7 B;  5LYJ B;  4I0X A;  2YI8 A;  2YEV B;  2CTW A;  2JEU A;  3RYC B;  1KMI Z;  5IYZ B;  5EBW C;  1ARO P;  1BSM A;  2FL4 A;  4YHH O;  2LGW A;  1NZ6 A;  5BY1 A;  1NQT A;  1BZK A;  4CBC A;  1NJI W;  1AI7 A;  4PA6 A;  1K97 A;  2HVJ C;  5J9P C;  1VQO V;  3G6E V;  1QLE B;  4HBN A;  3GWO A;  2NLJ C;  2KSD A;  5LMN B;  2GHY A;  2YUA A;  4X66 O;  3BCC H;  3TGU H;  3A0R A;  1XMO O;  2WLL B;  2ZIO A;  3ABL C;  1ORQ C;  2VRZ A;  4NB5 A;  1N32 O;  1VQ7 V;  3ETD A;  1M5I A;  4GX0 A;  4ZBM A;  4O2B A;  3LSS A;  5A9G A;  4LFA B;  1GM9 A;  3H9V A;  3W7W A;  1M56 C;  2KQX A;  2ZDI C;  4W4K A;  3U11 A;  1X59 A;  2VWK A;  5EYP B;  4H13 B;  3M7M X;  4DR2 O;  4LFB O;  3OGI B;  4QPJ A;  4EEQ A;  5BZB A;  5LOV A;  4J41 A;  3IJ4 A;  2OYQ A;  4X66 B;  1OCZ B;  1PL4 A;  2YEV A;  5TIS Z;  2QJ1 A;  4UCO A;  2QTO A;  1W0K G;  2XAS A;  2PF4 E;  2W0X A;  1Y74 B;  1WLE A;  4RO2 A;  5J2U A;  1S0V A;  2Q69 A;  1RPO A;  4PI0 A;  3OD4 A;  2R9A A;  4KHP O;  3RBZ A;  2ZE6 A;  1YZB A;  5JH7 A;  3ICX A;  5LMN O;  1M56 B;  4G27 B;  4I50 B;  1JOY A;  5KUK A;  1VQ6 V;  2UUA O;  3W7S A;  2DJV A;  3BAA A;  4GT1 A;  3ZMZ A;  3CC4 V;  4UV8 A;  3ASN B;  3LNN A;  2PI4 A;  2ZE8 A;  2AHY A;  3QF7 A;  4X20 B;  2H94 A;  4YY3 B;  3H1I H;  1ZSP A;  1ZUQ A;  3Q4H A;  4I50 A;  3OMA B;  4YJ3 B;  1I7F A;  5CA3 A;  5KHG A;  1P7G A;  4LF9 O;  1EFR G;  3SPG A;  4AQY O;  3LDD A;  3D8C A;  1QR8 A;  3L70 H;  1CXZ B;  4JAV A;  4HZ3 A;  1VMG A;  1I0H A;  4MVS A;  4U3J A;  1XHX A;  1Y76 B;  2IJI A;  2P06 A;  5CB4 B;  2WLM A;  1OCR B;  1VQK V;  3DXR A;  2IH1 C;  4WFE A;  2CAZ C;  3K08 A;  4ICG A;  3O9O A;  2X6A A;  1M93 A;  4FPP A;  1Y66 A;  2P22 C;  4L87 A;  4GKJ O;  1BHA A;  2ZE5 A;  1GN4 A;  4HNA B;  5B1N A;  2X6C A;  2A06 H;  3R65 A;  1SQX H;  2Q7G A;  5IJ0 A;  4GUN A;  4NR1 A;  4UFZ A;  1GN6 A;  2KKW A;  2F4V O;  2ATK C;  3CHX A;  1TGO A;  1HNX B;  2EJ7 A;  2XAG A;  4MVR A;  3CCQ V;  1J5E B;  1NTM H;  2ADQ B;  4NVP A;  1XEQ A;  2DYS C;  5IJ9 A;  2W0F C;  3T4D A;  2XAQ A;  3DGE A;  4JPR A;  3SYA A;  3OEH G;  1JR9 A;  4RQE A;  3E35 A;  3JAR A;  1Q86 W;  3IGA C;  1VF7 A;  1GO3 F;  2LO1 A;  1AI6 A;  1HW7 A;  2FTK A;  4X1I B;  1AVM A;  4B3R B;  1EN4 A;  3APO A;  4LP8 A;  1M9N A;  2QWO B;  3RYI B;  3RN4 A;  4D6T H;  1JCH A;  2B5U A;  2ZD9 A;  4OPH A;  4J9Z B;  2ZNJ A;  1Y6X A;  1HWY A;  1PM9 A;  2X6B A;  4BIU A;  4O2A A;  3G80 A;  4J7K A;  4CC6 A;  3F7V C;  3MAQ A;  1H2L A;  4FLY A;  5H2F Z;  1Z2G A;  3OR7 C;  2YS8 A;  1QCE A;  1KEC A;  4P30 A;  1PNK A;  1FXK B;  1H38 A;  3BVO A;  4UVA A;  3AG4 C;  4EFB A;  1COW G;  3L71 H;  2UXC B;  3ZIA G;  4RQF A;  1N33 B;  3ABM C;  4B3R O;  2ITD C;  4FMT A;  1L8D A;  1AR1 B;  1TA8 A;  1D5N A;  3BRC A;  5KX5 A;  4RWU A;  1YTF B;  5IJ0 B;  4CH4 A;  1OCO C;  4JV5 B;  4H33 A;  5HFL A;  2VS0 A;  2RJZ A;  5ITZ B;  5IY5 B;  3FB5 C;  3CB2 A;  3CMA V;  2F4V B;  3FYI B;  3WB0 