1W2BU

Trigger factor ribosome binding domain in complex with 50s
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosome
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2004-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1w2bU00
3CCLV 1KQSU 3CC2V 2QEXV 4WFAV 3CPWU 1NJIW 5DM6V 1Q82W 1VQ8V 1VQ5V 1QVGU 1VQ9V 1YJNV 1K73W 3CXCU 1VQLV 1YIJV 1K8AW 1VQOV 2OTLV 1VQ7V 1VQ6V 3CMEV 1VQKV 1VQ4V 3I55V 1Q81W 1QVFU 3CCMV 1KC8W 3CC7V 1KD1W 3CC4V 3I56V 1R73A 3CCUV 1VQNV 4WCEV 3G71V 3CCQV 3G6EV 3CCVV 2QA4V 3G4SV 3CCRV 1YI2V 1YJ9V 3CCEV 1W2BU 4WFBV 1YHQV 1YITV 1YJWV 1Q7YW 1N8RW 3OW2U 1JJ2U 3CMAV 4WF9V 1VQMV 3CCJV 1Q86W 3CD6V 2OTJV 2D3OW 1S72V 3CCSV 1M1KW 1VQPV 1K9MW 1M90W
chains in the Genus database with same CATH superfamily
3S3WA 3SR2C 2LFSA 4F4LA 4X1IB 3WG7B 1YIJV 4GT1A 4I50B 3K0DA 3ZHUA 3WB0A 1PV0A 4R7CA 3D36C 1YJNV 2ZXWB 1TA8A 1MMMA 1F4MA 4TT3G 5EZYB 3AG3C 3K5OA 1VQPV 3KZIZ 3H9VA 3JAKB 3ABKB 2GSMB 5KLVH 4B7KA 3OTOO 2A06H 4LF4O 3ZRSA 2YI9A 1UPGA 3SYAA 1EZVH 3G67A 2RN9A 5LP6A 1KP3A 2ZIOA 3AK3A 4X66O 2XTAA 1H2MA 3MHHC 4WFBV 4I55A 2Q67A 1KQSU 2CGNA 3JCUZ 3RFRA 4MVOA 1AB3A 3AG1B 5IJ9B 3SYQA 5CBHA 5K1XA 3RYCB 2QA4V 2LW1A 3CCVV 3E8FA 1I94B 1KKCA 1SETA 1YHQV 4E2LA 2X6BA 1F7YA 3ZN1A 2R9IA 2BOCC 5JQGB 5ITZA 2IU3A 1D5NA 2QJ1A 2Q7HA 4LH6A 4CC5A 2BE3A 4LWSA 3GWOA 1QVFU 1NZ6A 1AJNA 2IJJA 3CEIA 2QWPB 4JAUA 3OT7A 2VWJA 4UVBA 3CCRV 5IY5B 3N2KA 4X62O 3TXQA 4QE7A 2JEXA 1HDJA 3L74H 5LYJA 5BMVB 1WA8B 4LF6B 1ENVA 4JI2O 4EFBA 1VQOV 2N74A 1FXKB 4DW0A 5EK0A 1S5HC 3JD4A 1U97A 5HFMA 5KHKA 2XASA 4N21A 5L3FA 3ZMUA 4JYBA 5CN0A 2YXLA 5FL7G 4FPPA 5CA1B 3ZHRA 3RYHA 2PTMA 4UFZA 2OTLV 2X6CA 1VQKV 4I9QA 5KA5A 3DXRA 3C3SA 4Q20A 5KHHA 5LXTA 1LUVA 1UFIA 4LF7O 3IJ4A 4DR5O 4CZZA 2JGDB 2FB5A 1MABG 1E1RG 1KYOF 3CXCU 2ZE7A 1H2GA 2Q73A 1QLEB 2EIJB 3J81N 1AP5A 5H5NA 5KMGB 5L3BA 3DSQA 3ZX6A 1NH2B 4DV3B 1J95A 5EYPB 1GN3A 2DYSB 3ML0A 4B3TB 2QTOA 1FKAO 1YSCA 4FM0A 3K59A 4NVPA 1VF5B 4CBCA 1YF2A 3KG2A 5LP6C 4U3JB 2JJ1G 4XDKA 3CWBH 3SPGA 1GM8A 3T1CA 4K0KB 4JTDB 1Z5VA 1N4CA 3RW0A 1G1XB 4JTCB 3Q4HB 3PJSK 4GUNA 1P49A 4F6RB 1JA8A 4JI1B 3IAYA 4X20A 3SPIA 2VQFB 4G2KA 2EINC 1HNWB 4OXSA 2BOBC 2LP7A 4LF9B 1E1QG 1L0LH 2FMLA 1JJ2U 1M56C 3HKCB 1P84F 1XREA 2DYRC 4YJ3A 3CCLV 1RSOB 1COWG 4K35A 5CA0B 2HHHB 4MVUA 3ABLC 2H8PC 2R9RB 1X59A 2HVJC 2QKSA 4IHJB 4J41A 5BR8B 1NVPD 1W2BU 3OGCC 4R8CA 1Z5WA 1Y74A 1S5LZ 2RQ6A 3LSUA 1XL4A 3VQVA 2PY5A 4J10A 4CS3A 4DW1A 5IJ0B 4X65O 3HPLC 3RN4A 2QDOA 2IJIA 2EILC 2PF4E 3STZC 2CTRA 5CBFA 3TCUA 1BHBA 1TVKB 4TWKA 4DRXA 1ZWIC 1THZA 4FFBB 1Q6UA 2QTSA 1KBHA 4D7SA 4YJ2A 4NKGB 3OTOB 3ZHTA 2P06A 3CMAV 2V1DA 1GRJA 4QJFB 1XQ8A 4BIOA 3M8AA 1OCCC 4WBNA 2DMXA 5C93A 3C90A 4MT8A 1GK9A 3E35A 2CAZC 4ZOLA 1LNQA 3ABTA 2KG7B 3CJHB 4P30A 2DQ0A 4TQDA 5JJEB 1V54B 4IL6Z 3CRMA 1E79G 2XAFA 4I7ZB 2XAGA 2GUZA 3HR0A 1K92A 4WFEA 3P3NA 4BW9A 3FB7C 3B77A 5FPRA 4O4HA 1OHHG 3H1IH 4O4IA 5KAIZ 5GTIZ 1HWYA 4I0XA 5CA3A 4LBEC 4O4LA 4HBNA 4CH6A 4BWAA 5EC2C 3W7XA 3BFRA 2P6JA 3N2GA 2JVDA 1JCHA 4NTYA 1DLBA 3OMIB 4IYHA 1M9NA 4X62B 2AW9A 5IWAB 5KUMA 1N36B 2ZM6O 1CXZB 2LJ2A 4UCSA 1AI6A 2OCCB 4MW3A 2EULA 4GCZA 4K8XA 2QM8A 4X1YB 3S3XA 3FB6C 1IZ3A 5IE9A 2WLNA 2QSAA 5B1AC 4H13B 3ICXA 3ETEA 3HB3B 1H2LA 2WLMA 5L3CA 2GBOA 2WLIA 2M7WA 1PD3A 3JYCA 5E1AC 3M7MX 4JAVA 3SJCC 1K5SA 3G6BA 5IYZB 2QWNB 4CS2A 5H2FZ 4DR6O 2A79B 2ZIMA 4YIPA 1H38A 1S77D 2KB1A 2PGGA 3IC7A 1JFFA 2GTAA 2QE7G 3BVOA 1FAFA 3FFQA 2HEPA 2EIKB 3ASOC 3K3WA 3ETQA 3LDEA 5LGUA 4FK5C 5FLXN 2F4VO 4DK0A 4LF6O 2GHYA 3HKEA 1WLEA 2V4DA 3ZRWB 2Y69B 3CP1A 1VF7A 2FYUH 1ZL8A 2P7TC 3K57A 4X89A 2WLLA 1B06A 3K04A 4O2BB 4TV9B 3F7VC 2BSKB 2A3QA 4PA3A 2YIBA 3QO5A 4O4JB 3X2QB 2UUCO 3JATB 2IH3C 3IGAC 1N0NA 2Q4PA 3ZRVA 4UV9A 3ASNB 1MSWD 1Y76A 3P3PA 5KX5A 1AR5A 3O9OA 1NKDA 2CGOA 4DR4O 2XUMA 4X1KA 2N05A 3CRCA 2LFRA 2QGNA 4QNHB 4GX5A 3GB7C 3T4ZA 1OCZB 5B5EZ 4B3MO 