1W2BU

Trigger factor ribosome binding domain in complex with 50s
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1w2bU00
3CCVV 1R73A 3CCMV 3CMAV 1KD1W 4WCEV 3CXCU 3CCUV 1Q7YW 1VQLV 3CMEV 1M1KW 1YHQV 1Q81W 1K73W 3G71V 1VQ4V 1VQ8V 1VQNV 4WF9V 1YJNV 1VQPV 1K9MW 1QVGU 1W2BU 3CCRV 3CC7V 1M90W 4WFBV 1S72V 1N8RW 5DM6V 1VQ6V 3CCLV 1K8AW 1YJWV 3I56V 1KQSU 3CC2V 1QVFU 1VQMV 3OW2U 1YITV 3CD6V 3G6EV 3CCJV 3CCQV 1NJIW 3CPWU 3CCSV 2QA4V 1Q86W 2OTJV 1YI2V 2D3OW 1Q82W 3G4SV 1YJ9V 1JJ2U 3CC4V 1KC8W 2OTLV 2QEXV 1YIJV 1VQKV 1VQ7V 4WFAV 1VQOV 1VQ5V 1VQ9V 3CCEV 3I55V
chains in the Genus database with same CATH superfamily
2RNBA 1NVPD 4DRXA 1V55C 5HFMA 1TVKB 5GW7A 1H8HG 1NR1A 2JVDA 1HW7A 2LW7A 1FXKA 5KA6A 3ZHRA 5LA6A 1WP8A 3OMIB 1SQXH 1V9PA 3Q4HB 2WLJA 5CA0A 5CMUA 5IYDO 2HHHO 1VQ8V 4AHCA 3R66A 4B08A 1W59A 4YXWG 1OV9A 1YJNV 3FAVB 2CTQA 4WFEA 4DV1B 4LH6A 4KUMA 4UUJC 3WB2A 4LH7A 1BQ0A 4JI2B 1YJ9V 1IBLB 3ETEA 2NN4A 4LFAB 1QQCA 4X65B 1LUVA 1P84F 1GN6A 3HKBA 3CMEV 3FB5C 1N0JA 2GUZA 4B3TO 4HZ3A 3JD1A 1Y74A 4DW0A 4O4LB 5LHHA 4UCTA 2DMXA 4O4HA 5CB4A 3O9OA 4H33A 4JASA 4UCVA 4TWKA 1XI1A 5LHGA 1VF7A 1I7FA 2KB1A 2H8PC 3H1IH 2N74A 4RQEA 5K1XA 2CTRA 4FLYA 5CBHA 5EYPB 5CA1B 3GB7C 3I56V 4DR7O 2L6LA 1P4RA 4MVUA 1D2DA 3ZHSA 4B7EA 2EJ7A 2ITCC 1VQOV 1GN2A 2LP7A 4I4TA 4FPPA 4P9PA 4ZBMA 1SQVH 1XUQA 3STZC 1B6QA 2JGUA 3RVYA 3KCXA 2P6JA 1ENVA 3UCSC 1XMOO 3BFRA 4I0XA 4DV7B 4R6ZA 1XILA 3ABKB 2EIMC 1JMKC 1K97A 4DUYO 3T1HB 3ZMTA 5IYZA 1R6TA 1VQ9V 2LGWA 1ROPA 1JJOA 2PGGA 4J7KA 1SQQH 4ASUG 4LBEC 4TOIA 1HNXO 2JS3A 3ZMVA 3QO5A 3WFVA 4B3MB 1PV0A 3WU2Z 1FFXA 1M93A 3O65A 1EM1A 1OHHG 4QGPA 2A0LA 4H37A 3IC7A 5LYJB 4XDLA 4FJCC 2EIKC 2KKWA 2QTOA 2H3OA 3J80N 5B1AC 3AG4B 2ADQB 2FYUH 2ZR2A 3ZMZA 1PNLA 4RUEA 5DECA 1PP9H 2Y69C 3QG5A 1MZFA 4KP4A 1G6UA 4MW8A 1LUWA 1X4TA 1XDCA 2R9RB 3TXQA 3CYOA 2B9ZA 3LSUA 1NZ6A 3CWBH 2E75B 4I0XB 1BGYH 3ZRVA 1VQLV 4QNHB 1BS3A 2B1GA 4FLTA 3K58A 3K5LA 1QLNA 4YY3B 4PV1B 3CCLV 4J9ZB 4X20A 1FJGO 5KUMA 1Q6HA 4O4JB 3DTUB 2ZDIA 3ZEDA 2HJDA 5EIBC 2V7QG 3G67A 2WLKA 2ARHA 3FB8C 4DR5B 2FMLA 4X20B 3ASNC 1MZEA 3SYAA 1DLBA 3L9DA 4NXMB 4U7NA 2NNUA 4FLZA 1QVFU 1W0KG 5H2FZ 5L3GA 5L3EA 4FLXA 1F7YA 4ZOLB 2QKSA 4ICGA 4AI8A 4X1YA 1Y66A 4DW1A 3W7TA 1MMMA 4DUZB 2Q7GA 2GHYA 1I94B 1K73W 3RYHA 2LFSA 3GWOA 4B3SB 1EBOA 2EBOA 1H2KA 1MABG 3VQYA 3MHHC 4GX2A 1YITV 1EZJA 1ZUQA 5LGTA 3K79A 2QJ1A 5IDJA 1YTFD 3JARA 2D2CB 5KAIZ 2UUCB 4MVZA 1S5LZ 5L3CA 2DN9A 3CCRV 2JGDB 1G4YB 2F23A 4LCUC 1YCIA 1TUBB 3JALA 3OGCC 4MVRA 2YIDA 4BW9A 2WPDG 3KG2A 3MD0A 1QCEA 4O2BB 2L35A 3IC9A 2KG7A 4KL1A 5GTIZ 4DV5O 1WPXA 1HWYA 2O57A 2Q0AA 4WF9V 2UXCO 1K9MW 5IWAO 4K0KO 2A3QA 4X62O 4O4IB 3VOUA 3ZJZA 4DUYB 3T1HO 1SERA 2IJJA 1KP3A 3QVNA 2EIJB 2MW2B 1B04A 3CRAA 5BZBA 2UU9O 4R50A 1Q81W 4ZHQB 4YHHO 1F4NA 1K34A 3RW0A 3UO3A 2E5LO 1VF6A 2W0XA 3BHPA 4OX9O 4UCOA 3S3WA 2C2AA 3A0RA 4CS2A 4J7ZA 4CC6A 4DK1A 2KQXA 1VF6C 1PM9A 2DWEC 2OCCB 4FZ0A 5F2VO 2ZINA 2XAFA 1PL4A 1AP5A 1N33B 1SQGA 3I5DA 2N04A 5E1AC 1Y76A 4NTWA 2E3CA 2Q7EA 5IJ0B 1FXVA 2QSAA 4QE7A 5B1OA 4LF8O 1XL4A 1M56B 1M57C 2X6CA 2PI5A 1RFYA 1L8DA 3B40A 1SQFA 3TK1A 4GKJO 3E8BA 3ABMC 4LFCB 3A2FA 3P30A 1WLEA 1VARA 4MTFA 1HDJA 3LNNA 1YIJV 5JCOC 2CE4A 3OUSA 2Q4PA 3EFFK 1GKFA 2ZXWB 3CCMV 4XDKA 2M7WA 3BA9A 4LC1A 4BW5A 1MG1A 5GONB 1IXBA 2CGNA 2GSMB 5BMVA 3ASOB 2ADPA 3BEHA 4ZOLA 2NR5A 1Y76B 3E86A 5JCOA 1N4CA 1Y6XA 2ZE6A 2YEVA 3CE2A 1HNWO 4FM2A 1XNRB 2GUZB 3SJCC 3VQXA 1VP7A 2VRZA 1SKVA 1BMFG 1K8AW 2Y69B 1AVMA 1AR1B 2X0LA 2AGAA 4IYHA 1KB9F 5KHHA 1W2BU 1DTOA 3ZX6A 4RO2A 3HKCA 3VQVA 1LR1A 3ABMB 1NS1A 3N2GB 1JA8A 2XTAA 3H01A 3HKEA 4I9QA 3W7SA 3TGUH 1S77D 2P90A 4JI8O 2AHYA 4O4JA 2EZPA 4IIJB 5FNVA 2IM9A 4DR5O 1VMGA 2JJ1G 3ZMSA 1KU9A 1H2LA 1XMQO 3FYIB 4ABMA 1FFTB 4DV3B 4X1KB 2XUMA 5LYJA 4YJ3A 1GH6A 2ZDIC 4LF7B 3JCZA 2PZSA 1FXHA 3CRMA 3B8MA 4MS2A 2ZM6O 2HVJC 4NVPA 3C90A 4RWUA 3CMAV 4JI0B 4UB6Z 3G71V 4FZ1A 4DO2A 1K7DA 4UCRA 3UT5B 4TV8B 2IJHA 4NB5A 5EBWC 1PNMA 2UXXA 1JR9A 1EFRG 4ZI7A 5BR8O 1ZL8A 4J7JA 1H2GA 2A06H 2X7RB 2Q6AA 1S0VA 4LF8B 4B7KA 2R9IA 4FMTA 3NXSA 4PA4A 5IYZB 5KAFZ 1WP7A 1QU7A 2P7TC 3P32A 2RQ6A 1OCCB 3ZRWB 1H38A 3LDCA 2KG7B 5FNVB 3JSNA 4DXWA 4EKWA 4X89A 4QPJA 4LFCO 1Q5OA 3JATB 2XNDG 1F23A 1ZWIC 3PN1A 2IBZH 4J10A 4JTCB 3N2KA 4NXNB 3H1KH 3WB1A 1N34O 4NR1A 1Q90D 4O2AB 4W4KA 5B66Z 2P22C 2HKOA 5IT9N 2QWRB 2BTQB 1ZTEA 1Z5VA 1XBLA 4I7ZB 2EULA 4WFFA 2K9PA 3W7UA 4FLVA 3SYQA 3U11A 4CH5A 1OCRC 4IHJA 1RM1C 3T4DA 2B5UA 3BABA 4YHHB 3OMAB 3RYIB 5EK0A 3ASNB 5JVDA 4PA6A 1SZTA 4LFBB 3OR7C 4WFHA 4BIUA 2UXNA 1AJNA 5EC1C 2IJKA 4JYYA 2XAHA 2V4DA 5LMUB 4MVMA 3E8FA 4B3TB 4X66B 4GCZA 2BE3A 1OCZC 5JJEB 5KLVH 2ZD9A 3CCQV 1WN7A 1IBMO 2ZE7A 2Y0PA 1SS3A 5LP6A 1K5QA 2HR3A 2LGQA 1AP6A 2BSKA 4ZI7B 2YIBD 2ZQMA 4UV9A 1Z5WA 3T1YB 3ZMUA 2EIJC 3ZN0A 4CBCA 3HPLC 2QWNB 5LMNO 2PY5A 4QPKA 4QIWF 2LJ2A 4JGSA 3AK3A 4KXRA 1I5XA 2HJFC 4LFAO 3SPCA 3GWKC 3K03A 3CRCA 3F7YC 1BZKA 3H9VA 5GTHZ 2ZE8A 2DYSB 5A9GA 2WLIA 3QF7A 3ICXA 1XNRO 1NJIW 2OTJV 2EINB 3LSSA 3J7AU 4CS4A 3D3IA 4F4LA 2YSUB 3HKCB 3N2GA 1K5SA 4LF9O 4DV2O 1KUQA 4LF5O 4ZKIA 2QWPB 1J5EB 2HEPA 2YI9A 3AG7A 2QDOA 4TQFA 1ZSPA 2MK3A 1DGSA 3T4ZA 1N36O 2ZNIA 2Q0OC 1E79G 3ABUA 3OD4A 5BR8B 3HKEB 1AR5A 2Y4TA 2JS5A 3RYFB 4UB8Z 3ABLB 2YICA 2F4VB 1EN4A 1SA0B 4DR1O 2EIMB 3APOA 4JI5B 1QR8A 3OM3B 