A;  3J7A U;  2EIJ C;  4JYB A;  5FNV B;  3SPJ A;  2XOK G;  1I94 O;  3CX5 F;  2QGN A;  1XOU A;  4DV7 O;  2A3Q A;  1KB9 F;  3VQX A;  3HKC B;  5L3C A;  2LFS A;  2OTJ V;  1KYO F;  3I55 V;  4O4L B;  1GKF A;  4E4E A;  3K58 A;  1VQN V;  3G6B A;  1XNQ B;  4G2K A;  2ZNI A;  5LA6 A;  3BY6 A;  4GX2 A;  1OHH G;  4H37 A;  2HR3 A;  4UB8 Z;  4JI0 B;  1CPY A;  4K0K O;  2E74 B;  5L3D A;  4DR3 O;  5IE9 A;  5IT9 N;  4I0X B;  2Y4U A;  3QTC A;  1QNM A;  4YY3 O;  3K5L A;  1XL6 A;  2IU0 A;  2CGN A;  3ZHU A;  5LA6 B;  5B1B C;  3JAL B;  3K5N A;  4IIJ B;  5KUM A;  5BXZ A;  3HKD B;  3ETG A;  3E8H A;  1NTZ H;  4GKK B;  4U3F H;  4IT5 A;  4TSF G;  3FKS G;  4CZZ A;  2ZIM A;  1M90 W;  1TUB B;  3K03 A;  3THO A;  2JIZ G;  3UT5 B;  3ZX6 A;  4KHP B;  2JS3 A;  1GH6 A;  1Q6H A;  1S5J A;  3E8G A;  1RM1 B;  2IM9 A;  5KHI A;  5H6Q A;  3L74 H;  2P7T C;  5FL7 G;  3LSU A;  4MW8 A;  2CUG A;  4N23 A;  4UCR A;  5BMV B;  4RAI A;  1EN5 A;  3CYO A;  4DW0 A;  2WPD G;  3MDS A;  4NTY A;  1K5Q A;  4P9O A;  3P3P A;  1RFY A;  1KP3 A;  1HR0 O;  3HKC A;  3JAT A;  4PV1 B;  4X88 A;  1R6K A;  3BA9 A;  3VOU A;  4YIO A;  4CH3 A;  2ZQM A;  1WPX A;  2UXN A;  3ABU A;  4AHC A;  4MW3 A;  1WP8 A;  2MW2 B;  3O65 A;  1YJ9 V;  2PUS A;  1JVM A;  3GWK C;  3WU2 Z;  2YIB A;  1GAX A;  3CCJ V;  5EBL C;  4MTO A;  3AG2 C;  4X89 A;  1AIL A;  1IDS A;  1FXK C;  1G1X B;  1HR0 B;  4PJ0 Z;  2ODM A;  1P49 A;  2ZM6 O;  2P67 A;  3ZN1 A;  3E8B A;  3JAM N;  3NXS A;  5JJJ B;  2ZKO A;  4LF8 O;  4DK0 A;  4PDV A;  1LUW A;  1G8M A;  1V54 B;  2YSU B;  4J80 A;  2HFE C;  4DV2 B;  1BQ0 A;  3H1J H;  3F5T A;  4YHH B;  2JRI A;  4LH6 A;  2UXC O;  1ZL8 B;  3A0B Z;  2UUC B;  4NXN B;  1GK9 A;  5JJN B;  1H2M A;  1IBM B;  4DV6 O;  1K7D A;  2QKA A;  4DR7 O;  2FYU H;  1TVK B;  2EZO A;  2GTA A;  2XAF A;  2DQ3 A;  2A7W A;  2PZS A;  3ZMU A;  1SQB H;  3M8A A;  4EKW A;  1YSC A;  4O4J B;  1W2B U;  1SKV A;  1FFX B;  3SPC A;  4WBN A;  3JD4 A;  1GM7 A;  4JI6 O;  3OT7 A;  4JI8 O;  4UVC A;  2OCC B;  4JI0 O;  2AZ0 A;  2UXB O;  2GSM B;  4KL1 A;  4JAS A;  3A2F A;  5B66 Z;  4LFC O;  2E5L B;  4UV9 A;  1OCC B;  4K3A A;  2DYR B;  3FAV A;  3SPI A;  1OZ0 A;  4B3M O;  3UKM A;  3OTO O;  4BW5 A;  4IHJ A;  5B5E Z;  1J5E O;  2NN4 A;  3ASN C;  4FIP C;  4J7J A;  1BMF G;  1UPG A;  1AJN A;  2EIJ B;  3CCV V;  2GBO A;  5IYB O;  2DQ0 A;  1SQP H;  2KB1 A;  1K8A W;  1K9M W;  1VAR A;  2NNU A;  4O4H B;  4QNH B;  4JV5 O;  1KC8 W;  3AK2 A;  2WLN A;  1SET A;  2B9Z A;  2JDI G;  3SJB C;  3CRQ A;  2IH3 C;  3EXA A;  3OUS A;  3UCS C;  3K9A A;  1E1Q G;  2JGD B;  3FB6 C;  4JI5 O;  4X65 O;  2PY5 A;  3L73 H;  3T1C A;  1AR4 A;  3FB7 C;  4FZ0 A;  3CE2 A;  5CA1 B;  3B77 A;  2UU9 B;  2QDO A;  4QJF B;  1D5A A;  3BEH A;  1H8H G;  4X65 B;  1SA0 B;  1KUQ A;  4WBN B;  5LP6 B;  4TQF A;  5LMU B;  3OAA G;  5JWP A;  1FXK A;  3ZED A;  3CWB H;  3PJS K;  3KCY A;  3KKY A;  3RT3 C;  2L6L A;  2RQ6 A;  3DXR B;  