2QWRB 2BTQA 2ETNA 4X88A 2CH7B 2C2AA 2YUAA 1J5EO 5JVDB 4JGSA 5C8YB 2WA3A 1FXKC 5AG2A 4I4TB 5CMUA 2VS0A 3LUTB 1XMQO 1IURA 2JGUA 1NH2D 3HKBA 3JARA 2HG5C 4B3TO 1VARA 4B7EA 1SERA 2HJFC 2Q7GA 1AJQA 1I0HA 1Q82W 3ABUA 3E22B 1N33O 3E89A 4TV8A 4FLYA 2UUAO 3EXAA 1R6TA 3J80N 2XT9A 4KFMA 1I7FA 4X65B 2JS3A 2NNUA 4ZI7A 1R3LC 3ZEDA 4J42A 4PI0A 3B8MA 4WFGA 2QM7A 4RAIA 1K97A 1CP9A 2QWQB 4GX1A 4NB5A 2QM4A 1FFXA 2RDCA 3N27A 4JAAA 2ZKOA 1QLEC 3RYFB 2EIMC 3SYOA 3A2FA 2WLHA 3RYIA 2B1IA 5D5QA 4RQFA 3SPHA 2HFEC 3CRAA 4H37A 3A0HZ 5H9CA 4JI3B 1IDSA 5GTHZ 5KHGA 3EVKA 1V55C 2A9HA 2XAJA 3W7SA 4XDJA 2ZINA 3B40A 3EHBB 3R66A 4MVRA 5J2TB 1QNMA 2JDIG 2ZR2A 3AG2B 3MHSC 1K33A 4ZHQB 1Y67A 1S76D 4UCVA 2D3OW 2Q68A 2WLKA 1WN7A 2V7QG 3K5MA 1XL6A 5FNVB 4LC1A 5J9PC 4DR7B 3CRRA 3P32A 5LBQA 2E76B 3BCCH 1WP7A 1OCRC 3HKDB 5J2UA 1FXVA 3UT5B 2UU9O 3UO3A 5K1PA 4LFCO 3ZMZA 2OT5A 1NTKH 3BHPA 3OEEG 4YIOA 3SYPA 1BT8A 1QQCA 2W6IG 3L75H 4UVCA 4LFBB 1XEQA 1SQGA 2ZM6B 1AR1B 1RM1C 1NS1A 3OMAB 2GV9A 1XUQA 4IIJB 1N34O 3FYIB 1OJHA 4JZGA 4PD4F 1ORQC 3K9SA 1QLNA 1S0VA 5BY1A 1Q6HA 4H44B 3ETGA 3JAWA 1PNKA 1ZSPA 3VQXA 2VQEO 4U3FH 4AHCA 2B1GA 5CB4B 4IYIA 2Z5UA 1W59A 5EBLC 1SQVH 4DR6B 3ABMB 1SC5B 3MDSA 4MVSA 1TUBA 1XI1A 5IWAO 4FM2A 1N36O 4DV5B 2CTWA 5L3DA 3THOA 1JQ0A 1KUQA 1VQ9V 2F4VB 4XBFA 1K73W 4P9OA 1K8AW 3ZHSA 4BIZA 3CMEV 1Q43A 3CRQA 2ZE6A 1PNMA 4GYCB 4JF3A 3JASA 4AQYB 3LSQA 4UB6Z 2P5OA 3QTCA 1M5IA 1HR0O 1B3QA 1QBZA 1GMGA 1NTZH 3QO8A 4PA7A 4J9YB 2UXBO 1YEWA 2Y4UA 2UUCB 4HNAA 1PPJH 1N32O 3MAQA 2M6YA 3M99B 5H6RA 3OAAG 4LCUC 2EJRA 3IFXA 4QIWF 4NR1A 4J11A 5EBMC 2PI5A 4DR4B 3JALA 3G71V 1QHTA 3UO2A 2UXXA 1WNSA 2NR5A 3B8NA 4JPRA 3K08A 1Y4MA 3LDCA 4B3MB 2NLJC 3UCSC 3LDDA 3UKMA 1PM9A 5LOVA 2YIAA 4B3RO 1JJOA 1H2NA 1M4UA 1NI8A 3CHXA 1YTFB 2YI8A 5GONB 3G6EV 2XHBA 1YITV 2BCCH 1J5EB 5B66Z 4MS2A 4UV8A 2MK3A 4WFAV 4R6ZA 2PUSA 1XMQB 3H1HH 4H33A 1VQ6V 4UCTA 2Q7EA 2HLDG 2JJ2G 3L71H 1IXBA 3CC7V 3BEHA 1D2DA 3OTFA 2Q6AA 3OE7G 2O57A 2UXNA 3E8GA 4G27B 1AVMA 3ETDA 2Q5ZA 4MW8A 2FL4A 4X1IA 3AG4B 1N33B 1FYJA 2F95B 3FB8C 1WB8A 2WLJA 1I5XA 3JSNA 2UUAB 1OCOC 4I50A 3RVYA 1QVGU 1OZ0A 1VQ4V 3H1JH 1JMKC 1D5AA 1IVSA 5EZYA 1KD1W 1DTOA 2A7WA 1OV9A 3I56V 1R3JC 4O2AB 4OGQB 2Y69C 3CCEV 3JAKA 2ADPA 1SS3A 3A0BZ 1Y66A 3AG3B 4EB6B 4B3SO 4J7KA 2W0XA 4JI5O 3WB2A 4J7JA 1URFA 3ASNC 3KCYA 4X64B 1EN4A 4EKWA 2DJVA 3FAVB 1JX9A 1Q86W 3E8HA 1K5QA 1SA0B 1TUEB 3U11A 1I5YA 2EX3A 2JS5A 4K8ZA 1ZLZA 4JI4O 5IJ9A 1OCZC 2CTQA 2Y0IA 1VF6A 1VQ7V 1HNXB 3RYCA 5F2VO 4DV0O 2P67A 3T1YB 1R73A 1VQNV 3AEIA 5B1BB 2ATKC 5JQGA 3CD6V 2FTKA 4FLZA 4ABMA 3OGIB 1MZFA 4LFAO 3CYOA 4DR3O 5A9GA 4RQEA 2UU9B 4QE9A 1YVWA 3QNEA 1AJPA 1WPBA 3ZN0A 4LFCB 4JI3O 3I55V 1KC8W 3NXSA 1YXBA 4LNUB 2F66C 5KAFZ 4FLUA 2AZ2A 1PL0A 5BMVA 1WA8A 3D8CA 1FXKA 2WSSG 1N34B 2WWWA 2EBOA 3K5NA 2QR4A 1IX9A 4PDLA 2EZPA 3SGIA 2ITDC 2X7RB 4DR7O 1IBMO 3OW2U 5CA1A 2VQEB 2YEVB 4JI6B 1S72V 2R70A 4OX9O 1VIBA 4J9ZB 1F51A 1NU1H 1IXMA 5B3SC 5JH7B 3QVNA 3JCZA 1BE3H 4PA4A 2OCHA 3OD4A 4LFBO 3BAAA 2PZSA 1TGOA 1R3IC 1XDCA 2JGDA 1MOFA 2E3CA 4TUYB 4CH3A 3WG7C 4C7UA 2HP8A 2KSDA 4BR6A 1VQ8V 1RFYA 1HR0B 3BY6A 1X4TA 4OPHA 3AG2C 4E4EA 5KMGA 2ZXWC 1W0KG 2UXBB 4L87A 1ZUQA 4DV6B 1N32B 4CH5A 5EYPA 3ABKC 4YXWG 4TOIA 2LW7A 4BAYA 1EN6A 2JK5C 4DV5O 4MSWC 4U3JA 4FJCC 3PN1A 4Z1VA 3K03A 2AXTZ 1US6A 4DV1O 3LNMB 5LP6B 1AILA 4AQYO 3T1HB 1M1KW 2XOKG 3Q4HA 4B3RB 4I55B 4F6RA 4FZ1A 2RNBA 3AG1C 2EZOA 4DUZO 1B6QA 3VQYA 4U7OA 4LH7A 1FD9A 1NR1A 1VF6C 1QCEA 3L9DA 3CCUV 2ODMA 3ZS8C 3HKCA 2EINB 3FB5C 3KCXA 5EIBD 1MZEA 1RSOA 5CA0A 4DUYB 1TAEA 1M56B 1GH6A 1JPXA 2VRZA 3JD2A 3FX7A 3GWKC 2YXYA 4D7TA 1EN5A 3QO7A 2PYLA 4IHJA 2CDYA 4CH4A 4PA6A 3OUSA 1S3JA 5ITZB 3ABLB 1R6KA 4LWSB 2DOSA 5IY5C 1MA1A 3OUFA 3JD1A 1K7DA 5IJ0A 5EC1C 2BTOA 4TQFA 1AI4A 1XILA 4NXNB 1CEZA 3N2KB 1O9HA 4QPJA 1TVKA 2IM9A 1G8MA 3TJTA 1YTFD 4NTWA 1AR4A 4FFBA 1VQLV 2EILB 2Y4TA 