2A79B 2Q8VA 1KKDA 1R6NA 3U10A 1IX9A 4GUNA 2WA3A 1FPOA 4JV5B 2EINC 2W6IG 2VS0A 1OCOC 2ZM6B 3SPHA 2E74B 1TUBA 4O2AA 1B06A 4FFBB 3ETDA 3RGBA 3JASA 3K5MA 2DWDC 3QTCA 1VEWA 4JAAA 3SJBC 4IGGA 1KKCA 4HYOA 4OPAA 3G6EV 2PI4A 2AHZA 1OCOB 1Q82W 3E89A 1JFFB 1IBMB 4MVOA 1AB3A 4QJFB 4TUYB 3I55V 1MSWD 4WFGA 3K06A 5IJ9A 1AI4A 2AXTZ 4DK0A 1SQBH 2A7WA 4UV8A 1ZAUA 3OW2U 1MOFA 5KUKA 3EXAA 3OAAG 1XOUA 5BY1A 1NT2B 4PA7A 1BSMA 1OCCC 5KHGA 4F6RB 5FPRA 1P7BA 1YTFB 3E22A 1WB8A 4N21A 1WAZA 3SPIA 2ZNJA 1JX9A 5IJ0A 3CC7V 4K3AA 4LF6B 2HP8A 1SZXA 3SYCA 1AI5A 1IVSA 2UXDO 3STLC 3VBBA 3K57A 4U7OA 4I55A 3CRQA 1JJ2U 2CTWA 2QEXV 3ZHQA 4JI1B 2BCCH 1VQ7V 4GKKO 2F1MA 1NBMG 2HVKC 2WA4A 3W7XA 1I08A 1E1QG 2P06A 3K9AA 3CC2V 1VQ4V 4TV9B 3K3WA 4I50B 1FAFA 4WBNA 2Z0AA 3VQWA 5IY5C 2AW9A 2LW1A 2F66C 4JI6O 2UXDB 2DQ0A 1GM9A 1YF2A 4JI7B 1BHBA 1Q6IA 1IURA 3ABTA 3JAKA 1QLEC 1S5JA 1M4UA 1Q43A 4HNAA 2OIGA 3DGEA 1N32O 1Z2GA 2YDEA 2DYSC 2XOKG 3RYCB 4X65O 2ZXWC 3IFXA 4PDLA 1GK9A 3CCEV 2Q67A 1Y67A 1R73A 4PA9A 2XAGA 3CCVV 4DV2B 4BAYA 2CK3G 2ZT9B 4CH4A 2WLLB 4YJ3B 4OXSA 2Y48A 4OX9B 4LNUB 4H13B 4DR6B 4EFBA 3CEIA 2IH1C 1YI2V 1XREA 4D7TA 3JAWB 5KHKA 2VQEO 4DR2B 4DV5B 4FVMA 1YEWA 1V54B 4O4LA 3KZIZ 2F4VO 5AG2A 4EB6A 4DR7B 2A9HA 4IL6Z 1DF4A 3OTOO 5KMGA 1R3LC 4DR6O 1GM7A 3EHBB 2GV9A 2WWWA 3TCUA 4B3RO 1SC5B 5E79Z 2EILB 1PPJH 2Z3YA 2P4VA 2EIKB 2QKCA 3K04A 2FL4A 3CXCU 1AI7A 2VWJA 1J5EO 4GX1A 2ATKC 4GKJB 1XMOB 1M57B 1KQSU 4LR3A 1DF5A 1N36B 4U3JB 2YS8A 4YIOA 1MSDA 1X59A 1XHZA 5J2TB 3WB0A 1WA8A 1GMGA 4WFAV 1SESA 1XHXA 4JAUA 4GKKB 1OCRB 4BIOA 4JI3O 4X1YB 1JQ0A 4E4EA 3K0GA 5DN6G 1H2MA 4MSWC 3LUTB 2Q9LA 5LOVA 3OE7G 1MA1A 1YDXA 3B8NA 1PNKA 4TT3G 3ZS8C 5CN0A 1KC8W 3M8AA 4JYAB 3CSXA 4JI7O 1M56C 4R7CA 2UXBB 1NH2D 2NLJC 4O4IA 3JATA 4OGQB 3D3QA 1HP8A 4YJ2B 3RBZA 5LL6Y 4DV6B 2LQTA 5JWPA 3BRCA 5DEDA 3FD9A 2V1DA 2D3OW 4MVSA 2JIZG 2QE7G 1HNZO 2UXBO 1FXKC 2HHHB 4YJ2A 4NTYA 4X64B 2DJVA 1ZX3A 3BVOA 5ITZA 1SF9A 2R70A 2P5OA 4X1IB 3RYFA 2XHBA 1IBLO 2LO1A 4X62B 3JD0A 3SPJA 1GM8A 2R72A 4FIPC 4JPRA 4QE9A 2BSKB 5EZYA 3L75H 1AJPA 1Q3EA 3ZRXA 4E2LA 2YEVB 4NXNO 3E22B 2WSSG 2OCCC 4WFBV 1RPRA 4DR3O 2Q73A 1I0HA 3CP1A 5LP6B 4P2ZA 2JRIA 2QA4V 2QWQB 3CJHB 2OT5A 2OTLV 4DV4O 1O9HA 1CPYA 5CA1A 3CB2A 2UXCB 4O2BA 2FTKA 3P3PA 1OJHA 1COWG 2Q69A 3AG2C 5JQGA 1F51A 1QHTA 1WJZA 4LF4B 1LNQA 3HKBB 3DXRB 1R1BA 1IBKO 3CXHF 4X8AA 1AI6A 3DC6A 2UU9B 3SJQC 3W7WA 4LF5B 4NTXA 4EB6B 4F6EA 3OEEG 5B1BC 2ETNA 4X88A 1N34B 4G28B 2QR4A 2VQFO 1R3KC 5CA0B 5KHIA 1K92A 4BWAA 4CZZA 4PJ0Z 3H1LH 3JYCA 1YZBA 1MNGA 4J9YB 3X2QC 2BTQA 1US6A 1O9GA 1BT8A 2OWOA 1JCHA 4FLUA 3CCUV 2LFRA 4K0KB 1NKDA 5LA6B 3FFQA 1HNXB 1HR0O 1IZ3A 3DSQA 5CB4B 4U3JA 4K35A 3DXRA 1FD9A 5B3SC 5EZYB 5IY5B 1HNWB 1PD3A 1Y74B 3CC4V 2R9AA 3AG1C 1A32A 1L0NH 2PUSA 3ZIAG 3HB3B 3QO8A 5IYCO 1HR0B 1SRYA 1YXBA 4X64O 1BCCH 1S72V 3CJHA 4GYCB 1E1RG 3CRRA 3JSLA 2GDSA 4G27B 1K33A 1EN5A 1Q86W 4CH3A 5EC2C 3OTFA 5KX5B 4KHPB 4NYKA 1FS0G 4TV8A 3UT5A 1GAXA 2DYRC 2UUBB 2IU3A 4CH6A 1ZL8B 4JYCA 3ZRSA 5B1BB 3SPGA 1RM1B 2CDYA 2X6AA 4YY3O 5B3SB 2JGDA 4MTOA 3ZCCA 4I50A 4UXNA 4KHPO 1TGOA 5LOVB 3D36A 3BPZA 3TETA 1Q6UA 1NQTA 3N27A 3TJTA 5L3FA 1SETA 5EIBD 1H2NA 4JAVA 2Y4UA 3FX7A 3CD6V 4F6RA 4ZIBA 3MDSA 4IIJA 2Q68A 4UVCA 3K5NA 1F4MA 1IDSA 3AG1B 5D5QA 4GLXA 1CP9A 3JD3A 3F5TA 3F7VC 1IBKB 1URFA 5CBFA 4JF3A 4JV5O 3OR6C 2ZKOA 3RT3C 2YIAA 4DR2O 1Q7YW 4JYBA 3HKDB 2YXYA 1M90W 4B3SO 4P30A 3RFRA 1FJGB 1PKXA 3L74H 1AJQA 2DW4A 4WBNB 5FPOA 1NTKH 1JOYA 4PA3A 4HBNA 4JI4O 2DE0X 4JI3B 5LXTA 3JARB 1NU1H 4XBFA 3LDEA 2HG5C 1N32B 2E5LB 1WB7A 2Y0IA 3UO2A 3QNEA 4RAIA 1U96A 5LP6C 4K8XA 3A0BZ 1GTOA 3OMNB 4Q20A 3AEIA 3LSQA 5JH7B 5BMVB 5B1AB 4LWSB 1GN3A 4P9OA 2PYJA 4WCEV 1WA8B 2JJ2G 1K4DC 3LDDA 4PI2A 5J2TA 5IYBO 4DV1O 4CS3A 1V54C 5FLXN 5H6RA 2P4KA 2GBOA 4DYLA 1BHAA 4UCUA 4BR6A 4FM0A 5FL7G 1AILA 3B77A 1QLEB 3G4SV 1P7GA 1TA8A 3ETQA 5CBGA 5LXTB 4FK5C 4JI0O 4KFMA 4GX0A 3RWRD 1FYJA 2JK5C 3RN4A 1V55B 2E76B 1UPGA 2UUBO 2QM7A 3JAWA 1T5EA 1R3JC 1NTZH 4TQDA 1NI8A 2AZ2A 4J11A 3F5WC 4J41A 1THZA 3FAVA 1BL8A 1SA0A 3L73H 3UQ8A 1NTMH 3HR0A 3IGAC 2UUAB 5IWAB 5CA3A 4L87A 4PHZA 3BA8A 5JJNB 3SYPA 4D6TH 3OUFA 3CCJV 3CCSV 2VQEB 4R8CA 5TISZ 2CH7A 2BTOA 1Q8IA 4DRXB 1VQKV 4X1IA 4IYIA 1G1XB 3AG3C 4DR4B 2EZOA 1KBHA 5LMUO 1YHQV 3AK1A 3ZRWA 3E2EA 2OCHA 3B09A 1U97A 3C3SA 4X66O 1K3EA 1UFIA 4N23A 2CTPA 4FLWA 1RSOA 2RN9A 2HLDG 4RUFA 3T2MA 4DR3B 2F93B 2W0FC 1EN6A 1H8EG 5ITZB 2YXLA 4J80A 1KMIZ 2BOBC 3K9SA 4DR4O 3A0HZ 3SJAC 1P49A 3RVZA 1OZ0A 1I94O 2G38A 3QO7A 1PL0A 2RJZA 3B2EE 5DM6V 1M5IA 1L0LH 4PDMA 3OEHG 1FKAO 4DV3O 4GT1A 2K1EA 1KECA 1M9NA 1RPOA 4LP8A 3KKYA 2ILMA 3DC5A 4I9WA 4B3RB 4XDJA 4C7UA 3WG7B 4FFKA 1KD1W 2IU0A 5J2UA 5JVDB 1UJWB 4PI0A 5LHIA 5B5EZ 2F95B 4DR1B 1ORQC 3SGIA 3K08A 3E8HA 3JD4A 5HFLA 3MHSC 2QM4A 3OGIB 4DV0B 3CS5A 3OT7A 1XEQA 5EYPA 2AZ0A 1EZVH 2YI8A 2WLHA 1GN4A 2GTAA 5IE9A 3RYHB 2BOCC 1VQ5V 1TUEB 4A5UB 4EFEA 4LF9B 3NR7A 3SR2C 2GTSA 4TUYA 1D5AA 3AK2A 5K1PA 3D36C 3T1CA 4Z1VA 1YVWA 1QVGU 3T1YO 2ZE5A 3JCUZ 1XL6A 1BQZA 4TSFG 2F43G 2RMKB 4GZRB 3ZHTA 4CC5A 1HNZB 2PF4E 3JASB 5J2UB 2ZIMA 4JYAO 5L3DA 4Z1MG 4AQYO 3L72H 2CAZC 3AG3B 2UUCO 1IXMA 3JD2A 5JQGB 4JZGA 1DK1A 2EILC 3G80A 4JI5O 2IJIA 3RYIA 2XAJA 2EX3A 2JEXA 2JEUA 5B1NA 4B3MO 2ZR3A 3E8GA 4L8JA 4JI8B 1QBZA 5LGUA 5GONA 2YC0A 4FFBA 4AQYB 