4QPK A;  4BIZ A;  2UUA B;  2F43 G;  4JI4 O;  4JAU A;  1T5E A;  2YIA A;  4JI5 B;  1YTF D;  2EJR A;  4IHJ B;  1V55 C;  4TOI A;  1J95 A;  5B1A B;  1K4D C;  3D36 C;  2FB5 A;  3G67 A;  2QEX V;  3JAS B;  5A2Q N;  1DLB A;  3K59 A;  1G6U A;  3H1K H;  4MTX A;  1XNR B;  5EBM C;  1D2D A;  1K92 A;  3SYQ A;  1WPB A;  2JK5 C;  3JYC A;  2UUB B;  5GON B;  1YJN V;  4JI7 B;  3I56 V;  1S72 V;  2XUM A;  4ZHQ B;  4I9W A;  1TUE B;  3N27 A;  4DV5 B;  1FKA O;  2ZR3 A;  3VQV A;  4F6R A;  1XMQ O;  4PA7 A;  1NU1 H;  4W4L A;  4ZKI A;  5KHH A;  5EIB D;  1I5X A;  1IVS A;  1AP5 A;  3MHS C;  1PNM A;  4GCZ A;  3R66 A;  1AP6 A;  4NTW A;  5KAF Z;  4P2Z A;  3EFF K;  1OCZ C;  3LUT B;  4JI6 B;  2P4V A;  5LYJ A;  1MOF A;  3QO5 A;  2CH7 B;  4MTG A;  4R6Z A;  1BCC H;  1P7B A;  1VEW A;  4NYK A;  3B40 A;  2VQE O;  3RYC A;  1SQF A;  4OXS A;  2CGO A;  4XDK A;  1S5L Z;  3CCU V;  5LL6 Y;  1OJH A;  2VWJ A;  1JJ2 U;  3BAB A;  3IFX A;  4FFK A;  5JQG B;  1QQC A;  3AG7 A;  4IYH A;  3EHB B;  1NR7 A;  3CCS V;  4DR4 B;  5B1A C;  5IYC O;  2YXH A;  3ABM B;  1DF4 A;  5LGN A;  4JI1 B;  4DV2 O;  2XND G;  4JTA B;  5ITZ A;  5JQG A;  2WLL A;  3AG1 C;  4XBF A;  3UO3 A;  4I55 A;  1RP3 B;  2EX3 A;  3T1Y B;  4FLW A;  1JQ0 A;  1G4Y B;  4LH7 A;  4AI8 A;  4DR1 B;  3BHP A;  4ASU G;  4CS2 A;  4FLU A;  4LBE C;  1VIB A;  3U0Z A;  3B8M A;  2ILM A;  1YCI A;  2CTQ A;  1KP2 A;  2Y4T A;  4I9Q A;  5GTI Z;  4A5U B;  4D7T A;  5KLV H;  2BE3 A;  1SRY A;  1WJZ A;  2BSK B;  4IGG A;  5C93 A;  2QKS A;  1SS3 A;  2Q0O C;  4GX5 A;  2YI9 A;  2YDE A;  3OM3 B;  1L1F A;  4R8C A;  3E22 A;  1Y74 A;  1V55 B;  4G28 B;  4DR5 B;  1VQP V;  3CRR A;  4BW9 A;  3N2G B;  2ZE7 A;  4PA3 A;  1IBK B;  5JH7 B;  4OPA A;  4WFF A;  1Q3E A;  2Q5Z A;  3FFQ A;  2CE4 A;  2F93 B;  3D3I A;  5HFM A;  4E2L A;  1XHZ A;  4JTD B;  5L3G A;  3CC2 V;  3SJA C;  4QE7 A;  1CP9 A;  4X20 A;  2Q9L A;  2CK3 G;  4DV0 O;  4MVO A;  3OFN G;  1PP9 H;  2EIN B;  4DR5 O;  2DE0 X;  3BPZ A;  3E83 A;  2RN9 A;  4JTC B;  5H5N A;  5EZY A;  1V54 C;  1YI2 V;  1K3E A;  4EFE A;  4F4L A;  1BQZ A;  5DED A;  4DV3 B;  5CBH A;  2DMX A;  1NR1 A;  1NKD A;  3TXQ A;  3RYF A;  1AI4 A;  3ZS8 C;  5FLX N;  3IAY A;  2Q67 A;  4MVU A;  5LHG A;  4JI2 O;  4WFB V;  4OX9 O;  1NH2 D;  4JI7 O;  3LNM B;  4HYO A;  1VF6 A;  5KMG B;  2Z5U A;  1Q5O A;  4WF9 V;  1BGY H;  3E86 A;  3C3S A;  1U96 A;  2Y0I A;  1YIJ V;  5LGU A;  2K9P A;  3ML0 A;  5CA0 A;  3D36 A;  2R9R B;  4JI3 B;  4Z2W A;  3T1H O;  1MAB G;  4I7Z B;  4UCT A;  4BIO A;  4O4H A;  2X7R B;  2P5O A;  1VF5 B;  1V9P A;  4JF3 A;  1LR1 A;  3CCL V;  1IUR A;  3JAR B;  1ZL8 A;  1QLN A;  4B3T B;  2OIG A;  1QLE C;  2EIK C;  4X1K B;  1HNW B;  1O9G A;  4LF7 O;  4JYY A;  1W59 A;  2FKX A;  3SJQ C;  1FJG B;  2WA3 A;  4LF6 B;  1H2S B;  3HKE B;  1ROP A;  4PDM A;  3JSL A;  1PV0 A;  5GTH Z;  4O2A B;  4EB6 A;  4O4J A;  2VQE B;  1N8R W;  1U97 A;  1JJO A;  1Q82 W;  1K4C C;  1R1B