1GM9A 5LYJB 3F5TA 3RVZA 1NT2B 3D3IA 4PI2A 1M57B 5E79Z 3JASB 4FLTA 3UQ8A 4B3SB 2ZE8A 1Q7YW 4Z2WA 1H2KA 3AK2A 1PKXA 1FJGB 4JI5B 3CXHF 3CC2V 3SPJA 1Q5OA 3CJHA 2KG7A 1OCCB 4UCOA 3SJAC 4I9WA 3RYHB 3G80A 4G28B 4YHHO 2HKOA 4LR3A 3JD0A 3DXRB 4KXRA 5LMUO 4JI4B 5LXTB 5LL6Y 5GW7A 1KP2A 1ZAUA 4DV0B 1HW7A 3W7TA 4UVAA 2P22C 1K4DC 3K5LA 1KECA 4JV5O 2EIJC 3K79A 5HFLA 3ZMSA 3SJQC 4JI7O 4JI0O 4LFAB 4DR3B 3P30A 4JYCA 4X64O 4HAMA 2DYSC 5LGNA 4JI8B 1U96A 3OM3B 2L6LA 2A0LA 1ZX3A 3W7UA 4ZKIA 3U10A 4YY3B 1L0NH 1FS0G 3L72H 4X1YA 3RGBA 1YI2V 1HNXO 5A2QN 4KL1A 4BW5A 3T1YO 3TETA 1K9MW 3SDLA 3ZMVA 2E5LO 4LF8B 5B1AB 2GDSA 4EEQA 1B04A 3T2MA 2Z3YA 5BXZA 3DGEA 1ROPA 2OWOA 2CK3G 1KU9A 4H0LB 5IYZA 1IBMB 2LO1A 4EFEA 2RMKB 4OX9B 3H01A 1KMIZ 4FIPC 1MNGA 4X20B 3FYEB 3SJBC 2YIDA 3CS5A 1NR7A 4MVQA 5BZBA 4GKKB 3LSSA 4W4KA 4PJ0Z 4QPKA 4YJ3B 1PL4A 2YSUB 3CC4V 3ZRWA 2F23A 2W0FC 3ASOB 4NXMO 2ZDIC 1WAZA 1GTOA 4LP8A 2UXDB 1O9GA 2UUBO 4O2BA 3TGUH 3AK1A 4TV9A 2H3OA 1H8EG 1JR9A 2BSKA 5D5PA 4D6TH 1Y74B 1RP3B 1R6NA 4O4JA 2IJHA 1G6UA 3JSLA 2F1MA 1CPYA 5IYBO 3JATA 4UXNA 3OEHG 4JI6O 1LR1A 2VWKA 1RPOA 1XBLA 2R72A 1XMOO 4DRXB 4B08A 2KKWA 5B1BC 5KHIA 3DC5A 3JD3A 4WFHA 2X0LA 1XNQB 3L70H 2E75B 4YJ2B 1EFRG 4RWUA 1BSMA 5L3EA 3AG7A 4BIUA 4DV1B 1K3EA 1NQTA 2NN4A 4WBNB 5LMNB 3CCMV 3UM7A 1V54C 2ZT9B 1GM7A 2CH7A 1P7BA 4GX2A 4ZOLB 2IBZH 3A8TA 1GN2A 5LA6A 4DUZB 1SZXA 5JVDA 2HJDA 5C8YA 3F5WC 3T4DA 2OYQA 4FLVA 1BQZA 2K1EA 4I4TA 2YS8A 4DV6O 2GUZB 1BQ0A 1WB7A 5IDJA 2OIEA 3TXSA 2DWEC 2RCVA 4FMTA 3U0ZA 1BCCH 4O4HB 3SPCA 4DV2O 4O4IB 3FD9A 2H94A 3A0RA 4MTXA 1Q8IA 2GTSA 4I0XB 1IBLB 3ZCCA 4O4LB 3MD0A 4TSFG 3E22A 5LHGA 2AZ0A 4DXWA 3OR7C 5L3GA 4UB8Z 4DV7O 5LHIA 3T1HO 3BA8A 2P90A 2ZNJA 1M93A 3N2GB 3QF7A 2RJZA 1HNZO 3QG5A 1EBOA 2UXCB 3APOA 1MSDA 4NYKA 2OCCC 2F43G 5JCOC 3ZJZA 1SESA 4WF9V 2PYJA 4DYLA 4UUJC 3CCSV 4LF5O 3CPWU 4ICGA 3RYFA 1SZTA 2IJKA 3K0GA 4JYAO 2F93B 5LHHA 4DUYO 2HVKC 4GX0A 4X9QA 5JJNB 1UJWB 2EIMB 3K58A 2XAHA 2E74B 2WLIB 5KUKA 1SKVA 3E83A 4N23A 4KHPO 4JZ2A 3B4SA 2DN9A 4X8AA 1PNLA 4GKJB 3OFNG 5J2TA 4YHHB 1AI7A 1V55B 2Z0AA 3K06A 4OPAA 1FPOA 4NXNO 5LMUB 1PP9H 2AHZA 2EIKC 2YC0A 5DN6G 1JFFB 3I5DA 4MVZA 1K34A 4ZHQA 3CE2A 2P4VA 4DR1O 2PI4A 2ZD9A 4WCEV 4I5SA 3WFVA 1H8HG 3FKSG 3DC6A 1N8RW 4KUMA 3J7AU 3HKEB 4NTXA 5DEDA 4P9PA 2YICA 4Q6GA 3ZHQA 1SRYA 5FNVA 4RUFA 4JV5B 2DE0X 3L73H 1EM1A 1ZL8B 3HKDA 3X2QC 2WLLB 1FJGO 2Q0AA 4JI7B 4JI0B 3UT5A 1GN4A 3RWRD 5FPOA 1OCRB 3STLC 1H2SB 2Q69A 2QWOB 4W4LA 1XOUA 2JRIA 4MVMA 2Q8VA 3CCJV 2OTJV 1Y76B 3VBBA 4CS4A 2IW5A 5KX5B 4DR2O 2ZNIA 1YZBA 1F23A 5H6QA 1DK1A 3DTUB 4X1KB 1XHZA 4IIJA 4IGGA 2KQXA 1RM1B 3RBZA 1BL8A 2ARHA 4DV4O 1BZKA 2ZE5A 2E5LB 2LGQA 2JEUA 2BTQB 5KHJA 1IBKO 3C3TA 1WPXA 3LNNA 3ZMTA 5CB4A 2ZQMA 1L1FA 3BRCA 3E2EA 1BS3A 2AHYA 2L35A 1M57C 1RPRA 1T5EA 1ZTEA 4JI8O 4K3AA 2WPDG 1LUWA 1N0JA 1P7GA 3K9AA 4LF4B 4YY3O 3HKBB 1GN6A 3JARB 1QR9A 3NR7A 1NBMG 1XNRO 1M90W 4JASA 2G38A 4X66B 1EZJA 4U7NA 4ZIBA 4NXMB 2LQTA 2UUBB 4MTGA 4LF8O 3RT3C 1FXHA 4TV8B 1SQPH 3CCQV 2QKCA 4PELA 4FVMA 1JOYA 1Q3EA 1YCIA 1MG1A 4ZI7B 2CUGA 1KB9F 1XMOB 1VMGA 1SF9A 3OR6C 3D3QA 2AGAA 2W6JG 3B09A 4GKKO 1FFXB 5B1NA 1DGSA 1F4NA 1R3KC 3IC9A 2K9PA 1DF5A 3CB2A 1KKDA 4CC6A 3RYIB 2FKXA 4XDLA 4FLWA 3F7YC 5IYCO 2UXDO 2QKAA 5GONA 3APQA 3JAMN 1QR8A 3R65A 3OMNB 2EJ7A 4QGPA 3TK1A 4FFKA 2N04A 3E86A 4GZRB 2YDEA 2IU0A 4JI2B 1BMFG 1GO3F 4Z1MG 1V9PA 1I94O 1K4CC 2HR3A 2JIZG 1VQ5V 4DV2B 2CE4A 4P2ZA 1XNQO 1VEWA 3WU2Z 3CX5F 4PDVA 4PDRA 5JWPA 4DV7B 2OIGA 3B2EE 5J2UB 5LMNO 2ZCEA 2WAMA 1BGYH 2YXHA 1HNZB 1NJIW 1YDXA 1OCOB 2IH1C 1R1BA 1Y6XA 4R50A 4O2AA 1SQFA 4L8JA 3D36A 3ZRXA 3BA9A 5CBGA 4LF7B 2DW4A 1AI5A 4J7ZA 3SYCA 4DR5B 4A5UB 4LF5B 3W7WA 3G4SV 2ITCC 4HZ3A 1JVMA 1WP8A 4EB6A 4GLXA 4FLXA 2B5UA 3KKYA 4JYAB 3O65A 3VQWA 2DYRB 2CTPA 1IBLO 3JAWB 1AROP 4KHPB 3FAVA 2ZDIA 2MW2B 4ASUG 3ABMC 1SA0A 2R9AA 3ZIAG 3VOUA 1GAXA 1YJWV 