4YIPA 4O4HB 4H0LB 2CUGA 1XMQB 3KCYA 2YUAA 2ZCEA 5EBLC 3ASOC 1XNQO 3A8TA 3FKSG 4JZ2A 1FFXB 4AILC 4NXMO 1J95A 1N33O 3OFNG 1VF5B 3L70H 3N2KB 4Q6GA 5H5NA 5LGNA 4JTDB 2WLLA 4GX5A 1TVKA 4RQFA 3M7MX 4JI1O 4LNUA 3ETGA 4DUZO 2RDCA 4X1KA 2ODMA 1S76D 1VQNV 3RYCA 4FM1A 4LF4O 2H94A 4K8ZA 4DV7O 2XASA 4MTXA 2DQ3A 4DV6O 1GO3F 3H1JH 3CHXA 3EVKA 4UVBA 4JI2O 3JAKB 1S3JA 4DV4B 1BE3H 3PJSK 3IJ4A 1RSOB 5L3BA 5KA5A 1NH2B 1NVPB 4W4LA 1R6KA 4I4TB 2XAQA 1W0JG 4PD4F 3G6BA 4UVAA 3CPWU 1H2SB 1I5YA 2CGOA 5LMNB 3K0DA 3M99B 1B3QA 1M1KW 2QGNA 2Z5UA 3ABKC 2QWOB 3SYOA 3B4SA 3BY6A 1N8RW 1NR7A 3D8CA 1KP2A 3JAMN 4IHJB 5H6QA 3THOA 1S5HC 2ZIOA 1JVMA 1SQPH 4JI6B 2WLNA 3FYEB 1YSCA 4BIZA 1AROP 4MT8A 1JPXA 5H9CA 5JH7A 3ZHUA 4J42A 3U0ZA 4I5SA 2IH3C 4HAMA 2EJRA 1TAEA 2XT9A 4PELA 2QM8A 3OTOB 3MAQA 2HFEC 5LBQA 2DYRB 4MTGA 3AG4C 4D7SA 4DV0O 4UFZA 4OPHA 1AR4A 2N05A 2B1IA 3LNMB 4PDRA 1VIBA 2FB5A 5KMGB 2UUAO 3X2QB 3ML0A 5KHJA 3AG2B 1JFFA 2W6JG 1VQPV 3K5OA 4LWSA 1VQ6V 3GVMA 3S3XA 3E35A 3Q4HA 3ABLC 1ZLZA 1RP3B 4PDVA 1D5NA 2OIEA 3FB6C 4IT5A 2JDIG 2RCVA 1QNMA 3C3TA 1FXKB 2PYLA 3FB7C 3BAAA 3L71H 2OYQA 2X6BA 3ZBHA 5D5PA 4MVQA 4EEQA 1WNSA 1G8MA 2DOSA 3H1HH 2WLMA 4NKGB 3IAYA 4U3FH 1CEZA 2QTSA 1K4CC 2PTMA 1R3IC 3HKDA 3BCCH 5BXZA 2M6YA 2Q5ZA 4UCSA 3ZHVA 2YXHA 4JTAB 3UKMA 1N0NA 1WPBA 4HNAB 2ITDC 3APQA 4I55B 3J81N 5C8YA 1Y4MA 2IW5A 2VWKA 1XNQB 2VQFB 2WAMA 5EBMC 1VQMV 2YIBA 4X9QA 1OCZB 1KYOF 2KSDA 4G2KA 5C93A 3P3NA 5C8YB 3CX5F 2P67A 4JI4B 1QR9A 1XQ8A 3UM7A 3JALB 5A2QN 2Q7HA 4Z2WA 5KX5A 3SDLA 3R65A 4MW3A 1L1FA 2CH7B 5J9PC 2FKXA 5JJJB 4TV9A 1YJWV 3E83A 4LFBO 3WG7C 4LF6O 4LF7O 5IJ9B 3K59A 2QKAA 4H44B 4ZHQA 1GRJA 3ZN1A 3TXSA 2WLIB 1CXZB
chains in the Genus database with same CATH topology
4GX0A 1NVPD 3CCVV 1R73A 4PA9A 2XAGA 2Y69B 1V55C 2JK5C 4BAYA 1AR1B 2X0LA 2CK3G 5HFMA 1V55B 5GW7A 2QM7A 2WLLB 1W2BU 4OXSA 1H8HG 1NR1A 1DTOA 2Y48A 1R3JC 4RO2A 3ABMB 3F5WC 3H01A 1FXKA 1THZA 5KA6A 3W7SA 2IH1C 1YI2V 3OMIB 1S77D 2P90A 2AHYA 1BL8A 2EZPA 2JJ1G 3ZMSA 2WLJA 5CMUA 5IYDO 1V54B 1VQ8V 3FYIB 3IGAC 4YXWG 1YJNV 5CA3A 4L87A 1FFTB 4WFEA 2A9HA 4KUMA 3SYPA 1DF4A 1R3LC 4UUJC 3OUFA 1GM7A 3CCJV 3EHBB 3CCSV 4R8CA 2ZDIC 2WWWA 3TCUA 1YJ9V 2EILB 3JCZA 3ETEA 1VQKV 1FXHA 2Z3YA 3B8MA 4MS2A 2EIKB 2HVJC 3AG3C 3K04A 3CMAV 2EZOA 3CXCU 1AI7A 3CMEV 1YHQV 3E2EA 3ZRWA 3FB5C 3G71V 4GX1A 2ATKC 4HZ3A 1K3EA 3JD1A 4N23A 4DO2A 1K7DA 1M57B 5LHHA 1KQSU 2HLDG 4RUFA 3T2MA 1DF5A 2IJHA 2W0FC 5EBWC 1PNMA 2UXXA 4H33A 4JASA 1H8EG 4TWKA 1EFRG 1GMGA 5LHGA 1H2GA 2BOBC 2X7RB 4WFAV 2KB1A 2Q6AA 1S0VA 1SESA 4JAUA 2H8PC 2R9IA 3RVZA 1OZ0A 1OCRB 3NXSA 4FMTA 4PA4A 3QO7A 4RQEA 1PL0A 4FK5C 1JQ0A 2P7TC 3K0GA 5CBHA 5DN6G 3P32A 4MSWC 5DM6V 1OCCB 3ZRWB 3GB7C 1H38A 3LDCA 3I56V 3LUTB 4PDMA 3OEHG 3OE7G 3B8NA 4TT3G 1PNKA 4GT1A 4DXWA 2K1EA 4X89A 4QPJA 4EKWA 1KECA 1M9NA 1P4RA 4MVUA 1RPOA 4LP8A 2XNDG 5CN0A 1F23A 1ZWIC 1KC8W 2ITCC 1VQOV 4JTCB 4I9WA 2LP7A 1M56C 4XDJA 4R7CA 3WG7B 4FPPA 1KD1W 4P9PA 4ZBMA 2IU0A 1UJWB 3STZC 1B6QA 1NH2D 3RVYA 5LHIA 2NLJC 1ORQC 3K08A 3E8HA 3JD4A 5HFLA 3MHSC 2P6JA 1ENVA 3RBZA 2HKOA 4R6ZA 3ABKB 2V1DA 2EIMC 2D3OW 1K97A 2WLHA 4MVSA 4WFFA 3ZMTA 3W7UA 2BOCC 2JIZG 2QE7G 1VQ5V 1VQ9V 3SYQA 1FXKC 1ROPA 1OCRC 1TUEB 1RM1C 3T4DA 2B5UA 3OMAB 4ASUG 4LBEC 5EK0A 3T1CA 1QVGU 3ASNB 4PA6A 1SZTA 3OR7C 1XL6A 3ZMVA 3QO5A 4WFHA 3WFVA 4BIUA 2UXNA 2F43G 1AJNA 4TSFG 5EC1C 3JD0A 3SPJA 1GM8A 1OHHG 2IJKA 4FIPC 2A0LA 4H37A 3IC7A 4JPRA 4QE9A 2XAHA 5L3DA 4Z1MG 1AJPA 4MVMA 4XDLA 3AG3B 4FJCC 2EIKC 2QTOA 1IXMA 3JD2A 3E8FA 3ZRXA 4E2LA 2EILC 2YEVB 5B1AC 4GCZA 3AG4B 2IJIA 2WSSG 2OCCC 2ZR2A 3ZMZA 1RPRA 4WFBV 2XAJA 1PNLA 4RUEA 3CP1A 2Y69C 2JEXA 4P2ZA 1OCZC 2JEUA 2ZD9A 4KP4A 3CCQV 5B1NA 2ZR3A 4MW8A 2QA4V 3E8GA 1QBZA 5LGUA 2OT5A 2OTLV 2R9RB 1CPYA 3CYOA 1K5QA 2HR3A 3ZRVA 1VQLV 4QNHB 2B1GA 2FTKA 2ZQMA 4UV9A 5EBLC 1COWG 3ASOC 1QLNA 2Q69A 3FKSG 3AG2C 3CCLV 4J9ZB 1F51A 1J95A 3OFNG 1LNQA 3ZMUA 2EIJC 5KUMA 3ZN0A 3HPLC 4CBCA 4QPKA 4JTDB 4QIWF 3DTUB 2ZDIA 5LGNA 2WLLA 4JGSA 4GX5A 2V7QG 4RQFA 1I5XA 2HJFC 2WLKA 4X8AA 1AI6A 3SPCA 3FB8C 3K03A 3ETGA 3ASNC 3SJQC 3W7WA 1S76D 1VQNV 3F7YC 3OEEG 5B1BC 3SYAA 4X88A 1DLBA 2H94A 4G28B 4U7NA 2NNUA 2DYSB 2XASA 2WLIA 1R3KC 4MTXA 2DQ3A 1QVFU 1W0KG 1GO3F 5L3GA 5L3EA 1K92A 1NJIW 2OTJV 2QKSA 4CZZA 2EINB 4UVBA 3LSSA 1Y66A 3W7TA 3JYCA 4J9YB 3D3IA 4F4LA 1S3JA 3X2QC 2YSUB 2GHYA 1K5SA 1JCHA 3PJSK 3CCUV 1K73W 2LFRA 5L3BA 5KA5A 4ZKIA 1NH2B 1NKDA 2LFSA 3GWOA 1NVPB 1EBOA 2EBOA 1MABG 3MHHC 4GX2A 1R6KA 2MK3A 2XAQA 1YITV 1EZJA 5B3SC 1W0JG 4UVAA 3T4ZA 3CPWU 5IY5B 5LGTA 3K79A 1E79G 1I5YA 1PD3A 3ABUA 5IDJA 3CC4V 1YTFD 3K0DA 3AG1C 3M99B 3ABLB 3ZIAG 3HB3B 3QO8A 1M1KW 5IYCO 1SRYA 2Z5UA 4MVZA 2EIMB 5L3CA 3ABKC 3CCRV 1QR8A 1G4YB 3SYOA 3BY6A 1S72V 1N8RW 3OM3B 1NR7A 2A79B 1E1RG 1KP2A 1R6NA 4LCUC 1KKDA 4G27B 1K33A 5H6QA 1S5HC 3OGCC 4MVRA 1Q86W 1JVMA 2WPDG 3KG2A 3MD0A 5EC2C 2WLNA 1QCEA 3FYEB 2EINC 2W6IG 1FS0G 1OCOC 1YSCA 4BIZA 1AROP 4MT8A 3SPHA 1JPXA 2DYRC 5H9CA 1WPXA 2IU3A 1HWYA 3ETDA 4WF9V 4JYCA 1K9MW 4I5SA 2IH3C 3ZRSA 2DWDC 5B1BB 3SPGA 1RM1B 4HAMA 2EJRA 2X6AA 4PELA 2QM8A 2HFEC 5B3SB 5LBQA 2DYRB 4HYOA 4MTGA 3AG4C 3G6EV 2PI4A 4MTOA 2AHZA 3ZCCA 1OCOB 1Q82W 4UXNA 3E89A 3VOUA 3ZJZA 4MVOA 1SERA 2B1IA 3LNMB 4QJFB 4PDRA 2IJJA 1KP3A 3I55V 1MSWD 2EIJB 4WFGA 3D36A 5BZBA 4R50A 1Q81W 3K06A 3X2QB 3TETA 3ML0A 