A;  1QR9 A;  1Q8I A;  3MD0 A;  1FD9 A;  4X8A A;  2Q0A A;  3RVZ A;  1DF5 A;  1SES A;  1GMG A;  4YJ3 A;  1NTK H;  1YVW A;  2V1D A;  4JAA A;  3ASO B;  2VQF O;  2HG5 C;  2Z3Y A;  1F4N A;  1NT2 B;  5LHH A;  3LDC A;  5J2T B;  1OCO B;  3CRM A;  3AG3 C;  1A32 A;  2E76 B;  4WCE V;  3JD2 A;  1MNG A;  3J81 N;  4O4I B;  3G71 V;  1X4T A;  5B1B B;  2Z0A A;  1HNX O;  4WFH A;  4JI3 O;  1ZX3 A;  5CB4 A;  1MA1 A;  1B3Q A;  4IL6 Z;  4GX1 A;  2X0L A;  5H6R A;  4TUY B;  3D3Q A;  1GN2 A;  3SJC C;  2RNB A;  2F66 C;  4DYL A;  4LR3 A;  3JSN A;  1PKX A;  3CC7 V;  1H2N A;  4MVZ A;  4PA9 A;  4X1K A;  4MSW C;  3C90 A;  2N74 A;  3VBB A;  2XTA A;  2PGG A;  1DTO A;  1NI8 A;  4B3M B;  3ZCC A;  2HLD G;  3H1H H;  3OR6 C;  1KBH A;  2DN9 A;  1JA8 A;  3K9S A;  3K5O A;  4JI2 B;  3WB2 A;  1OV9 A;  4OX9 B;  1N33 O;  5JCO A;  5E1A C;  2ZIN A;  1FPO A;  1HP8 A;  2VQF B;  1IXM A;  4D7S A;  1R3K C;  4LWS B;  1NH2 B;  1KD1 W;  1FAF A;  3CJH A;  2LQT A;  3FB8 C;  2OIE A;  1DGS A;  2AW9 A;  1AJP A;  3QO7 A;  5FPR A;  4Z1V A;  3B4S A;  1H8E G;  3N2K B;  5EC1 C;  3CME V;  3ZHT A;  2H3O A;  3B09 A;  1ENV A;  3X2Q B;  1I5Y A;  1TUB A;  4TQD A;  5LXT A;  1CEZ A;  5EC2 C;  4IYI A;  3K5M A;  4FVM A;  5BMV A;  1YEW A;  3N2K A;  3DC6 A;  4ZOL B;  1Y67 A;  2M7W A;  4DUY B;  5KA6 A;  1R3I C;  2EIL B;  1W0J G;  3QVN A;  5F2V O;  2WAM A;  4B08 A;  4LF4 O;  1S77 D;  1HNW O;  5LXT B;  3RFR A;  1L0L H;  5JVD A;  3TET A;  4I4T A;  2ZM6 B;  4ZI7 A;  1SER A;  1FXV A;  3RW0 A;  5LHI A;  2YC0 A;  4JYA O;  1YXB A;  3ZHR A;  1MZE A;  3CSX A;  4ZOL A;  2F1M A;  3OTO B;  3F7Y C;  3T1H B;  1K5S A;  3UM7 A;  3KZI Z;  4LFA O;  3K79 A;  3ZHS A;  2AXT Z;  2EIL C;  1IBL B;  4R7C A;  3HB3 B;  1XI1 A;  1XUQ A;  1URF A;  4YJ2 B;  2QSA A;  5LBQ A;  1FFT B;  1H2G A;  1RPR A;  2Q68 A;  3JD0 A;  4PA4 A;  2QWN B;  1AB3 A;  2AZ2 A;  5CN0 A;  2IBZ H;  1P4R A;  2A0L A;  1B6Q A;  2WWW A;  5LP6 C;  4FJC C;  4PDL A;  2WLI A;  4DW1 A;  4DUY O;  4TT3 G;  1BS3 A;  3OE7 G;  4MT8 A;  4DV0 B;  3RVY A;  3ABL B;  4JI1 O;  1FXH A;  3ZRS A;  4NXN O;  1SQV H;  4IIJ A;  1XRE A;  1WN7 A;  4UCS A;  1Z5V A;  2WLI B;  3W7U A;  4J10 A;  1K33 A;  3SGI A;  1BT8 A;  1PPJ H;  2B1I A;  5CBF A;  2UXX A;  1TVK A;  3SDL A;  4F6E A;  3K04 A;  2HJD A;  1XBL A;  4H44 B;  2W6J G;  4MVM A;  1B06 A;  1XNQ O;  2Y69 B;  1FFX A;  1OCR C;  2ETN A;  1UFI A;  2YXL A;  2UXD B;  2HJF C;  1N4C A;  2QWQ B;  1NS1 A;  3I5D A;  2QWP B;  3RYF B;  2JGU A;  2E3C A;  2Q7E A;  4JYC A;  4X64 B;  3RGB A;  3SYO A;  4FLX A;  2XT9 A;  4DR1 O;  2UUB O;  1WA8 A;  3OW2 U;  1F7Y A;  3OGC C;  3KCX A;  4DUZ O;  1LUV A;  2EZP A;  4Q6G A;  2FML A;  3E22 B;  4DV5 O;  2QM8 A;  3AG4 B;  4Z1M G;  1IBL O;  4OGQ B;  3P3N A;  3ZN0 A;  1Q6I A;  2LP7 A;  3S3W A;  5C8Y B;  4LF5 B;  1YDX A;  2WLH A;  1DK1 A;  2EIM B;  3OTF A;  2ZXW B;  4UVB A;  1WA8 B;  4I5S A;  2YIB D;  2A9H A;  2LW1 A;  5K1X A;  