3GVMA 4RUEA 1VQMV 4PV1B 2ZR3A 4DK1A 4AILC 2UXCO 4MTOA 1TUBB 4FZ0A 1A32A 5IYDO 5EBWC 1VP7A 2D2CB 3ZBHA 4DR1B 1L8DA 5LGTA 1Q81W 2X6AA 4FM1A 2Y48A 1BHAA 5LA6B 5EIBC 3ZHVA 1I08A 5B1OA 1SQXH 2Q9LA 4HNAB 4LNUA 4DV3O 3EFFK 1QU7A 4GKJO 1DF4A 5TISZ 4DR2B 1XHXA 4PA9A 2ADQB 2WA4A 3JALB 4JYYA 4UCRA 5KA6A 4HYOA 1NVPB 2XNDG 1Z2GA 3E8BA 2QEXV 5JJJB 5DM6V 4RO2A 4DV4B 3CSXA 4K0KO 1G4YB 1SQQH 3BPZA 4IT5A 2YEVA 1Q6IA 5LOVB 1IBKB 1P4RA 1NTMH 4DO2A 4PDMA 1HP8A 2Q0OC 1SQBH 4UCUA 4MTFA 4JI1O 2DWDC 5IT9N 2LGWA 2Y0PA 3H1LH 2VQFO 1HNWO 4KP4A 2P4KA 5JH7A 4F6EA 4LF9O 2XAQA 2YIBD 2B9ZA 4J80A 1WJZA 1AP6A 5B3SB 3WB1A 1GKFA 3BABA 5DECA 2HHHO 1XNRB 1W0JG 1S5JA 5JCOA 4ZBMA 4AI8A 1YJ9V 1Q90D 2DQ3A 4TUYA 4JTAB 1FFTB 3AG4C 4WFFA 2ILMA 3H1KH 5BR8O 4PHZA
chains in the Genus database with same CATH topology
2LFSA 4X89A 2WLLA 4DXWA 3K04A 3OR7C 4F4LA 5L3GA 3F7VC 3WG7B 3CYOA 5LHIA 4PA3A 4RQEA 1YIJV 3QO5A 2P90A 4QE9A 3QNEA 1AJPA 3X2QB 3ZN0A 4GT1A 3I55V 2IH3C 3K0DA 1KC8W 3NXSA 3IGAC 3ZRVA 4R7CA 4UV9A 1EBOA 3ASNB 1MSWD 1YJNV 2ZXWB 2OCCC 1F4MA 2F43G 4TT3G 3ZJZA 1SESA 4WF9V 1PL0A 3AG3C 4UUJC 1NKDA 3CCSV 1VQPV 3ABKB 2GSMB 3CPWU 2LFRA 4QNHB 1SZTA 4GX5A 1FXKA 3ZRSA 2IJKA 3GB7C 3T4ZA 2WSSG 3K0GA 1OCZB 5LHHA 2WWWA 2EBOA 3SYAA 2HVKC 4GX0A 1UJWB 2EIMB 1KP3A 2XAHA 2WLIB 4PDLA 5KUKA 3MHHC 2EZPA 3E83A 2ITDC 2X7RB 4N23A 4WFBV 3OW2U 2Q67A 2YEVB 4X88A 1S72V 4X8AA 1KQSU 2C2AA 1PNLA 4J9ZB 3OFNG 4JGSA 1F51A 1AI7A 1V55B 3K06A 1IXMA 4MVOA 3AG1B 5B3SC 1FXKC 3JCZA 2AHZA 4PA4A 2EIKC 5CMUA 3LUTB 3SYQA 5CBHA 5DN6G 4MVZA 1K34A 1NH2D 2PI4A 2ZD9A 4WCEV 2HG5C 4I5SA 1R3IC 3CCVV 2QA4V 3E8FA 1H8HG 3WFVA 3FKSG 1SETA 1YHQV 4E2LA 1N8RW 4KUMA 1MOFA 2X6BA 4P9PA 1SRYA 1SERA 4RUFA 2HJFC 3ZN1A 3WG7C 1AJQA 2R9IA 2BOCC 1Q82W 2IU3A 1VQ8V 3ABUA 3E89A 3X2QC 2WLLB 3BY6A 3GWOA 1QVFU 3AG2C 1AJNA 2IJJA 1OCRB 4JAUA 2ZXWC 4KFMA 1W0KG 3STLC 2Q69A 2NNUA 4UVBA 3CCRV 4L87A 5IY5B 1R3LC 3B8MA 4MVMA 4WFGA 3CCJV 2OTJV 3VBBA 4QE7A 2JEXA 2QM7A 3ABKC 4RAIA 2IW5A 1K97A 1CP9A 4GX1A 1F23A 5H6QA 3DTUB 4YXWG 1ENVA 1VQOV 4BAYA 1QLEC 2EIMC 2JK5C 3SYOA 4MSWC 1FXKB 1RM1B 3RBZA 1BL8A 2WLHA 4FJCC 5EK0A 1S5HC 2B1IA 3JD4A 4RQFA 5HFMA 3K03A 2XASA 4N21A 5L3FA 3LNMB 3SPHA 2HFEC 4H37A 3ZMUA 4JYBA 5CN0A 1M1KW 2JEUA 5H9CA 2XOKG 5FL7G 4FPPA 1WPXA 3ZMTA 2ZQMA 1V55C 2A9HA 2XAJA 3AG1C 2EZOA 4XDJA 1L1FA 3EHBB 1B6QA 3W7SA 2X6CA 2OTLV 3E2EA 1VQKV 4MVRA 4U7OA 2AHYA 1NR1A 5KA5A 1M57C 1RPRA 4Q20A 1QCEA 2JDIG 2ZR2A 3CCUV 3AG2B 2WPDG 3MHSC 1K33A 3K9AA 2EINB 3FB5C 1S76D 1QR9A 2D3OW 1NBMG 2Q68A 2WLKA 2V7QG 1M90W 1M56B 4CZZA 4JASA 1JPXA 3JD2A 1MABG 1EZJA 1E1RG 1XL6A 4LC1A 4U7NA 3QO7A 3CXCU 5J9PC 3P32A 4PA6A 3OUSA 1S3JA 5LBQA 3ABLB 4MTGA 1H2GA 1OCRC 1FXHA 1QLEB 2EIJB 1FXVA 1R6KA 3CCQV 5IY5C 3OUFA 3JD1A 1K7DA 4PELA 5EC1C 3ZMZA 5L3BA 2OT5A 3OEEG 1JOYA 1AI4A 1NH2B 3SYPA 1CEZA 1MG1A 2W6IG 1J95A 4QPJA 1G8MA 2DYSB 3ML0A 4UVCA 1YTFD 1VQLV 3OR6C 2EILB 2QTOA 1GM9A 1AR1B 3RVZA 2W6JG 1YSCA 1RM1C 3OMAB 3D3IA 5B1NA 1F4NA 1R3KC 4CBCA 3KG2A 1M57B 1DF5A 1KKDA 2JJ1G 3FYIB 4XDKA 1Q7YW 3SPGA 1ORQC 1GM8A 1PKXA 4XDLA 1QLNA 1S0VA 3T1CA 3F7YC 4JTDB 5IYCO 3CC2V 3ETGA 3SPJA 1PNKA 3RW0A 4JTCB 1OCCB 3PJSK 2B1GA 4I9WA 4G28B 1QR8A 2Z5UA 5EBLC 2HKOA 3SPIA 3R65A 3OMNB 4G2KA 2EINC 3TK1A 3JD0A 3ABMB 4OXSA 2BOBC 3E86A 2LP7A 4MVSA 1E1QG 2IU0A 5GW7A 1JJ2U 1M56C 1BMFG 1GO3F 4Z1MG 3CCLV 1KP2A 2DYRC 1K4CC 1COWG 5L3DA 4UVAA 2HR3A 2JIZG 1JQ0A 3W7TA 1K4DC 1VQ5V 1VQ9V 4P2ZA 4XBFA 4MVUA 1KECA 4P9OA 1K73W 1K8AW 4BIZA 3CMEV 3ABLC 2H8PC 2R9RB 5LHGA 1PNMA 2EIJC 3K79A 4JF3A 3LSQA 2HVJC 2QKSA 5HFLA 3ZMSA 4PDVA 3SJQC 1NVPD 4PDRA 1W2BU 3OGCC 1QBZA 4R8CA 1GMGA 1XL4A 3QO8A 4PA7A 3P30A 2WAMA 4JYCA 4J9YB 3HPLC 4HAMA 2DYSC 5LGNA 1NJIW 3M99B 1OCOB 2IH1C 2IJIA 2EILC 3OM3B 3STZC 2A0LA 3OAAG 5H6RA 5CBFA 3TCUA 1BHBA 4LCUC 4R50A 4TWKA 4ZKIA 3W7UA 1ZWIC 1THZA 3D36A 2EJRA 3ZRXA 3IFXA 1FS0G 4QIWF 5CBGA 2DW4A 1AI5A 