1F4NA 1K34A 1AI4A 3AG2B 3RW0A 1NQTA 2W6JG 1VQPV 5L3FA 1SETA 4UV8A 1VQ6V 4JAVA 3E35A 2C2AA 3CD6V 3OW2U 3ABLC 1MOFA 5KUKA 2Q68A 4PDVA 4UVCA 1F4MA 3AG1B 3OAAG 1CP9A 3FB6C 3JD3A 3F7VC 2JDIG 3A0RA 4PA7A 1FXKB 5CBFA 4JF3A 1OCCC 3OR6C 3FB7C 1P7BA 1YTFB 4N21A 1Q7YW 2X6BA 2DWEC 4MVQA 4JYBA 2OCCB 3SPIA 1G8MA 1JX9A 2XAFA 3CC7V 1M90W 4P30A 2WLMA 3SYCA 1AI5A 1PKXA 3STLC 5E1AC 3VBBA 1AJQA 4U7OA 1CEZA 1JJ2U 1K4CC 2DW4A 1R3IC 1FXVA 4QE7A 2QEXV 5B1OA 1VQ7V 1XL4A 1NBMG 1M56B 2HVKC 4PA3A 3W7XA 1JOYA 1M57C 2X6CA 1E1QG 4JTAB 2PI5A 3UKMA 3K9AA 3CC2V 1VQ4V 2ITDC 3K3WA 3TK1A 4XBFA 3LDEA 2HG5C 3E8BA 1Y4MA 2IW5A 3ABMC 5IY5C 2WAMA 5EBMC 1VQMV 1OCZB 3QNEA 4RAIA 3P30A 1GTOA 1WLEA 3OMNB 4G2KA 4Q20A 2DQ0A 3AEIA 1GM9A 3LSQA 5C93A 4MTFA 1BHBA 5B1AB 1YIJV 4P9OA 2P67A 3OUSA 1QR9A 3UM7A 3EFFK 3ABTA 1GKFA 2ZXWB 3CCMV 4WCEV 4XDKA 2M7WA 4LC1A 3R65A 2JJ2G 1MG1A 4BW5A 1K4DC 3LDDA 4MW3A 1QLEC 5IYBO 2GSMB 1L1FA 1V54C 3ASOB 3BEHA 5J9PC 5H6RA 3DGEA 1YJWV 3E86A 3E83A 1BHAA 3WG7C 5FL7G 2YEVA 3B77A 2DYSC 1QLEB 3G4SV 2XOKG 2ZXWC 3IFXA 4PDLA 5CBGA 3ZN1A 1BMFG 1GK9A 3CCEV 2WLIB 2Q67A 1K8AW 4KFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV V;  1R73 A;  3CCM V;  3CMA V;  1KD1 W;  4WCE V;  3CXC U;  3CCU V;  1Q7Y W;  1VQL V;  3CME V;  1M1K W;  1YHQ V;  1Q81 W;  1K73 W;  3G71 V;  1VQ4 V;  1VQ8 V;  1VQN V;  4WF9 V;  1YJN V;  1VQP V;  1K9M W;  1QVG U;  1W2B U;  3CCR V;  3CC7 V;  1M90 W;  4WFB V;  1S72 V;  1N8R W;  5DM6 V;  1VQ6 V;  3CCL V;  1K8A W;  1YJW V;  3I56 V;  1KQS U;  3CC2 V;  1QVF U;  1VQM V;  3OW2 U;  1YIT V;  3CD6 V;  3G6E V;  3CCJ V;  3CCQ V;  1NJI W;  3CPW U;  3CCS V;  2QA4 V;  1Q86 W;  2OTJ V;  1YI2 V;  2D3O W;  1Q82 W;  3G4S V;  1YJ9 V;  1JJ2 U;  3CC4 V;  1KC8 W;  2OTL V;  2QEX V;  1YIJ V;  1VQK V;  1VQ7 V;  4WFA V;  1VQO V;  1VQ5 V;  1VQ9 V;  3CCE V;  3I55 V; 
#chains in the Genus database with same CATH topology
 2RNB A;  1NVP D;  4DRX A;  1V55 C;  5HFM A;  1TVK B;  5GW7 A;  1H8H G;  1NR1 A;  2JVD A;  1HW7 A;  2LW7 A;  1FXK A;  5KA6 A;  3ZHR A;  5LA6 A;  1WP8 A;  3OMI B;  1SQX H;  1V9P A;  3Q4H B;  2WLJ A;  5CA0 A;  5CMU A;  5IYD O;  2HHH O;  1VQ8 V;  4AHC A;  3R66 A;  4B08 A;  1W59 A;  4YXW G;  1OV9 A;  1YJN V;  3FAV B;  2CTQ A;  4WFE A;  4DV1 B;  4LH6 A;  4KUM A;  4UUJ C;  3WB2 A;  4LH7 A;  1BQ0 A;  4JI2 B;  1YJ9 V;  1IBL B;  3ETE A;  2NN4 A;  4LFA B;  1QQC A;  4X65 B;  1LUV A;  1P84 F;  1GN6 A;  3HKB A;  3CME V;  3FB5 C;  1N0J A;  2GUZ A;  4B3T O;  4HZ3 A;  3JD1 A;  1Y74 A;  4DW0 A;  4O4L B;  5LHH A;  4UCT A;  2DMX A;  4O4H A;  5CB4 A;  3O9O A;  4H33 A;  4JAS A;  4UCV A;  4TWK A;  1XI1 A;  5LHG A;  1VF7 A;  1I7F A;  2KB1 A;  2H8P C;  3H1I H;  2N74 A;  4RQE A;  5K1X A;  2CTR A;  4FLY A;  5CBH A;  5EYP B;  5CA1 B;  3GB7 C;  3I56 V;  4DR7 O;  2L6L A;  1P4R A;  4MVU A;  1D2D A;  3ZHS A;  4B7E A;  2EJ7 A;  2ITC C;  1VQO V;  1GN2 A;  2LP7 A;  4I4T A;  4FPP A;  4P9P A;  4ZBM A;  1SQV H;  1XUQ A;  3STZ C;  1B6Q A;  2JGU A;  3RVY A;  3KCX A;  2P6J A;  1ENV A;  3UCS C;  1XMO O;  3BFR A;  4I0X A;  4DV7 B;  4R6Z A;  1XIL A;  3ABK B;  2EIM C;  1JMK C;  1K97 A;  4DUY O;  3T1H B;  3ZMT A;  5IYZ A;  1R6T A;  1VQ9 V;  2LGW A;  1ROP A;  1JJO A;  2PGG A;  4J7K A;  1SQQ H;  4ASU G;  4LBE C;  4TOI A;  1HNX O;  2JS3 A;  3ZMV A;  3QO5 A;  3WFV A;  4B3M B;  1PV0 A;  3WU2 Z;  1FFX A;  1M93 A;  3O65 A;  1EM1 A;  1OHH G;  4QGP A;  2A0L A;  4H37 A;  3IC7 A;  5LYJ B;  4XDL A;  4FJC C;  2EIK C;  2KKW A;  2QTO A;  2H3O A;  3J80 N;  5B1A C;  3AG4 B;  2ADQ B;  2FYU H;  2ZR2 A;  3ZMZ A;  1PNL A;  4RUE A;  5DEC A;  1PP9 H;  2Y69 C;  3QG5 A;  1MZF A;  4KP4 A;  1G6U A;  4MW8 A;  1LUW A;  1X4T A;  1XDC A;  2R9R B;  3TXQ A;  3CYO A;  2B9Z A;  3LSU A;  1NZ6 A;  3CWB H;  2E75 B;  4I0X B;  1BGY H;  3ZRV A;  1VQL V;  4QNH B;  1BS3 A;  2B1G A;  4FLT A;  3K58 A;  3K5L A;  1QLN A;  4YY3 B;  4PV1 B;  3CCL V;  4J9Z B;  4X20 A;  1FJG O;  5KUM A;  1Q6H A;  4O4J B;  3DTU B;  2ZDI A;  3ZED A;  2HJD A;  5EIB C;  2V7Q G;  3G67 A;  2WLK A;  2ARH A;  3FB8 C;  4DR5 B;  2FML A;  4X20 B;  3ASN C;  1MZE A;  3SYA A;  1DLB A;  3L9D A;  4NXM B;  4U7N A;  2NNU A;  4FLZ A;  1QVF U;  1W0K G;  5H2F Z;  5L3G A;  5L3E A;  4FLX A;  1F7Y A;  4ZOL B;  2QKS A;  4ICG A;  4AI8 A;  4X1Y A;  1Y66 A;  4DW1 A;  3W7T A;  1MMM A;  4DUZ B;  2Q7G A;  2GHY A;  1I94 B;  1K73 W;  3RYH A;  2LFS A;  3GWO A;  4B3S B;  1EBO A;  2EBO A;  1H2K A;  1MAB G;  3VQY A;  3MHH C;  4GX2 A;  1YIT V;  1EZJ A;  1ZUQ A;  5LGT A;  3K79 A;  2QJ1 A;  5IDJ A;  1YTF D;  3JAR A;  2D2C B;  5KAI Z;  2UUC B;  4MVZ A;  1S5L Z;  5L3C A;  2DN9 A;  3CCR V;  2JGD B;  1G4Y B;  2F23 A;  4LCU C;  1YCI A;  1TUB B;  3JAL A;  3OGC C;  4MVR A;  2YID A;  4BW9 A;  2WPD G;  3KG2 A;  3MD0 A;  1QCE A;  4O2B B;  2L35 A;  3IC9 A;  2KG7 A;  4KL1 A;  5GTI Z;  4DV5 O;  1WPX A;  1HWY A;  2O57 A;  2Q0A A;  4WF9 V;  2UXC O;  1K9M W;  5IWA O;  4K0K O;  2A3Q A;  4X62 O;  4O4I B;  3VOU A;  3ZJZ A;  4DUY B;  3T1H O;  1SER A;  2IJJ A;  1KP3 A;  3QVN A;  2EIJ B;  2MW2 B;  1B04 A;  3CRA A;  5BZB A;  2UU9 O;  4R50 A;  1Q81 W;  4ZHQ B;  4YHH O;  1F4N A;  1K34 A;  3RW0 A;  3UO3 A;  2E5L O;  1VF6 A;  2W0X A;  3BHP A;  4OX9 O;  4UCO A;  3S3W A;  2C2A A;  3A0R A;  4CS2 A;  4J7Z A;  4CC6 A;  4DK1 A;  2KQX