1WB8 A;  3CD6 V;  3ABK C;  1N0J A;  3CRC A;  3ZRV A;  1TAE A;  1Z5W A;  4LNU A;  5KHJ A;  2WA4 A;  2XAJ A;  4P9P A;  1OCC C;  4DR6 O;  4X1I A;  3ZMS A;  1L0N H;  1VQ9 V;  3ZMV A;  1QHT A;  3OMI B;  2IJH A;  4EB6 B;  1GM8 A;  2B1G A;  1EZJ A;  2F23 A;  4J9Y B;  5EZY B;  1VP7 A;  1M4U A;  1SA0 A;  1HNZ B;  3JCZ A;  4X62 B;  1MSD A;  2HEP A;  3A8T A;  1SQG A;  4PI2 A;  3T2M A;  4FZ1 A;  2MK3 A;  3F5W C;  2UU9 O;  3UO2 A;  2XHB A;  1VF6 C;  4KFM A;  3AEI A;  4CH5 A;  5JJE B;  4GZR B;  3E8F A;  1N34 B;  5DN6 G;  5K1P A;  1JMK C;  4U7N A;  4L8J A;  2PYJ A;  3B2E E;  3K0D A;  5KMG A;  5EIB C;  4KXR A;  4J7Z A;  5AG2 A;  1SQQ H;  4U3J B;  3ABT A;  3APQ A;  5CMU A;  2DWD C;  5KX5 B;  3P32 A;  5DM6 V;  4PD4 F;  4K35 A;  2DW4 A;  3IC7 A;  1WP7 A;  2QA4 V;  2D3O W;  2GTS A;  2V4D A;  4TUY A;  1WNS A;  2EBO A;  4FFB A;  2R72 A;  5JCO C;  3FYE B;  3LSQ A;  2BOC C;  4DK1 A;  3STL C;  2Y48 A;  4LNU B;  3W7X A;  5FPO A;  2LJ2 A;  2IW5 A;  4DUZ B;  2GDS A;  4F6R B;  5H9C A;  2IJK A;  1AR5 A;  1Q43 A;  2EIN C;  3ZMT A;  3CP1 A;  1N34 O;  4JGS A;  1BL8 A;  2UXB B;  3CS5 A;  4CC5 A;  3TK1 A;  3JD3 A;  2W6I G;  4XDJ A;  2UXD O;  3NR7 A;  1HNZ O;  1UJW B;  1R3J C;  4JI4 B;  3HPL C;  1P84 F;  4GLX A;  3J80 N;  1R73 A;  1M57 B;  5BR8 B;  2QE7 G;  2BTQ B;  5B3S B;  2YXY A;  3MHH C;  3CCR V;  1K34 A;  3AG1 B;  4UCV A;  1VQ5 V;  4FM2 A;  2JJ2 G;  1ZAU A;  3WG7 C;  1RM1 C;  1IBM O;  3AK1 A;  4Q20 A;  3AG3 B;  3SPH A;  2UUC O;  5IYZ A;  3GB7 C;  2EIM C;  4PDR A;  4QGP A;  4FLV A;  2BTQ A;  3PN1 A;  1E1R G;  1FJG O;  2WLJ A;  1ZLZ A;  5KHK A;  4X1Y A;  3U10 A;  4J42 A;  4LF7 B;  1XDC A;  4UUJ C;  4I55 B;  1YJW V;  2P6J A;  3JAW B;  1LNQ A;  1R6T A;  4JZ2 A;  3C3T A;  3X2Q C;  2YIC A;  2PYL A;  1I08 A;  3G4S V;  3JAK A;  2ZCE A;  1AI5 A;  1S5H C;  2ZDI A;  3K0G A;  4WFA V;  2ARH A;  4LF5 O;  4FM0 A;  4X64 O;  1O9H A;  1N36 O;  4DR2 B;  5FNV A;  5IWA B;  2WSS G;  2N04 A;  3FD9 A;  4R50 A;  1MG1 A;  4JI8 B;  1F23 A;  2WLK A;  4CS4 A;  2CTP A;  3SYC A;  1B04 A;  3ZRX A;  3FX7 A;  2E5L O;  2DOS A;  3HKB B;  4LFC B;  3LDE A;  4RUF A;  1BHB A;  3AK3 A;  4YJ2 A;  1WAZ A;  1QVG U;  1K73 W;  3N2G A;  3ASO C;  1XMO B;  3BFR A;  2GUZ A;  2CH7 A;  2N05 A;  4K8X A;  2F95 B;  4TV8 B;  4BWA A;  3E89 A;  4FLT A;  3ETQ A;  4MVQ A;  3HKB A;  1US6 A;  2V7Q G;  3P30 A;  2PTM A;  1WB7 A;  2Q4P A;  3BA8 A;  3K57 A;  1KKD A;  2GV9 A;  4B7E A;  3S3X A;  3HKD A;  2BTO A;  4DV4 O;  1IBK O;  1M57 C;  1MSW D;  2LW7 A;  4TV8 A;  1GRJ A;  2Q73 A;  4DV6 B;  5GW7 A;  4U7O A;  5L3E A;  4TV9 B;  4I4T B;  2IU3 A;  5IDJ A;  2Q6A A;  1IXB A;  3WB1 A;  5IYD O;  3JAK B;  1FYJ A;  4GYC B;  4X9Q A;  1VQ8 V;  4CH6 A;  2IJJ A;  2HHH O;  1YF2 A;  2HVK C;  3L9D A;  4K0K B;  2XAH A;  4LFB B;  4DV7 B;  2RDC A;  1SZX A;  1YHQ V;  4WFG A;  1N36 B;  1I94 B;  3JAT B;  5LOV B;  2BOB C;  3QG5 A;  1SF9 A;  4O2B B;  2ADP