3SYCA 5EBMC 2PI5A 3G71V 3W7WA 3G4SV 1YI2V 2ITCC 4HZ3A 1JVMA 2UXXA 3CMAV 4BW5A 2B5UA 3B8NA 2V1DA 4JPRA 3TETA 4QJFB 1K9MW 3ZMVA 3K08A 1Y4MA 5B1AB 2DYRB 3LDCA 1OCCC 2NLJC 3T2MA 2Z3YA 3DGEA 5C93A 3UKMA 3LDDA 4MT8A 1AROP 1ROPA 1GK9A 3E35A 2CK3G 1LNQA 3ABTA 4P30A 1YTFB 2DQ0A 2ZDIA 4ASUG 3ABMC 3H01A 3G6EV 1V54B 3ZIAG 3VOUA 4FIPC 1YITV 1YJWV 1E79G 2XAFA 3FYEB 4RUEA 1VQMV 1NR7A 2XAGA 2ZR3A 4MVQA 1K92A 4WFEA 5BZBA 4MS2A 4MTOA 4UV8A 2MK3A 4WFAV 3LSSA 4R6ZA 5IYDO 5EBWC 4QPKA 3FB7C 4H33A 3B77A 2YSUB 1VQ6V 1OHHG 5LGTA 1Q81W 2HLDG 2JJ2G 1HWYA 3CC7V 3CC4V 2X6AA 3ZRWA 2W0FC 3BEHA 5CA3A 3ASOB 4LBEC 2Q6AA 2ZDIC 3OE7G 1GTOA 2UXNA 4LP8A 3E8GA 4G27B 3ETDA 4MW8A 2Y48A 5EC2C 1H8EG 3AG4B 1BHAA 3W7XA 3FB8C 2WLJA 1R6NA 1I5XA 2P6JA 2IJHA 1OCOC 5B1OA 1JCHA 1CPYA 3RVYA 5IYBO 1QVGU 4UXNA 1OZ0A 3OEHG 1DLBA 3OMIB 1RPOA 1VQ4V 3EFFK 1M9NA 1KD1W 1DTOA 5KUMA 3I56V 1DF4A 1R3JC 2Y69C 5B1BC 3CCEV 1AI6A 2OCCB 4MW3A 4PA9A 4GCZA 3JD3A 4WFHA 2QM8A 2X0LA 3FB6C 5KA6A 1Y66A 3AG3B 4HYOA 1EFRG 1NVPB 2WLNA 2XNDG 5B1AC 3E8BA 2QEXV 5L3EA 5DM6V 4RO2A 3ETEA 3HB3B 4BIUA 2WLMA 5L3CA 1K3EA 1NQTA 2WLIA 2M7WA 1PD3A 3JYCA 3ASNC 5E1AC 3CCMV 3UM7A 1G4YB 4JAVA 4EKWA 1V54C 2YEVA 1GM7A 1K5SA 1P7BA 4GX2A 1P4RA 4DO2A 4PDMA 1JX9A 4MTFA 1Q86W 2DWDC 1K5QA 3E8HA 1TUEB 3F5WC 1I5YA 2A79B 3T4DA 4KP4A 1H38A 2K1EA 2XAQA 1S77D 1OCZC 2KB1A 3IC7A 5IDJA 2DWEC 1VQ7V 4FMTA 5B3SB 2QE7G 2P67A 1GKFA 3LDEA 2EIKB 3ASOC 3K3WA 3SPCA 5LGUA 4FK5C 1R73A 1VQNV 1W0JG 2GHYA 3AEIA 1WLEA 2H94A 1YJ9V 4ZBMA 3A0RA 2DQ3A 4MTXA 3ZRWB 4JTAB 2Y69B 1FFTB 3AG4C 3CP1A 2ATKC 4WFFA 5B1BB 3ZCCA 3CD6V 2FTKA 3MD0A 4TSFG 2P7TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL V;  1KQS U;  3CC2 V;  2QEX V;  4WFA V;  3CPW U;  1NJI W;  5DM6 V;  1Q82 W;  1VQ8 V;  1VQ5 V;  1QVG U;  1VQ9 V;  1YJN V;  1K73 W;  3CXC U;  1VQL V;  1YIJ V;  1K8A W;  1VQO V;  2OTL V;  1VQ7 V;  1VQ6 V;  3CME V;  1VQK V;  1VQ4 V;  3I55 V;  1Q81 W;  1QVF U;  3CCM V;  1KC8 W;  3CC7 V;  1KD1 W;  3CC4 V;  3I56 V;  1R73 A;  3CCU V;  1VQN V;  4WCE V;  3G71 V;  3CCQ V;  3G6E V;  3CCV V;  2QA4 V;  3G4S V;  3CCR V;  1YI2 V;  1YJ9 V;  3CCE V;  1W2B U;  4WFB V;  1YHQ V;  1YIT V;  1YJW V;  1Q7Y W;  1N8R W;  3OW2 U;  1JJ2 U;  3CMA V;  4WF9 V;  1VQM V;  3CCJ V;  1Q86 W;  3CD6 V;  2OTJ V;  2D3O W;  1S72 V;  3CCS V;  1M1K W;  1VQP V;  1K9M W;  1M90 W; 
#chains in the Genus database with same CATH topology
 3S3W A;  3SR2 C;  2LFS A;  4F4L A;  4X1I B;  3WG7 B;  1YIJ V;  4GT1 A;  4I50 B;  3K0D A;  3ZHU A;  3WB0 A;  1PV0 A;  4R7C A;  3D36 C;  1YJN V;  2ZXW B;  1TA8 A;  1MMM A;  1F4M A;  4TT3 G;  5EZY B;  3AG3 C;  3K5O A;  1VQP V;  3KZI Z;  3H9V A;  3JAK B;  3ABK B;  2GSM B;  5KLV H;  4B7K A;  3OTO O;  2A06 H;  4LF4 O;  3ZRS A;  2YI9 A;  1UPG A;  3SYA A;  1EZV H;  3G67 A;  2RN9 A;  5LP6 A;  1KP3 A;  2ZIO A;  3AK3 A;  4X66 O;  2XTA A;  1H2M A;  3MHH C;  4WFB V;  4I55 A;  2Q67 A;  1KQS U;  2CGN A;  3JCU Z;  3RFR A;  4MVO A;  1AB3 A;  3AG1 B;  5IJ9 B;  3SYQ A;  5CBH A;  5K1X A;  3RYC B;  2QA4 V;  2LW1 A;  3CCV V;  3E8F A;  1I94 B;  1KKC A;  1SET A;  1YHQ V;  4E2L A;  2X6B A;  1F7Y A;  3ZN1 A;  2R9I A;  2BOC C;  5JQG B;  5ITZ A;  2IU3 A;  1D5N A;  2QJ1 A;  2Q7H A;  4LH6 A;  4CC5 A;  2BE3 A;  4LWS A;  3GWO A;  1QVF U;  1NZ6 A;  1AJN A;  2IJJ A;  3CEI A;  2QWP B;  4JAU A;  3OT7 A;  2VWJ A;  4UVB A;  3CCR V;  5IY5 B;  3N2K A;  4X62 O;  3TXQ A;  4QE7 A;  2JEX A;  1HDJ A;  3L74 H;  5LYJ A;  5BMV B;  1WA8 B;  4LF6 B;  1ENV A;  4JI2 O;  4EFB A;  1VQO V;  2N74 A;  1FXK B;  4DW0 A;  5EK0 A;  1S5H C;  3JD4 A;  1U97 A;  5HFM A;  5KHK A;  2XAS A;  4N21 A;  5L3F A;  3ZMU A;  4JYB A;  5CN0 A;  2YXL A;  5FL7 G;  4FPP A;  5CA1 B;  3ZHR A;  3RYH A;  2PTM A;  4UFZ A;  2OTL V;  2X6C A;  1VQK V;  4I9Q A;  5KA5 A;  3DXR A;  3C3S A;  4Q20 A;  5KHH A;  5LXT A;  1LUV A;  1UFI A;  4LF7 O;  3IJ4 A;  