A;  1VF6 C;  1PM9 A;  2DWE C;  2OCC B;  4FZ0 A;  5F2V O;  2ZIN A;  2XAF A;  1PL4 A;  1AP5 A;  1N33 B;  1SQG A;  3I5D A;  2N04 A;  5E1A C;  1Y76 A;  4NTW A;  2E3C A;  2Q7E A;  5IJ0 B;  1FXV A;  2QSA A;  4QE7 A;  5B1O A;  4LF8 O;  1XL4 A;  1M56 B;  1M57 C;  2X6C A;  2PI5 A;  1RFY A;  1L8D A;  3B40 A;  1SQF A;  3TK1 A;  4GKJ O;  3E8B A;  3ABM C;  4LFC B;  3A2F A;  3P30 A;  1WLE A;  1VAR A;  4MTF A;  1HDJ A;  3LNN A;  1YIJ V;  5JCO C;  2CE4 A;  3OUS A;  2Q4P A;  3EFF K;  1GKF A;  2ZXW B;  3CCM V;  4XDK A;  2M7W A;  3BA9 A;  4LC1 A;  4BW5 A;  1MG1 A;  5GON B;  1IXB A;  2CGN A;  2GSM B;  5BMV A;  3ASO B;  2ADP A;  3BEH A;  4ZOL A;  2NR5 A;  1Y76 B;  3E86 A;  5JCO A;  1N4C A;  1Y6X A;  2ZE6 A;  2YEV A;  3CE2 A;  1HNW O;  4FM2 A;  1XNR B;  2GUZ B;  3SJC C;  3VQX A;  1VP7 A;  2VRZ A;  1SKV A;  1BMF G;  1K8A W;  2Y69 B;  1AVM A;  1AR1 B;  2X0L A;  2AGA A;  4IYH A;  1KB9 F;  5KHH A;  1W2B U;  1DTO A;  3ZX6 A;  4RO2 A;  3HKC A;  3VQV A;  1LR1 A;  3ABM B;  1NS1 A;  3N2G B;  1JA8 A;  2XTA A;  3H01 A;  3HKE A;  4I9Q A;  3W7S A;  3TGU H;  1S77 D;  2P90 A;  4JI8 O;  2AHY A;  4O4J A;  2EZP A;  4IIJ B;  5FNV A;  2IM9 A;  4DR5 O;  1VMG A;  2JJ1 G;  3ZMS A;  1KU9 A;  1H2L A;  1XMQ O;  3FYI B;  4ABM A;  1FFT B;  4DV3 B;  4X1K B;  2XUM A;  5LYJ A;  4YJ3 A;  1GH6 A;  2ZDI C;  4LF7 B;  3JCZ A;  2PZS A;  1FXH A;  3CRM A;  3B8M A;  4MS2 A;  2ZM6 O;  2HVJ C;  4NVP A;  3C90 A;  4RWU A;  3CMA V;  4JI0 B;  4UB6 Z;  3G71 V;  4FZ1 A;  4DO2 A;  1K7D A;  4UCR A;  3UT5 B;  4TV8 B;  2IJH A;  4NB5 A;  5EBW C;  1PNM A;  2UXX A;  1JR9 A;  1EFR G;  4ZI7 A;  5BR8 O;  1ZL8 A;  4J7J A;  1H2G A;  2A06 H;  2X7R B;  2Q6A A;  1S0V A;  4LF8 B;  4B7K A;  2R9I A;  4FMT A;  3NXS A;  4PA4 A;  5IYZ B;  5KAF Z;  1WP7 A;  1QU7 A;  2P7T C;  3P32 A;  2RQ6 A;  1OCC B;  3ZRW B;  1H38 A;  3LDC A;  2KG7 B;  5FNV B;  3JSN A;  4DXW A;  4EKW A;  4X89 A;  4QPJ A;  4LFC O;  1Q5O A;  3JAT B;  2XND G;  1F23 A;  1ZWI C;  3PN1 A;  2IBZ H;  4J10 A;  4JTC B;  3N2K A;  4NXN B;  3H1K H;  3WB1 A;  1N34 O;  4NR1 A;  1Q90 D;  4O2A B;  4W4K A;  5B66 Z;  2P22 C;  2HKO A;  5IT9 N;  2QWR B;  2BTQ B;  1ZTE A;  1Z5V A;  1XBL A;  4I7Z B;  2EUL A;  4WFF A;  2K9P A;  3W7U A;  4FLV A;  3SYQ A;  3U11 A;  4CH5 A;  1OCR C;  4IHJ A;  1RM1 C;  3T4D A;  2B5U A;  3BAB A;  4YHH B;  3OMA B;  3RYI B;  5EK0 A;  3ASN B;  5JVD A;  4PA6 A;  1SZT A;  4LFB B;  3OR7 C;  4WFH A;  4BIU A;  2UXN A;  1AJN A;  5EC1 C;  2IJK A;  4JYY A;  2XAH A;  2V4D A;  5LMU B;  4MVM A;  3E8F A;  4B3T B;  4X66 B;  4GCZ A;  2BE3 A;  1OCZ C;  5JJE B;  5KLV H;  2ZD9 A;  3CCQ V;  1WN7 A;  1IBM O;  2ZE7 A;  2Y0P A;  1SS3 A;  5LP6 A;  1K5Q A;  2HR3 A;  2LGQ A;  1AP6 A;  2BSK A;  4ZI7 B;  2YIB D;  2ZQM A;  4UV9 A;  1Z5W A;  3T1Y B;  3ZMU A;  2EIJ C;  3ZN0 A;  4CBC A;  3HPL C;  2QWN B;  5LMN O;  2PY5 A;  4QPK A;  4QIW F;  2LJ2 A;  4JGS A;  3AK3 A;  4KXR A;  1I5X A;  2HJF C;  4LFA O;  3SPC A;  3GWK C;  3K03 A;  3CRC A;  3F7Y C;  1BZK A;  3H9V A;  5GTH Z;  2ZE8 A;  2DYS B;  5A9G A;  2WLI A;  3QF7 A;  3ICX A;  1XNR O;  1NJI W;  2OTJ V;  2EIN B;  3LSS A;  3J7A U;  4CS4 A;  3D3I A;  4F4L A;  2YSU B;  3HKC B;  3N2G A;  1K5S A;  4LF9 O;  4DV2 O;  1KUQ A;  4LF5 O;  4ZKI A;  2QWP B;  1J5E B;  2HEP A;  2YI9 A;  3AG7 A;  2QDO A;  4TQF A;  1ZSP A;  2MK3 A;  1DGS A;  3T4Z A;  1N36 O;  2ZNI A;  2Q0O C;  1E79 G;  3ABU A;  3OD4 A;  5BR8 B;  3HKE B;  1AR5 A;  2Y4T A;  2JS5 A;  3RYF B;  4UB8 Z;  3ABL B;  2YIC A;  2F4V B;  1EN4 A;  1SA0 B;  4DR1 O;  2EIM B;  3APO A;  4JI5 B;  1QR8 A;  3OM3 B;  2A79 B;  2Q8V A;  1KKD A;  1R6N A;  3U10 A;  1IX9 A;  4GUN A;  2WA3 A;  1FPO A;  4JV5 B;  2EIN C;  2W6I G;  2VS0 A;  1OCO C;  2ZM6 B;  3SPH A;  2E74 B;  1TUB A;  4O2A A;  1B06 A;  4FFB B;  3ETD A;  3RGB A;  3JAS A;  3K5M A;  2DWD C;  3QTC A;  1VEW A;  4JAA A;  3SJB C;  4IGG A;  1KKC A;  4HYO A;  4OPA A;  3G6E V;  2PI4 A;  2AHZ A;  1OCO B;  1Q82 W;  3E89 A;  1JFF B;  1IBM B;  4MVO A;  1AB3 A;  4QJF B;  4TUY B;  3I55 V;  1MSW D;  4WFG A;  3K06 A;  5IJ9 A;  1AI4 A;  2AXT Z;  4DK0 A;  1SQB H;  2A7W A;  4UV8 A;  1ZAU A;  3OW2 U;  1MOF A;  5KUK A;  3EXA A;  3OAA G;  1XOU A;  5BY1 A;  1NT2 B;  4PA7 A;  1BSM A;  1OCC C;  5KHG A;  4F6R B;  5FPR A;  1P7B A;  1YTF B;  3E22 A;  1WB8 A;  4N21 A;  1WAZ A;  3SPI A;  2ZNJ A;  1JX9 A;  5IJ0 A;  3CC7 V;  4K3A A;  4LF6 B;  2HP8 A;  1SZX A;  3SYC A;  1AI5 A;  1IVS A;  2UXD O;  3STL C;  3VBB A;  3K57 A;  4U7O A;  4I55 A;  3CRQ A;  1JJ2 U;  2CTW A;  2QEX V;  3ZHQ A;  4JI1 B;  2BCC H;  1VQ7 V;  4GKK O;  2F1M A;  1NBM G;  2HVK C;  2WA4 A;  3W7X A;  1I08 A;  1E1Q G;  2P06 A;  3K9A A;  3CC2 V;  1VQ4 V;  4TV9 B;  3K3W A;  4I50 B;  1FAF A;  4WBN A;  2Z0A A;  3VQW A;  5IY5 C;  2AW9 A;  2LW1 A;  2F66 C;  4JI6 O;  2UXD B;  2DQ0 A;  1GM9 A;  1YF2 A;  4JI7 B;  1BHB A;  1Q6I A;  1IUR A;  3ABT A;  3JAK A;  1QLE C;  1S5J A;  1M4U A;  1Q43 A;  4HNA A;  2OIG A;  3DGE A;  1N32 O;  1Z2G A;  2YDE A;  2DYS C;  2XOK G;  3RYC B;  4X65 O;  2ZXW C;  3IFX A;  4PDL A;  1GK9 A;  3CCE V;  2Q67 A;  1Y67 A;  1R73 A;  4PA9 A;  2XAG A;  3CCV V;  4DV2 B;  4BAY A;  2CK3 G;  2ZT9 B;  4CH4 A;  2WLL B;  4YJ3 B;  4OXS A;  2Y48 A;  4OX9 B;  4LNU B;  4H13 B;  4DR6 B;  4EFB A;  3CEI A;  2IH1 C;  1YI2 V;  