A;  4LCU C;  2Q8V A;  3B8N A;  2E75 B;  3CCE V;  1GTO A;  4B7K A;  2HP8 A;  3L75 H;  1Y76 A;  4FLZ A;  5CA0 B;  2EIK B;  1N32 B;  5J2U B;  3CCM V;  4XDL A;  4LC1 A;  1Q81 W;  2JS5 A;  5C8Y A;  2A79 B;  4C7U A;  4NXM B;  2GUZ B;  3M99 B;  1IZ3 A;  2BSK A;  5E79 Z;  1JX9 A;  2P90 A;  1PD3 A;  4UB6 Z;  4JYA B;  3ZBH A;  3T1Y O;  1IX9 A;  4YIP A;  1EZV H;  3RYH A;  1Q7Y W;  1VQ4 V;  3CXH F;  5LGT A;  4DR4 O;  5D5Q A;  4LF4 B;  2DYR C;  1YIT V;  4B3S O;  3QO8 A;  3Q4H B;  4DV4 B;  2OCC C;  3HKE A;  5IJ9 B;  4AIL C;  1HDJ A;  1NBM G;  4MTF A;  5B1O A;  3HR0 A;  3TCU A;  2JJ1 G;  4FM1 A;  3RYH B;  1VQM V;  4TV9 A;  2R9I A;  3K3W A;  3ETE A;  1GN3 A;  5B3S C;  5DEC A;  5L3B A;  4DR3 B;  4GKK O;  5BR8 O;  2RMK B;  1F51 A;  1F4M A;  3RYI A;  4NKG B;  5J2T A;  2P4K A;  1MZF A;  3VQW A;  1S3J A;  2YID A;  1N0N A;  1NVP D;  2Y69 C;  4LF6 O;  4FK5 C;  3TXS A;  3CRA A;  5KA5 A;  4O4I A;  2Q7H A;  4HNA A;  1KQS U;  2OWO A;  4YXW G;  1EM1 A;  3JAS A;  5KAI Z;  2DYS B;  2QR4 A;  5IWA O;  4BAY A;  1PL0 A;  2JVD A;  1E79 G;  3FAV B;  4DXW A;  2ITC C;  2D2C B;  1XQ8 A;  2HKO A;  2CTR A;  1S76 D;  5CBG A;  4QIW F;  5GON A;  2NR5 A;  1XMQ B;  3DSQ A;  3OEE G;  3DTU B;  1RSO B;  1KKC A;  3A0H Z;  3H1L H;  4HAM A;  1KU9 A;  1BE3 H;  2OT5 A;  3KG2 A;  3OUF A;  1EN6 A;  1THZ A;  1JPX A;  1M1K W;  4J11 A;  4MS2 A;  3VQY A;  1R3L C;  4PEL A;  1JFF A;  2LFR A;  1VQL V;  4H0L B;  4RUE A;  1XNR O;  1XL4 A;  1PNL A;  4UXN A;  3CEI A;  4KP4 A;  4DV3 O;  4UCU A;  4LWS A;  4QE9 A;  2JGD A;  5LMU O;  4DRX A;  2LGQ A;  1R6N A;  4DV1 O;  2KG7 B;  2QM7 A;  3CJH B;  1JFF B;  2K1E A;  4LF9 B;  2QKC A; 
#chains in the Genus database with same CATH homology
 3D3I A;  2IU0 A;  3OMI B;  2IJH A;  4TWK A;  5B1B C;  5HFM A;  1QVF U;  3ZJZ A;  5KUM A;  4E2L A;  1GM8 A;  2B1G A;  4JTD B;  3ZRW A;  3W7T A;  5L3G A;  1EZJ A;  3CC2 V;  3AG2 B;  3ETG A;  3E8H A;  4QE7 A;  1CP9 A;  4J9Y B;  4TSF G;  3STZ C;  3JCZ A;  2OTL V;  2CK3 G;  3FKS G;  4CZZ A;  3T4Z A;  1M90 W;  3H01 A;  1AJQ A;  3K03 A;  4MVO A;  3T2M A;  3OFN G;  2JIZ G;  2MK3 A;  3F5W C;  2EIN B;  1ZWI C;  3E8G A;  4DO2 A;  3K06 A;  1RM1 B;  3E83 A;  3OMN B;  1SZT A;  4KFM A;  4N21 A;  3E2E A;  2PI5 A;  3AEI A;  5H6Q A;  2P7T C;  3E8F A;  3CXC U;  5DN6 G;  5FL7 G;  4JTC B;  4U7N A;  2JEX A;  4MW8 A;  1QBZ A;  3ABK B;  4N23 A;  3K0D A;  1V54 C;  4RAI A;  1YI2 V;  3CYO A;  4KUM A;  2ZXW C;  2WPD G;  1K3E A;  2C2A A;  2AHZ A;  3ABT A;  1K5Q A;  1EBO A;  4F4L A;  5CMU A;  2DWD C;  5CBH A;  1NR1 A;  4P9O A;  3P32 A;  5DM6 V;  1NKD A;  2DW4 A;  1AI4 A;  1Y4M A;  1KP3 A;  3IC7 A;  2Q67 A;  4MVU A;  5L3F A;  5LHG A;  4WFB V;  2QA4 V;  2D3O W;  1NH2 D;  3WFV A;  4X88 A;  2H8P C;  3LNM B;  1R6K A;  4HYO A;  2EBO A;  2Z5U A;  5EK0 A;  3FYE B;  4WF9 V;  3WG7 B;  3E86 A;  3LSQ A;  3VOU A;  2BOC C;  1YIJ V;  2ZR2 A;  5LGU A;  3ML0 A;  2ZQM