4DR5 O;  4CZZ A;  2JGD B;  2FB5 A;  1MAB G;  1E1R G;  1KYO F;  3CXC U;  2ZE7 A;  1H2G A;  2Q73 A;  1QLE B;  2EIJ B;  3J81 N;  1AP5 A;  5H5N A;  5KMG B;  5L3B A;  3DSQ A;  3ZX6 A;  1NH2 B;  4DV3 B;  1J95 A;  5EYP B;  1GN3 A;  2DYS B;  3ML0 A;  4B3T B;  2QTO A;  1FKA O;  1YSC A;  4FM0 A;  3K59 A;  4NVP A;  1VF5 B;  4CBC A;  1YF2 A;  3KG2 A;  5LP6 C;  4U3J B;  2JJ1 G;  4XDK A;  3CWB H;  3SPG A;  1GM8 A;  3T1C A;  4K0K B;  4JTD B;  1Z5V A;  1N4C A;  3RW0 A;  1G1X B;  4JTC B;  3Q4H B;  3PJS K;  4GUN A;  1P49 A;  4F6R B;  1JA8 A;  4JI1 B;  3IAY A;  4X20 A;  3SPI A;  2VQF B;  4G2K A;  2EIN C;  1HNW B;  4OXS A;  2BOB C;  2LP7 A;  4LF9 B;  1E1Q G;  1L0L H;  2FML A;  1JJ2 U;  1M56 C;  3HKC B;  1P84 F;  1XRE A;  2DYR C;  4YJ3 A;  3CCL V;  1RSO B;  1COW G;  4K35 A;  5CA0 B;  2HHH B;  4MVU A;  3ABL C;  2H8P C;  2R9R B;  1X59 A;  2HVJ C;  2QKS A;  4IHJ B;  4J41 A;  5BR8 B;  1NVP D;  1W2B U;  3OGC C;  4R8C A;  1Z5W A;  1Y74 A;  1S5L Z;  2RQ6 A;  3LSU A;  1XL4 A;  3VQV A;  2PY5 A;  4J10 A;  4CS3 A;  4DW1 A;  5IJ0 B;  4X65 O;  3HPL C;  3RN4 A;  2QDO A;  2IJI A;  2EIL C;  2PF4 E;  3STZ C;  2CTR A;  5CBF A;  3TCU A;  1BHB A;  1TVK B;  4TWK A;  4DRX A;  1ZWI C;  1THZ A;  4FFB B;  1Q6U A;  2QTS A;  1KBH A;  4D7S A;  4YJ2 A;  4NKG B;  3OTO B;  3ZHT A;  2P06 A;  3CMA V;  2V1D A;  1GRJ A;  4QJF B;  1XQ8 A;  4BIO A;  3M8A A;  1OCC C;  4WBN A;  2DMX A;  5C93 A;  3C90 A;  4MT8 A;  1GK9 A;  3E35 A;  2CAZ C;  4ZOL A;  1LNQ A;  3ABT A;  2KG7 B;  3CJH B;  4P30 A;  2DQ0 A;  4TQD A;  5JJE B;  1V54 B;  4IL6 Z;  3CRM A;  1E79 G;  2XAF A;  4I7Z B;  2XAG A;  2GUZ A;  3HR0 A;  1K92 A;  4WFE A;  3P3N A;  4BW9 A;  3FB7 C;  3B77 A;  5FPR A;  4O4H A;  1OHH G;  3H1I H;  4O4I A;  5KAI Z;  5GTI Z;  1HWY A;  4I0X A;  5CA3 A;  4LBE C;  4O4L A;  4HBN A;  4CH6 A;  4BWA A;  5EC2 C;  3W7X A;  3BFR A;  2P6J A;  3N2G A;  2JVD A;  1JCH A;  4NTY A;  1DLB A;  3OMI B;  4IYH A;  1M9N A;  4X62 B;  2AW9 A;  5IWA B;  5KUM A;  1N36 B;  2ZM6 O;  1CXZ B;  2LJ2 A;  4UCS A;  1AI6 A;  2OCC B;  4MW3 A;  2EUL A;  4GCZ A;  4K8X A;  2QM8 A;  4X1Y B;  3S3X A;  3FB6 C;  1IZ3 A;  5IE9 A;  2WLN A;  2QSA A;  5B1A C;  4H13 B;  3ICX A;  3ETE A;  3HB3 B;  1H2L A;  2WLM A;  5L3C A;  2GBO A;  2WLI A;  2M7W A;  1PD3 A;  3JYC A;  5E1A C;  3M7M X;  4JAV A;  3SJC C;  1K5S A;  3G6B A;  5IYZ B;  2QWN B;  4CS2 A;  5H2F Z;  4DR6 O;  2A79 B;  2ZIM A;  4YIP A;  1H38 A;  1S77 D;  2KB1 A;  2PGG A;  3IC7 A;  1JFF A;  2GTA A;  2QE7 G;  3BVO A;  1FAF A;  3FFQ A;  2HEP A;  2EIK B;  3ASO C;  3K3W A;  3ETQ A;  3LDE A;  5LGU A;  4FK5 C;  5FLX N;  2F4V O;  4DK0 A;  4LF6 O;  2GHY A;  3HKE A;  1WLE A;  2V4D A;  3ZRW B;  2Y69 B;  3CP1 A;  1VF7 A;  2FYU H;  1ZL8 A;  2P7T C;  3K57 A;  4X89 A;  2WLL A;  1B06 A;  3K04 A;  4O2B B;  4TV9 B;  3F7V C;  2BSK B;  2A3Q A;  4PA3 A;  2YIB A;  3QO5 A;  4O4J B;  3X2Q B;  2UUC O;  3JAT B;  2IH3 C;  3IGA C;  1N0N A;  2Q4P A;  3ZRV A;  4UV9 A;  3ASN B;  1MSW D;  1Y76 A;  3P3P A;  5KX5 A;  1AR5 A;  3O9O A;  1NKD A;  2CGO A;  4DR4 O;  2XUM A;  4X1K A;  2N05 A;  3CRC A;  2LFR A;  2QGN A;  4QNH B;  4GX5 A;  3GB7 C;  3T4Z A;  1OCZ B;  5B5E Z;  4B3M O;  2QWR B;  2BTQ A;  2ETN A;  4X88 A;  2CH7 B;  2C2A A;  2YUA A;  1J5E O;  5JVD B;  4JGS A;  5C8Y B;  2WA3 A;  1FXK C;  5AG2 A;  4I4T B;  5CMU A;  2VS0 A;  3LUT B;  1XMQ O;  1IUR A;  2JGU A;  1NH2 D;  3HKB A;  3JAR A;  2HG5 C;  4B3T O;  1VAR A;  4B7E A;  1SER A;  2HJF C;  2Q7G A;  1AJQ A;  1I0H A;  1Q82 W;  3ABU A;  3E22 B;  1N33 O;  3E89 A;  4TV8 A;  4FLY A;  2UUA O;  3EXA A;  1R6T A;  3J80 N;  2XT9 A;  4KFM A;  1I7F A;  4X65 B;  2JS3 A;  2NNU A;  4ZI7 A;  1R3L C;  3ZED A;  4J42 A;  4PI0 A;  3B8M A;  4WFG A;  2QM7 A;  4RAI A;  1K97 A;  1CP9 A;  2QWQ B;  4GX1 A;  4NB5 A;  2QM4 A;  1FFX A;  2RDC A;  3N27 A;  4JAA A;  2ZKO A;  1QLE C;  3RYF