1XRE A;  4D7T A;  3JAW B;  5KHK A;  2VQE O;  4DR2 B;  4DV5 B;  4FVM A;  1YEW A;  1V54 B;  4O4L A;  3KZI Z;  2F4V O;  5AG2 A;  4EB6 A;  4DR7 B;  2A9H A;  4IL6 Z;  1DF4 A;  3OTO O;  5KMG A;  1R3L C;  4DR6 O;  1GM7 A;  3EHB B;  2GV9 A;  2WWW A;  3TCU A;  4B3R O;  1SC5 B;  5E79 Z;  2EIL B;  1PPJ H;  2Z3Y A;  2P4V A;  2EIK B;  2QKC A;  3K04 A;  2FL4 A;  3CXC U;  1AI7 A;  2VWJ A;  1J5E O;  4GX1 A;  2ATK C;  4GKJ B;  1XMO B;  1M57 B;  1KQS U;  4LR3 A;  1DF5 A;  1N36 B;  4U3J B;  2YS8 A;  4YIO A;  1MSD A;  1X59 A;  1XHZ A;  5J2T B;  3WB0 A;  1WA8 A;  1GMG A;  4WFA V;  1SES A;  1XHX A;  4JAU A;  4GKK B;  1OCR B;  4BIO A;  4JI3 O;  4X1Y B;  1JQ0 A;  4E4E A;  3K0G A;  5DN6 G;  1H2M A;  4MSW C;  3LUT B;  2Q9L A;  5LOV A;  3OE7 G;  1MA1 A;  1YDX A;  3B8N A;  1PNK A;  4TT3 G;  3ZS8 C;  5CN0 A;  1KC8 W;  3M8A A;  4JYA B;  3CSX A;  4JI7 O;  1M56 C;  4R7C A;  2UXB B;  1NH2 D;  2NLJ C;  4O4I A;  3JAT A;  4OGQ B;  3D3Q A;  1HP8 A;  4YJ2 B;  3RBZ A;  5LL6 Y;  4DV6 B;  2LQT A;  5JWP A;  3BRC A;  5DED A;  3FD9 A;  2V1D A;  2D3O W;  4MVS A;  2JIZ G;  2QE7 G;  1HNZ O;  2UXB O;  1FXK C;  2HHH B;  4YJ2 A;  4NTY A;  4X64 B;  2DJV A;  1ZX3 A;  3BVO A;  5ITZ A;  1SF9 A;  2R70 A;  2P5O A;  4X1I B;  3RYF A;  2XHB A;  1IBL O;  2LO1 A;  4X62 B;  3JD0 A;  3SPJ A;  1GM8 A;  2R72 A;  4FIP C;  4JPR A;  4QE9 A;  2BSK B;  5EZY A;  3L75 H;  1AJP A;  1Q3E A;  3ZRX A;  4E2L A;  2YEV B;  4NXN O;  3E22 B;  2WSS G;  2OCC C;  4WFB V;  1RPR A;  4DR3 O;  2Q73 A;  1I0H A;  3CP1 A;  5LP6 B;  4P2Z A;  2JRI A;  2QA4 V;  2QWQ B;  3CJH B;  2OT5 A;  2OTL V;  4DV4 O;  1O9H A;  1CPY A;  5CA1 A;  3CB2 A;  2UXC B;  4O2B A;  2FTK A;  3P3P A;  1OJH A;  1COW G;  2Q69 A;  3AG2 C;  5JQG A;  1F51 A;  1QHT A;  1WJZ A;  4LF4 B;  1LNQ A;  3HKB B;  3DXR B;  1R1B A;  1IBK O;  3CXH F;  4X8A A;  1AI6 A;  3DC6 A;  2UU9 B;  3SJQ C;  3W7W A;  4LF5 B;  4NTX A;  4EB6 B;  4F6E A;  3OEE G;  5B1B C;  2ETN A;  4X88 A;  1N34 B;  4G28 B;  2QR4 A;  2VQF O;  1R3K C;  5CA0 B;  5KHI A;  1K92 A;  4BWA A;  4CZZ A;  4PJ0 Z;  3H1L H;  3JYC A;  1YZB A;  1MNG A;  4J9Y B;  3X2Q C;  2BTQ A;  1US6 A;  1O9G A;  1BT8 A;  2OWO A;  1JCH A;  4FLU A;  3CCU V;  2LFR A;  4K0K B;  1NKD A;  5LA6 B;  3FFQ A;  1HNX B;  1HR0 O;  1IZ3 A;  3DSQ A;  5CB4 B;  4U3J A;  4K35 A;  3DXR A;  1FD9 A;  5B3S C;  5EZY B;  5IY5 B;  1HNW B;  1PD3 A;  1Y74 B;  3CC4 V;  2R9A A;  3AG1 C;  1A32 A;  1L0N H;  2PUS A;  3ZIA G;  3HB3 B;  3QO8 A;  5IYC O;  1HR0 B;  1SRY A;  1YXB A;  4X64 O;  1BCC H;  1S72 V;  3CJH A;  4GYC B;  1E1R G;  3CRR A;  3JSL A;  2GDS A;  4G27 B;  1K33 A;  1EN5 A;  1Q86 W;  4CH3 A;  5EC2 C;  3OTF A;  5KX5 B;  4KHP B;  4NYK A;  1FS0 G;  4TV8 A;  3UT5 A;  1GAX A;  2DYR C;  2UUB B;  2IU3 A;  4CH6 A;  1ZL8 B;  4JYC A;  3ZRS A;  5B1B B;  3SPG A;  1RM1 B;  2CDY A;  2X6A A;  4YY3 O;  5B3S B;  2JGD A;  4MTO A;  3ZCC A;  4I50 A;  4UXN A;  4KHP O;  1TGO A;  5LOV B;  3D36 A;  3BPZ A;  3TET A;  1Q6U A;  1NQT A;  3N27 A;  3TJT A;  5L3F A;  1SET A;  5EIB D;  1H2N A;  4JAV A;  2Y4U A;  3FX7 A;  3CD6 V;  4F6R A;  4ZIB A;  3MDS A;  4IIJ A;  2Q68 A;  4UVC A;  3K5N A;  1F4M A;  1IDS A;  3AG1 B;  5D5Q A;  4GLX A;  1CP9 A;  3JD3 A;  3F5T A;  3F7V C;  1IBK B;  1URF A;  5CBF A;  4JF3 A;  4JV5 O;  3OR6 C;  2ZKO A;  3RT3 C;  2YIA A;  4DR2 O;  1Q7Y W;  4JYB A;  3HKD B;  2YXY A;  1M90 W;  4B3S O;  4P30 A;  3RFR A;  1FJG B;  1PKX A;  3L74 H;  1AJQ A;  2DW4 A;  4WBN B;  5FPO A;  1NTK H;  1JOY A;  4PA3 A;  4HBN A;  4JI4 O;  2DE0 X;  4JI3 B;  5LXT A;  3JAR B;  1NU1 H;  4XBF A;  3LDE A;  2HG5 C;  1N32 B;  2E5L B;  1WB7 A;  2Y0I A;  3UO2 A;  3QNE A;  4RAI A;  1U96 A;  5LP6 C;  4K8X A;  3A0B Z;  1GTO A;  3OMN B;  4Q20 A;  3AEI A;  3LSQ A;  5JH7 B;  5BMV B;  5B1A B;  4LWS B;  1GN3 A;  4P9O A;  2PYJ A;  4WCE V;  1WA8 B;  2JJ2 G;  1K4D C;  3LDD A;  4PI2 A;  5J2T A;  5IYB O;  4DV1 O;  4CS3 A;  1V54 C;  5FLX N;  5H6R A;  2P4K A;  2GBO A;  4DYL A;  1BHA A;  4UCU A;  4BR6 A;  4FM0 A;  5FL7 G;  1AIL A;  3B77 A;  1QLE B;  3G4S V;  1P7G A;  1TA8 A;  3ETQ A;  5CBG A;  5LXT B;  4FK5 C;  4JI0 O;  4KFM A;  4GX0 A;  3RWR D;  1FYJ A;  2JK5 C;  3RN4 A;  1V55 B;  2E76 B;  1UPG A;  2UUB O;  2QM7 A;  3JAW A;  1T5E A;  1R3J C;  1NTZ H;  4TQD A;  1NI8 A;  2AZ2 A;  4J11 A;  3F5W C;  4J41 A;  1THZ A;  3FAV A;  1BL8 A;  1SA0 A;  3L73 H;  3UQ8 A;  1NTM H;  3HR0 A;  3IGA C;  2UUA B;  5IWA B;  5CA3 A;  4L87 A;  4PHZ A;  3BA8 A;  5JJN B;  3SYP A;  4D6T H;  3OUF A;  3CCJ V;  3CCS V;  2VQE B;  4R8C A;  5TIS Z;  2CH7 A;  2BTO A;  1Q8I A;  4DRX B;  1VQK V;  4X1I A;  4IYI A;  1G1X B;  3AG3 C;  4DR4 B;  2EZO A;  1KBH A;  5LMU O;  1YHQ V;  3AK1 A;  3ZRW A;  3E2E A;  2OCH A;  3B09 A;  1U97 A;  3C3S A;  4X66 O;  1K3E A;  1UFI A;  4N23 A;  2CTP A;  4FLW A;  1RSO A;  2RN9 A;  2HLD G;  4RUF A;  3T2M A;  4DR3 B;  2F93 B;  2W0F C;  1EN6 A;  1H8E G;  5ITZ B;  2YXL A;  4J80 A;  1KMI Z;  2BOB C;  3K9S A;  4DR4 O;  3A0H Z;  3SJA C;  1P49 A;  3RVZ A;  1OZ0 A;  1I94 O;  2G38 A;  3QO7 A;  1PL0 A;  2RJZ A;  3B2E E;  5DM6 V;  1M5I A;  1L0L H;  4PDM A;  3OEH G;  1FKA O;  4DV3 O;  4GT1 A;  2K1E A;  1KEC A;  1M9N A;  1RPO A;  4LP8 A;  3KKY A;  2ILM A;  3DC5 A;  4I9W A;  4B3R B;  4XDJ A;  4C7U A;  3WG7 B;  4FFK A;  1KD1 W;  