A;  1FS0 G;  1WPX A;  2UXN A;  3ABU A;  3STL C;  2Y48 A;  3D36 A;  2DWE C;  3CPW U;  3W7X A;  4MW3 A;  2R9R B;  3QNE A;  1YJ9 V;  1JVM A;  3SYP A;  2IW5 A;  5H9C A;  3JD1 A;  1NVP B;  1MAB G;  2IJK A;  2X7R B;  3CCJ V;  5EBL C;  4MTO A;  3AG2 C;  4X89 A;  4JF3 A;  1FXK C;  2EIN C;  3ZMT A;  3CCL V;  3CP1 A;  2P67 A;  4JGS A;  3ZN1 A;  1BL8 A;  3E8B A;  1QLN A;  3NXS A;  5IY5 C;  1QLE C;  2EIK C;  3ZRW B;  4PDV A;  3TK1 A;  3JD3 A;  1G8M A;  3SJQ C;  1V54 B;  2W6I G;  2YSU B;  4XDJ A;  2HFE C;  2YEV B;  1UJW B;  1ROP A;  1R3J C;  2JEU A;  3HPL C;  4PDM A;  5EBW C;  1ARO P;  1R73 A;  1GK9 A;  1N8R W;  1M57 B;  2QE7 G;  1Q82 W;  5B3S B;  1K4C C;  3CCR V;  3MHH C;  1K34 A;  1K7D A;  1QR9 A;  3AG1 B;  1VQ5 V;  3MD0 A;  1NQT A;  2JJ2 G;  4X8A A;  3WG7 C;  1RM1 C;  4CBC A;  3RVZ A;  1NJI W;  1DF5 A;  1AI7 A;  2EZO A;  1SES A;  1GMG A;  2XAF A;  2DQ3 A;  1K97 A;  4PA6 A;  4Q20 A;  2V1D A;  3AG3 B;  3SPH A;  3ASO B;  2HG5 C;  2HVJ C;  1F4N A;  2Z3Y A;  5LHH A;  3LDC A;  3GB7 C;  1OCO B;  3ZMU A;  2EIM C;  4EKW A;  3AG3 C;  4PDR A;  5J9P C;  1VQO V;  1YSC A;  1QLE B;  3G6E V;  3GWO A;  2NLJ C;  1W2B U;  4WCE V;  3JD2 A;  2GHY A;  1E1R G;  3SPC A;  3G71 V;  3JD4 A;  5B1B B;  3A0R A;  2WLJ A;  1GM7 A;  2WLL B;  4WFH A;  3ABL C;  4UVC A;  1ORQ C;  2OCC B;  4UUJ C;  1YJW V;  2GSM B;  2P6J A;  1LNQ A;  4JAS A;  1VQ7 V;  3ETD A;  3X2Q C;  4GX0 A;  4UV9 A;  1OCC B;  4ZBM A;  2DYR B;  3G4S V;  4GX1 A;  2X0L A;  3SPI A;  3LSS A;  5H6R A;  1AI5 A;  1GM9 A;  1OZ0 A;  1S5H C;  2ZDI A;  3W7W A;  3UKM A;  1M56 C;  3K0G A;  4BW5 A;  2ZDI C;  4WFA V;  3ASN C;  4FIP C;  1BMF G;  1PKX A;  3CC7 V;  1AJN A;  2EIJ B;  2WSS G;  4MVZ A;  4PA9 A;  3CCV V;  4MSW C;  5IYB O;  2DQ0 A;  4R50 A;  4QPJ A;  2KB1 A;  1MG1 A;  3VBB A;  5BZB A;  1K8A W;  1K9M W;  1DTO A;  1F23 A;  2HLD G;  2YEV A;  1OCZ B;  2NNU A;  2WLK A;  3OR6 C;  3ZCC A;  4QNH B;  3SYC A;  3ZRX A;  5E1A C;  2QTO A;  1KC8 W;  1W0K G;  2XAS A;  3LDE A;  4RUF A;  2WLN A;  1SET A;  1WLE A;  4RO2 A;  1BHB A;  2JDI G;  1S0V A;  2Q69 A;  1IXM A;  1RPO A;  1QVG U;  2IH3 C;  3OUS A;  1R3K C;  1K73 W;  3ASO C;  3K9A A;  3RBZ A;  1NH2 B;  1E1Q G;  3FB6 C;  1KD1 W;  1M56 B;  4G27 B;  1JOY A;  3E89 A;  5KUK A;  3FB8 C;  4MVQ A;  1VQ6 V;  3W7S A;  3T1C A;  1AJP A;  3QO7 A;  3FB7 C;  2V7Q G;  3P30 A;  4GT1 A;  3ZMZ A;  3CC4 V;  4UV8 A;  3ASN B;  3B77 A;  4QJF B;  3BEH A;  2PI4 A;  1KKD A;  1H8H G;  1H8E G;  5EC1 C;  2AHY A;  3CME V;  2H94 A;  1M57 C;  1MSW D;  1ENV A;  3X2Q B;  3OAA G;  1I5Y A;  1FXK A;  5GW7 A;  3PJS K;  3OMA B;  4U7O A;  1CEZ A;  5L3E A;  5EC2 C;  5CA3 A;  2IU3 A;  4QPK A;  5IDJ A;  2Q6A A;  4BIZ A;  2F43 G;  4JAU A;  1EFR G;  3SPG A;  5IYD O;  3LDD A;  1QR8 A;  1VQ8 V;  1YTF D;  2M7W A;  2IJJ A;  4JAV A;  2EJR A;  1V55 C;  5KA6 A;  4HZ3 A;  1R3I C;  1J95 A;  5B1A B;  2EIL B;  1W0J G;  4MVS A;  1K4D C;  