B;  2EIM C;  3SYO A;  3A2F A;  2WLH A;  3RYI A;  2B1I A;  5D5Q A;  4RQF A;  3SPH A;  2HFE C;  3CRA A;  4H37 A;  3A0H Z;  5H9C A;  4JI3 B;  1IDS A;  5GTH Z;  5KHG A;  3EVK A;  1V55 C;  2A9H A;  2XAJ A;  3W7S A;  4XDJ A;  2ZIN A;  3B40 A;  3EHB B;  3R66 A;  4MVR A;  5J2T B;  1QNM A;  2JDI G;  2ZR2 A;  3AG2 B;  3MHS C;  1K33 A;  4ZHQ B;  1Y67 A;  1S76 D;  4UCV A;  2D3O W;  2Q68 A;  2WLK A;  1WN7 A;  2V7Q G;  3K5M A;  1XL6 A;  5FNV B;  4LC1 A;  5J9P C;  4DR7 B;  3CRR A;  3P32 A;  5LBQ A;  2E76 B;  3BCC H;  1WP7 A;  1OCR C;  3HKD B;  5J2U A;  1FXV A;  3UT5 B;  2UU9 O;  3UO3 A;  5K1P A;  4LFC O;  3ZMZ A;  2OT5 A;  1NTK H;  3BHP A;  3OEE G;  4YIO A;  3SYP A;  1BT8 A;  1QQC A;  2W6I G;  3L75 H;  4UVC A;  4LFB B;  1XEQ A;  1SQG A;  2ZM6 B;  1AR1 B;  1RM1 C;  1NS1 A;  3OMA B;  2GV9 A;  1XUQ A;  4IIJ B;  1N34 O;  3FYI B;  1OJH A;  4JZG A;  4PD4 F;  1ORQ C;  3K9S A;  1QLN A;  1S0V A;  5BY1 A;  1Q6H A;  4H44 B;  3ETG A;  3JAW A;  1PNK A;  1ZSP A;  3VQX A;  2VQE O;  4U3F H;  4AHC A;  2B1G A;  5CB4 B;  4IYI A;  2Z5U A;  1W59 A;  5EBL C;  1SQV H;  4DR6 B;  3ABM B;  1SC5 B;  3MDS A;  4MVS A;  1TUB A;  1XI1 A;  5IWA O;  4FM2 A;  1N36 O;  4DV5 B;  2CTW A;  5L3D A;  3THO A;  1JQ0 A;  1KUQ A;  1VQ9 V;  2F4V B;  4XBF A;  1K73 W;  4P9O A;  1K8A W;  3ZHS A;  4BIZ A;  3CME V;  1Q43 A;  3CRQ A;  2ZE6 A;  1PNM A;  4GYC B;  4JF3 A;  3JAS A;  4AQY B;  3LSQ A;  4UB6 Z;  2P5O A;  3QTC A;  1M5I A;  1HR0 O;  1B3Q A;  1QBZ A;  1GMG A;  1NTZ H;  3QO8 A;  4PA7 A;  4J9Y B;  2UXB O;  1YEW A;  2Y4U A;  2UUC B;  4HNA A;  1PPJ H;  1N32 O;  3MAQ A;  2M6Y A;  3M99 B;  5H6R A;  3OAA G;  4LCU C;  2EJR A;  3IFX A;  4QIW F;  4NR1 A;  4J11 A;  5EBM C;  2PI5 A;  4DR4 B;  3JAL A;  3G71 V;  1QHT A;  3UO2 A;  2UXX A;  1WNS A;  2NR5 A;  3B8N A;  4JPR A;  3K08 A;  1Y4M A;  3LDC A;  4B3M B;  2NLJ C;  3UCS C;  3LDD A;  3UKM A;  1PM9 A;  5LOV A;  2YIA A;  4B3R O;  1JJO A;  1H2N A;  1M4U A;  1NI8 A;  3CHX A;  1YTF B;  2YI8 A;  5GON B;  3G6E V;  2XHB A;  1YIT V;  2BCC H;  1J5E B;  5B66 Z;  4MS2 A;  4UV8 A;  2MK3 A;  4WFA V;  4R6Z A;  2PUS A;  1XMQ B;  3H1H H;  4H33 A;  1VQ6 V;  4UCT A;  2Q7E A;  2HLD G;  2JJ2 G;  3L71 H;  1IXB A;  3CC7 V;  3BEH A;  1D2D A;  3OTF A;  2Q6A A;  3OE7 G;  2O57 A;  2UXN A;  3E8G A;  4G27 B;  1AVM A;  3ETD A;  2Q5Z A;  4MW8 A;  2FL4 A;  4X1I A;  3AG4 B;  1N33 B;  1FYJ A;  2F95 B;  3FB8 C;  1WB8 A;  2WLJ A;  1I5X A;  3JSN A;  2UUA B;  1OCO C;  4I50 A;  3RVY A;  1QVG U;  1OZ0 A;  1VQ4 V;  3H1J H;  1JMK C;  1D5A A;  1IVS A;  5EZY A;  1KD1 W;  1DTO A;  2A7W A;  1OV9 A;  3I56 V;  1R3J C;  4O2A B;  4OGQ B;  2Y69 C;  3CCE V;  3JAK A;  2ADP A;  1SS3 A;  3A0B Z;  1Y66 A;  3AG3 B;  4EB6 B;  4B3S O;  4J7K A;  2W0X A;  4JI5 O;  3WB2 A;  4J7J A;  1URF A;  3ASN C;  3KCY A;  4X64 B;  1EN4 A;  4EKW A;  2DJV A;  3FAV B;  1JX9 A;  1Q86 W;  3E8H A;  1K5Q A;  1SA0 B;  1TUE B;  3U11 A;  1I5Y A;  2EX3 A;  2JS5 A;  4K8Z A;  1ZLZ A;  4JI4 O;  5IJ9 A;  1OCZ C;  2CTQ A;  2Y0I A;  1VF6 A;  1VQ7 V;  1HNX B;  3RYC A;  5F2V O;  4DV0 O;  2P67 A;  3T1Y B;  1R73 A;  1VQN V;  3AEI A;  5B1B B;  2ATK C;  5JQG A;  3CD6 V;  2FTK A;  4FLZ A;  4ABM A;  3OGI B;  1MZF A;  4LFA O;  3CYO A;  4DR3 O;  5A9G A;  4RQE A;  2UU9 B;  4QE9 A;  1YVW A;  3QNE A;  1AJP A;  1WPB A;  3ZN0 A;  4LFC B;  4JI3 O;  3I55 V;  1KC8 W;  3NXS A;  1YXB A;  4LNU B;  2F66 C;  5KAF Z;  4FLU A;  2AZ2 A;  1PL0 A;  5BMV A;  1WA8 A;  3D8C A;  1FXK A;  2WSS G;  1N34 B;  2WWW A;  2EBO A;  3K5N A;  2QR4 A;  1IX9 A;  4PDL A;  2EZP A;  3SGI A;  2ITD C;  2X7R B;  4DR7 O;  1IBM O;  3OW2 U;  5CA1 A;  2VQE B;  2YEV B;  4JI6 B;  1S72 V;  2R70 A;  4OX9 O;  1VIB A;  4J9Z B;  1F51 A;  1NU1 H;  1IXM A;  5B3S C;  5JH7 B;  3QVN A;  3JCZ A;  1BE3 H;  4PA4 A;  2OCH A;  3OD4 A;  4LFB O;  3BAA A;  2PZS A;  1TGO A;  1R3I C;  1XDC A;  