2IU0 A;  5J2U A;  5JVD B;  1UJW B;  4PI0 A;  5LHI A;  5B5E Z;  2F95 B;  4DR1 B;  1ORQ C;  3SGI A;  3K08 A;  3E8H A;  3JD4 A;  5HFL A;  3MHS C;  2QM4 A;  3OGI B;  4DV0 B;  3CS5 A;  3OT7 A;  1XEQ A;  5EYP A;  2AZ0 A;  1EZV H;  2YI8 A;  2WLH A;  1GN4 A;  2GTA A;  5IE9 A;  3RYH B;  2BOC C;  1VQ5 V;  1TUE B;  4A5U B;  4EFE A;  4LF9 B;  3NR7 A;  3SR2 C;  2GTS A;  4TUY A;  1D5A A;  3AK2 A;  5K1P A;  3D36 C;  3T1C A;  4Z1V A;  1YVW A;  1QVG U;  3T1Y O;  2ZE5 A;  3JCU Z;  1XL6 A;  1BQZ A;  4TSF G;  2F43 G;  2RMK B;  4GZR B;  3ZHT A;  4CC5 A;  1HNZ B;  2PF4 E;  3JAS B;  5J2U B;  2ZIM A;  4JYA O;  5L3D A;  4Z1M G;  4AQY O;  3L72 H;  2CAZ C;  3AG3 B;  2UUC O;  1IXM A;  3JD2 A;  5JQG B;  4JZG A;  1DK1 A;  2EIL C;  3G80 A;  4JI5 O;  2IJI A;  3RYI A;  2XAJ A;  2EX3 A;  2JEX A;  2JEU A;  5B1N A;  4B3M O;  2ZR3 A;  3E8G A;  4L8J A;  4JI8 B;  1QBZ A;  5LGU A;  5GON A;  2YC0 A;  4FFB A;  4AQY B;  4YIP A;  4O4H B;  4H0L B;  2CUG A;  1XMQ B;  3KCY A;  2YUA A;  2ZCE A;  5EBL C;  3ASO C;  1XNQ O;  3A8T A;  3FKS G;  4JZ2 A;  1FFX B;  4AIL C;  4NXM O;  1J95 A;  1N33 O;  3OFN G;  1VF5 B;  3L70 H;  3N2K B;  4Q6G A;  5H5N A;  5LGN A;  4JTD B;  2WLL A;  4GX5 A;  1TVK A;  4RQF A;  3M7M X;  4JI1 O;  4LNU A;  3ETG A;  4DUZ O;  2RDC A;  4X1K A;  2ODM A;  1S76 D;  1VQN V;  3RYC A;  4FM1 A;  4LF4 O;  2H94 A;  4K8Z A;  4DV7 O;  2XAS A;  4MTX A;  2DQ3 A;  4DV6 O;  1GO3 F;  3H1J H;  3CHX A;  3EVK A;  4UVB A;  4JI2 O;  3JAK B;  1S3J A;  4DV4 B;  1BE3 H;  3PJS K;  3IJ4 A;  1RSO B;  5L3B A;  5KA5 A;  1NH2 B;  1NVP B;  4W4L A;  1R6K A;  4I4T B;  2XAQ A;  1W0J G;  4PD4 F;  3G6B A;  4UVA A;  3CPW U;  1H2S B;  1I5Y A;  2CGO A;  5LMN B;  3K0D A;  3M99 B;  1B3Q A;  1M1K W;  2QGN A;  2Z5U A;  3ABK C;  2QWO B;  3SYO A;  3B4S A;  3BY6 A;  1N8R W;  1NR7 A;  3D8C A;  1KP2 A;  3JAM N;  4IHJ B;  5H6Q A;  3THO A;  1S5H C;  2ZIO A;  1JVM A;  1SQP H;  4JI6 B;  2WLN A;  3FYE B;  1YSC A;  4BIZ A;  1ARO P;  4MT8 A;  1JPX A;  5H9C A;  5JH7 A;  3ZHU A;  4J42 A;  3U0Z A;  4I5S A;  2IH3 C;  4HAM A;  2EJR A;  1TAE A;  2XT9 A;  4PEL A;  2QM8 A;  3OTO B;  3MAQ A;  2HFE C;  5LBQ A;  2DYR B;  4MTG A;  3AG4 C;  4D7S A;  4DV0 O;  4UFZ A;  4OPH A;  1AR4 A;  2N05 A;  2B1I A;  3LNM B;  4PDR A;  1VIB A;  2FB5 A;  5KMG B;  2UUA O;  3X2Q B;  3ML0 A;  5KHJ A;  3AG2 B;  1JFF A;  2W6J G;  1VQP V;  3K5O A;  4LWS A;  1VQ6 V;  3GVM A;  3S3X A;  3E35 A;  3Q4H A;  3ABL C;  1ZLZ A;  1RP3 B;  4PDV A;  1D5N A;  2OIE A;  3FB6 C;  4IT5 A;  2JDI G;  2RCV A;  1QNM A;  3C3T A;  1FXK B;  2PYL A;  3FB7 C;  3BAA A;  3L71 H;  2OYQ A;  2X6B A;  3ZBH A;  5D5P A;  4MVQ A;  4EEQ A;  1WNS A;  1G8M A;  2DOS A;  3H1H H;  2WLM A;  4NKG B;  3IAY A;  4U3F H;  1CEZ A;  2QTS A;  1K4C C;  2PTM A;  1R3I C;  3HKD A;  3BCC H;  5BXZ A;  2M6Y A;  2Q5Z A;  4UCS A;  3ZHV A;  2YXH A;  4JTA B;  3UKM A;  1N0N A;  1WPB A;  4HNA B;  2ITD C;  3APQ A;  4I55 B;  3J81 N;  5C8Y A;  1Y4M A;  2IW5 A;  2VWK A;  1XNQ B;  2VQF B;  2WAM A;  5EBM C;  1VQM V;  2YIB A;  4X9Q A;  1OCZ B;  1KYO F;  2KSD A;  4G2K A;  5C93 A;  3P3N A;  5C8Y B;  3CX5 F;  2P67 A;  4JI4 B;  1QR9 A;  1XQ8 A;  3UM7 A;  3JAL B;  5A2Q N;  2Q7H A;  4Z2W A;  5KX5 A;  3SDL A;  3R65 A;  4MW3 A;  1L1F A;  2CH7 B;  5J9P C;  2FKX A;  5JJJ B;  4TV9 A;  1YJW V;  3E83 A;  4LFB O;  3WG7 C;  4LF6 O;  4LF7 O;  5IJ9 B;  3K59 A;  2QKA A;  4H44 B;  4ZHQ A;  1GRJ A;  3ZN1 A;  3TXS A;  2WLI B;  1CXZ B; 
#chains in the Genus database with same CATH homology
 4GX0 A;  1NVP D;  3CCV V;  1R73 A;  4PA9 A;  2XAG A;  2Y69 B;  1V55 C;  2JK5 C;  4BAY A;  1AR1 B;  2X0L A;  2CK3 G;  5HFM A;  1V55 B;  5GW7 A;  2QM7 A;  2WLL B;  1W2B U;  4OXS A;  1H8H G;  1NR1 A;  1DTO A;  2Y48 A;  1R3J C;  4RO2 A;  3ABM B;  3F5W C;  3H01 A;  1FXK A;  1THZ A;  5KA6 A;  3W7S A;  2IH1 C;  1YI2 V;  3OMI B;  1S77 D;  2P90 A;  2AHY A;  1BL8 A;  2EZP A;  2JJ1 G;  3ZMS A;  2WLJ A;  5CMU A;  5IYD O;  1V54 B;  1VQ8 V;  3FYI B;  3IGA C;  4YXW G;  1YJN V;  5CA3 A;  4L87 A;  1FFT B;  4WFE A;  2A9H A;  4KUM A;  3SYP A;  1DF4 A;  1R3L C;  4UUJ C;  3OUF A;  1GM7 A;  3CCJ V;  3EHB B;  3CCS V;  4R8C A;  2ZDI C;  2WWW A;  3TCU A;  1YJ9 V;  2EIL B;  3JCZ A;  3ETE A;  1VQK V;  1FXH A;  2Z3Y A;  3B8M A;  4MS2 A;  2EIK B;  2HVJ C;  3AG3 C;  3K04 A;  3CMA V;  2EZO A;  3CXC U;  1AI7 A;  3CME V;  1YHQ V;  3E2E A;  3ZRW A;  3FB5 C;  3G71 V;  4GX1 A;  2ATK C;  4HZ3 A;  1K3E A;  3JD1 A;  4N23 A;  4DO2 A;  1K7D A;  1M57 B;  5LHH A;  1KQS U;  2HLD G;  4RUF A;  3T2M A;  1DF5 A;  2IJH A;  2W0F C;  5EBW C;  1PNM A;  2UXX A;  4H33 A;  4JAS A;  1H8E G;  4TWK A;  1EFR G;  1GMG A;  5LHG A;  1H2G A;  2BOB C;  2X7R B;  4WFA V;  2KB1 A;  2Q6A A;  1S0V A;  1SES A;  4JAU A;  2H8P C;  2R9I A;  3RVZ A;  1OZ0 A;  1OCR B;  3NXS A;  4FMT A;  4PA4 A;  3QO7 A;  4RQE A;  1PL0 A;  4FK5 C;  1JQ0 A;  2P7T C;  3K0G A;  5CBH A;  5DN6 G;  3P32 A;  4MSW C;  5DM6 V;  1OCC B;  3ZRW B;  3GB7 C;  1H38 A;  3LDC A;  3I56 V;  3LUT B;  4PDM A;  3OEH G;  3OE7 G;  3B8N A;  4TT3 G;  1PNK A;  4GT1 A;  4DXW A;  2K1E A;  4X89 A;  4QPJ A;  4EKW A;  1KEC A;  1M9N A;  1P4R A;  4MVU A;  1RPO A;  4LP8 A;  2XND G;  5CN0 A;  1F23 A;  1ZWI C;  1KC8 W;  2ITC C;  1VQO V;  4JTC B;  4I9W A;  2LP7 A;  1M56 C;  4XDJ A;  4R7C