2HVK C;  2WAM A;  2QEX V;  1S77 D;  2XAH A;  2IJI A;  2WLM A;  1DLB A;  1OCR B;  1VQK V;  1YHQ V;  3TET A;  4WFG A;  4MTX A;  5EBM C;  1K92 A;  2IH1 C;  4WFE A;  1SER A;  3SYQ A;  3K08 A;  1FXV A;  3RW0 A;  5LHI A;  2BOB C;  2JK5 C;  3JYC A;  2X6A A;  4FPP A;  4L87 A;  1Y66 A;  4LCU C;  3F7Y C;  1K5S A;  3UM7 A;  1BHA A;  3B8N A;  3K79 A;  5B1N A;  3CCE V;  1GTO A;  2X6C A;  3I56 V;  1YJN V;  1S72 V;  2EIL C;  4R7C A;  3HB3 B;  3R65 A;  4I9W A;  1TUE B;  2EIK B;  3CCM V;  4XDL A;  4LC1 A;  1Q81 W;  5LBQ A;  1FFT B;  1H2G A;  2ZR3 A;  1RPR A;  2A79 B;  2ATK C;  4PA7 A;  2XAG A;  4MVR A;  3CCQ V;  3M99 B;  4ZKI A;  2Q68 A;  3JD0 A;  1JX9 A;  2P90 A;  4PA4 A;  1PD3 A;  1I5X A;  5CN0 A;  2DYS C;  2W0F C;  1P4R A;  2XAQ A;  3DGE A;  4JPR A;  3SYA A;  3MHS C;  3T4D A;  2A0L A;  1B6Q A;  1PNM A;  2WWW A;  3OEH G;  4GCZ A;  4RQE A;  1Q7Y W;  3E35 A;  1Q86 W;  1VQ4 V;  3IGA C;  4FJC C;  4PDL A;  5LGT A;  1GO3 F;  4P2Z A;  1AI6 A;  1OCZ C;  3EFF K;  3LUT B;  2DYR C;  1YIT V;  2FTK A;  2WLI A;  1MOF A;  3QO5 A;  3QO8 A;  4TT3 G;  3OE7 G;  4MT8 A;  4MTG A;  4LP8 A;  4R6Z A;  1M9N A;  3RVY A;  1P7B A;  3ABL B;  1FXH A;  2OCC C;  3ZRS A;  1NBM G;  4MTF A;  5B1O A;  1JCH A;  2B5U A;  3TCU A;  2JJ1 G;  2ZD9 A;  4J9Z B;  1VQM V;  4OXS A;  1HWY A;  4XDK A;  2X6B A;  4BIU A;  3CCU V;  2R9I A;  3K3W A;  3ETE A;  1JJ2 U;  3F7V C;  3IFX A;  2WLI B;  3W7U A;  5B3S C;  1K33 A;  3OR7 C;  1QCE A;  3EHB B;  1KEC A;  4P30 A;  5L3B A;  1PNK A;  2B1I A;  5CBF A;  1F51 A;  1FXK B;  2UXX A;  1F4M A;  1NR7 A;  3CCS V;  1H38 A;  4UVA A;  3K04 A;  3AG4 C;  5B1A C;  1COW G;  5IYC O;  4MVM A;  2W6J G;  1S3J A;  2Y69 B;  1DF4 A;  3ABM B;  5LGN A;  1OCR C;  3ZIA G;  4RQF A;  2XND G;  4JTA B;  1NVP D;  2Y69 C;  3ABM C;  4FK5 C;  2HJF C;  2ITD C;  2WLL A;  4FMT A;  5KA5 A;  3AG1 C;  1AR1 B;  1KQS U;  4YXW G;  4XBF A;  1YTF B;  2DYS B;  4BAY A;  1PL0 A;  1E79 G;  1OCO C;  4JYC A;  4DXW A;  1JQ0 A;  2ITC C;  4H33 A;  1G4Y B;  5HFL A;  3SYO A;  2HKO A;  5IY5 B;  3FB5 C;  3CMA V;  4ASU G;  3OW2 U;  1S76 D;  5CBG A;  4QIW F;  3OGC C;  3FYI B;  2EZP A;  2EIJ C;  4JYB A;  2XOK G;  3DTU B;  3OEE G;  4LBE C;  3SPJ A;  3B8M A;  1KP2 A;  2QM8 A;  3AG4 B;  4Z1M G;  3ZN0 A;  4HAM A;  2LP7 A;  3KG2 A;  2OT5 A;  5L3C A;  3OUF A;  2LFS A;  1THZ A;  2WLH A;  2OTJ V;  1JPX A;  1M1K W;  2EIM B;  1SRY A;  4MS2 A;  2ZXW B;  3I55 V;  4UVB A;  1R3L C;  4I5S A;  1GKF A;  4PEL A;  2QKS A;  5C93 A;  2A9H A;  2LFR A;  4GX5 A;  1VQL V;  3CD6 V;  4RUE A;  1VQN V;  3ABK C;  3OM3 B;  4G2K A;  1XL4 A;  1PNL A;  1L1F A;  4UXN A;  3BY6 A;  4GX2 A;  3ZRV A;  1OHH G;  4R8C A;  4KP4 A;  4H37 A;  2HR3 A;  1V55 B;  1CPY A;  4QE9 A;  2XAJ A;  4G28 B;  4P9P A;  1VQP V;  1OCC C;  5L3D A;  1R6N A;  4PA3 A;  3ZMS A;  2QM7 A;  4WFF A;  1VQ9 V;  1XL6 A;  3ZMV A;  2K1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...