A;  3WG7 B;  4FPP A;  1KD1 W;  4P9P A;  4ZBM A;  2IU0 A;  1UJW B;  3STZ C;  1B6Q A;  1NH2 D;  3RVY A;  5LHI A;  2NLJ C;  1ORQ C;  3K08 A;  3E8H A;  3JD4 A;  5HFL A;  3MHS C;  2P6J A;  1ENV A;  3RBZ A;  2HKO A;  4R6Z A;  3ABK B;  2V1D A;  2EIM C;  2D3O W;  1K97 A;  2WLH A;  4MVS A;  4WFF A;  3ZMT A;  3W7U A;  2BOC C;  2JIZ G;  2QE7 G;  1VQ5 V;  1VQ9 V;  3SYQ A;  1FXK C;  1ROP A;  1OCR C;  1TUE B;  1RM1 C;  3T4D A;  2B5U A;  3OMA B;  4ASU G;  4LBE C;  5EK0 A;  3T1C A;  1QVG U;  3ASN B;  4PA6 A;  1SZT A;  3OR7 C;  1XL6 A;  3ZMV A;  3QO5 A;  4WFH A;  3WFV A;  4BIU A;  2UXN A;  2F43 G;  1AJN A;  4TSF G;  5EC1 C;  3JD0 A;  3SPJ A;  1GM8 A;  1OHH G;  2IJK A;  4FIP C;  2A0L A;  4H37 A;  3IC7 A;  4JPR A;  4QE9 A;  2XAH A;  5L3D A;  4Z1M G;  1AJP A;  4MVM A;  4XDL A;  3AG3 B;  4FJC C;  2EIK C;  2QTO A;  1IXM A;  3JD2 A;  3E8F A;  3ZRX A;  4E2L A;  2EIL C;  2YEV B;  5B1A C;  4GCZ A;  3AG4 B;  2IJI A;  2WSS G;  2OCC C;  2ZR2 A;  3ZMZ A;  1RPR A;  4WFB V;  2XAJ A;  1PNL A;  4RUE A;  3CP1 A;  2Y69 C;  2JEX A;  4P2Z A;  1OCZ C;  2JEU A;  2ZD9 A;  4KP4 A;  3CCQ V;  5B1N A;  2ZR3 A;  4MW8 A;  2QA4 V;  3E8G A;  1QBZ A;  5LGU A;  2OT5 A;  2OTL V;  2R9R B;  1CPY A;  3CYO A;  1K5Q A;  2HR3 A;  3ZRV A;  1VQL V;  4QNH B;  2B1G A;  2FTK A;  2ZQM A;  4UV9 A;  5EBL C;  1COW G;  3ASO C;  1QLN A;  2Q69 A;  3FKS G;  3AG2 C;  3CCL V;  4J9Z B;  1F51 A;  1J95 A;  3OFN G;  1LNQ A;  3ZMU A;  2EIJ C;  5KUM A;  3ZN0 A;  3HPL C;  4CBC A;  4QPK A;  4JTD B;  4QIW F;  3DTU B;  2ZDI A;  5LGN A;  2WLL A;  4JGS A;  4GX5 A;  2V7Q G;  4RQF A;  1I5X A;  2HJF C;  2WLK A;  4X8A A;  1AI6 A;  3SPC A;  3FB8 C;  3K03 A;  3ETG A;  3ASN C;  3SJQ C;  3W7W A;  1S76 D;  1VQN V;  3F7Y C;  3OEE G;  5B1B C;  3SYA A;  4X88 A;  1DLB A;  2H94 A;  4G28 B;  4U7N A;  2NNU A;  2DYS B;  2XAS A;  2WLI A;  1R3K C;  4MTX A;  2DQ3 A;  1QVF U;  1W0K G;  1GO3 F;  5L3G A;  5L3E A;  1K92 A;  1NJI W;  2OTJ V;  2QKS A;  4CZZ A;  2EIN B;  4UVB A;  3LSS A;  1Y66 A;  3W7T A;  3JYC A;  4J9Y B;  3D3I A;  4F4L A;  1S3J A;  3X2Q C;  2YSU B;  2GHY A;  1K5S A;  1JCH A;  3PJS K;  3CCU V;  1K73 W;  2LFR A;  5L3B A;  5KA5 A;  4ZKI A;  1NH2 B;  1NKD A;  2LFS A;  3GWO A;  1NVP B;  1EBO A;  2EBO A;  1MAB G;  3MHH C;  4GX2 A;  1R6K A;  2MK3 A;  2XAQ A;  1YIT V;  1EZJ A;  5B3S C;  1W0J G;  4UVA A;  3T4Z A;  3CPW U;  5IY5 B;  5LGT A;  3K79 A;  1E79 G;  1I5Y A;  1PD3 A;  3ABU A;  5IDJ A;  3CC4 V;  1YTF D;  3K0D A;  3AG1 C;  3M99 B;  3ABL B;  3ZIA G;  3HB3 B;  3QO8 A;  1M1K W;  5IYC O;  1SRY A;  2Z5U A;  4MVZ A;  2EIM B;  5L3C A;  3ABK C;  3CCR V;  1QR8 A;  1G4Y B;  3SYO A;  3BY6 A;  1S72 V;  1N8R W;  3OM3 B;  1NR7 A;  2A79 B;  1E1R G;  1KP2 A;  1R6N A;  4LCU C;  1KKD A;  4G27 B;  1K33 A;  5H6Q A;  1S5H C;  3OGC C;  4MVR A;  1Q86 W;  1JVM A;  2WPD G;  3KG2 A;  3MD0 A;  5EC2 C;  2WLN A;  1QCE A;  3FYE B;  2EIN C;  2W6I G;  1FS0 G;  1OCO C;  1YSC A;  4BIZ A;  1ARO P;  4MT8 A;  3SPH A;  1JPX A;  2DYR C;  5H9C A;  1WPX A;  2IU3 A;  1HWY A;  3ETD A;  4WF9 V;  4JYC A;  1K9M W;  4I5S A;  2IH3 C;  3ZRS A;  2DWD C;  5B1B B;  3SPG A;  1RM1 B;  4HAM A;  2EJR A;  2X6A A;  4PEL A;  2QM8 A;  2HFE C;  5B3S B;  5LBQ A;  2DYR B;  4HYO A;  4MTG A;  3AG4 C;  3G6E V;  2PI4 A;  4MTO A;  2AHZ A;  3ZCC A;  1OCO B;  1Q82 W;  4UXN A;  3E89 A;  3VOU A;  3ZJZ A;  4MVO A;  1SER A;  2B1I A;  3LNM B;  4QJF B;  4PDR A;  2IJJ A;  1KP3 A;  3I55 V;  1MSW D;  2EIJ B;  4WFG A;  3D36 A;  5BZB A;  4R50 A;  1Q81 W;  3K06 A;  3X2Q B;  3TET A;  3ML0 A;  1F4N A;  1K34 A;  1AI4 A;  3AG2 B;  3RW0 A;  1NQT A;  2W6J G;  1VQP V;  5L3F A;  1SET A;  4UV8 A;  1VQ6 V;  4JAV A;  3E35 A;  2C2A A;  3CD6 V;  3OW2 U;  3ABL C;  1MOF A;  5KUK A;  2Q68 A;  4PDV A;  4UVC A;  1F4M A;  3AG1 B;  3OAA G;  1CP9 A;  3FB6 C;  3JD3 A;  3F7V C;  2JDI G;  3A0R A;  4PA7 A;  1FXK B;  5CBF A;  4JF3 A;  1OCC C;  3OR6 C;  3FB7 C;  1P7B A;  1YTF B;  4N21 A;  1Q7Y W;  2X6B A;  2DWE C;  4MVQ A;  4JYB A;  2OCC B;  3SPI A;  1G8M A;  1JX9 A;  2XAF A;  3CC7 V;  1M90 W;  4P30 A;  2WLM A;  3SYC A;  1AI5 A;  1PKX A;  3STL C;  5E1A C;  3VBB A;  1AJQ A;  4U7O A;  1CEZ A;  1JJ2 U;  1K4C C;  2DW4 A;  1R3I C;  1FXV A;  4QE7 A;  2QEX V;  5B1O A;  1VQ7 V;  1XL4 A;  1NBM G;  1M56 B;  2HVK C;  4PA3 A;  3W7X A;  1JOY A;  1M57 C;  2X6C A;  1E1Q G;  4JTA B;  2PI5 A;  3UKM A;  3K9A A;  3CC2 V;  1VQ4 V;  2ITD C;  3K3W A;  3TK1 A;  4XBF A;  3LDE A;  2HG5 C;  3E8B A;  1Y4M A;  2IW5 A;  3ABM C;  5IY5 C;  2WAM A;  5EBM C;  1VQM V;  1OCZ B;  3QNE A;  4RAI A;  3P30 A;  1GTO A;  1WLE A;  3OMN B;  4G2K A;  4Q20 A;  2DQ0 A;  3AEI A;  1GM9 A;  3LSQ A;  5C93 A;  4MTF A;  1BHB A;  5B1A B;  1YIJ V;  4P9O A;  2P67 A;  3OUS A;  1QR9 A;  3UM7 A;  3EFF K;  3ABT A;  1GKF A;  2ZXW B;  3CCM V;  4WCE V;  4XDK A;  2M7W A;  4LC1 A;  3R65 A;  2JJ2 G;  1MG1 A;  4BW5 A;  1K4D C;  3LDD A;  4MW3 A;  1QLE C;  5IYB O;  2GSM B;  1L1F A;  1V54 C;  3ASO B;  3BEH A;  5J9P C;  5H6R A;  3DGE A;  1YJW V;  3E86 A;  3E83 A;  1BHA A;  3WG7 C;  5FL7 G;  2YEV A;  3B77 A;  2DYS C;  1QLE B;  3G4S V;  2XOK G;  2ZXW C;  3IFX A;  4PDL A;  5CBG A;  3ZN1 A;  1BMF G;  1GK9 A;  3CCE V;  2WLI B;  2Q67 A;  1K8A W;  4KFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...