2JGD A;  1MOF A;  2E3C A;  4TUY B;  4CH3 A;  3WG7 C;  4C7U A;  2HP8 A;  2KSD A;  4BR6 A;  1VQ8 V;  1RFY A;  1HR0 B;  3BY6 A;  1X4T A;  4OPH A;  3AG2 C;  4E4E A;  5KMG A;  2ZXW C;  1W0K G;  2UXB B;  4L87 A;  1ZUQ A;  4DV6 B;  1N32 B;  4CH5 A;  5EYP A;  3ABK C;  4YXW G;  4TOI A;  2LW7 A;  4BAY A;  1EN6 A;  2JK5 C;  4DV5 O;  4MSW C;  4U3J A;  4FJC C;  3PN1 A;  4Z1V A;  3K03 A;  2AXT Z;  1US6 A;  4DV1 O;  3LNM B;  5LP6 B;  1AIL A;  4AQY O;  3T1H B;  1M1K W;  2XOK G;  3Q4H A;  4B3R B;  4I55 B;  4F6R A;  4FZ1 A;  2RNB A;  3AG1 C;  2EZO A;  4DUZ O;  1B6Q A;  3VQY A;  4U7O A;  4LH7 A;  1FD9 A;  1NR1 A;  1VF6 C;  1QCE A;  3L9D A;  3CCU V;  2ODM A;  3ZS8 C;  3HKC A;  2EIN B;  3FB5 C;  3KCX A;  5EIB D;  1MZE A;  1RSO A;  5CA0 A;  4DUY B;  1TAE A;  1M56 B;  1GH6 A;  1JPX A;  2VRZ A;  3JD2 A;  3FX7 A;  3GWK C;  2YXY A;  4D7T A;  1EN5 A;  3QO7 A;  2PYL A;  4IHJ A;  2CDY A;  4CH4 A;  4PA6 A;  3OUS A;  1S3J A;  5ITZ B;  3ABL B;  1R6K A;  4LWS B;  2DOS A;  5IY5 C;  1MA1 A;  3OUF A;  3JD1 A;  1K7D A;  5IJ0 A;  5EC1 C;  2BTO A;  4TQF A;  1AI4 A;  1XIL A;  4NXN B;  1CEZ A;  3N2K B;  1O9H A;  4QPJ A;  1TVK A;  2IM9 A;  1G8M A;  3TJT A;  1YTF D;  4NTW A;  1AR4 A;  4FFB A;  1VQL V;  2EIL B;  2Y4T A;  1GM9 A;  5LYJ B;  3F5T A;  3RVZ A;  1NT2 B;  3D3I A;  4PI2 A;  1M57 B;  5E79 Z;  3JAS B;  4FLT A;  3UQ8 A;  4B3S B;  2ZE8 A;  1Q7Y W;  4Z2W A;  1H2K A;  3AK2 A;  1PKX A;  1FJG B;  4JI5 B;  3CXH F;  3CC2 V;  3SPJ A;  1Q5O A;  3CJH A;  2KG7 A;  1OCC B;  4UCO A;  3SJA C;  4I9W A;  3RYH B;  3G80 A;  4G28 B;  4YHH O;  2HKO A;  4LR3 A;  3JD0 A;  3DXR B;  4KXR A;  5LMU O;  4JI4 B;  5LXT B;  5LL6 Y;  5GW7 A;  1KP2 A;  1ZAU A;  4DV0 B;  1HW7 A;  3W7T A;  4UVA A;  2P22 C;  1K4D C;  3K5L A;  1KEC A;  4JV5 O;  2EIJ C;  3K79 A;  5HFL A;  3ZMS A;  3SJQ C;  4JI7 O;  4JI0 O;  4LFA B;  4DR3 B;  3P30 A;  4JYC A;  4X64 O;  4HAM A;  2DYS C;  5LGN A;  4JI8 B;  1U96 A;  3OM3 B;  2L6L A;  2A0L A;  1ZX3 A;  3W7U A;  4ZKI A;  3U10 A;  4YY3 B;  1L0N H;  1FS0 G;  3L72 H;  4X1Y A;  3RGB A;  1YI2 V;  1HNX O;  5A2Q N;  4KL1 A;  4BW5 A;  3T1Y O;  3TET A;  1K9M W;  3SDL A;  3ZMV A;  2E5L O;  4LF8 B;  5B1A B;  2GDS A;  4EEQ A;  1B04 A;  3T2M A;  2Z3Y A;  5BXZ A;  3DGE A;  1ROP A;  2OWO A;  2CK3 G;  1KU9 A;  4H0L B;  5IYZ A;  1IBM B;  2LO1 A;  4EFE A;  2RMK B;  4OX9 B;  3H01 A;  1KMI Z;  4FIP C;  1MNG A;  4X20 B;  3FYE B;  3SJB C;  2YID A;  3CS5 A;  1NR7 A;  4MVQ A;  5BZB A;  4GKK B;  3LSS A;  4W4K A;  4PJ0 Z;  4QPK A;  4YJ3 B;  1PL4 A;  2YSU B;  3CC4 V;  3ZRW A;  2F23 A;  2W0F C;  3ASO B;  4NXM O;  2ZDI C;  1WAZ A;  1GTO A;  4LP8 A;  2UXD B;  1O9G A;  2UUB O;  4O2B A;  3TGU H;  3AK1 A;  4TV9 A;  2H3O A;  1H8E G;  1JR9 A;  2BSK A;  5D5P A;  4D6T H;  1Y74 B;  1RP3 B;  1R6N A;  4O4J A;  2IJH A;  1G6U A;  3JSL A;  2F1M A;  1CPY A;  5IYB O;  3JAT A;  4UXN A;  3OEH G;  4JI6 O;  1LR1 A;  2VWK A;  1RPO A;  1XBL A;  2R72 A;  1XMO O;  4DRX B;  4B08 A;  2KKW A;  5B1B C;  5KHI A;  3DC5 A;  3JD3 A;  4WFH A;  2X0L A;  1XNQ B;  3L70 H;  2E75 B;  4YJ2 B;  1EFR G;  4RWU A;  1BSM A;  5L3E A;  3AG7 A;  4BIU A;  4DV1 B;  1K3E A;  1NQT A;  2NN4 A;  4WBN B;  5LMN B;  3CCM V;  3UM7 A;  1V54 C;  2ZT9 B;  1GM7 A;  2CH7 A;  1P7B A;  4GX2 A;  4ZOL B;  2IBZ H;  3A8T A;  1GN2 A;  5LA6 A;  4DUZ B;  1SZX A;  5JVD A;  2HJD A;  5C8Y A;  3F5W C;  3T4D A;  2OYQ A;  4FLV A;  1BQZ A;  2K1E A;  4I4T A;  2YS8 A;  4DV6 O;  2GUZ B;  1BQ0 A;  1WB7 A;  5IDJ A;  2OIE A;  3TXS A;  2DWE C;  2RCV A;  4FMT A;  3U0Z A;  1BCC H;  4O4H B;  3SPC A;  4DV2 O;  4O4I B;  3FD9 A;  2H94 A;  3A0R A;  4MTX A;  1Q8I A;  2GTS A;  4I0X B;  1IBL B;  3ZCC A;  4O4L B;  3MD0 A;  4TSF G;  3E22 A;  5LHG A;  2AZ0 A;  4DXW A;  3OR7 C;  5L3G A;  4UB8 Z;  4DV7 O;  5LHI A;  3T1H O;  3BA8 A;  2P90 A;  2ZNJ A;  1M93 A;  3N2G B;  3QF7 A;  2RJZ A;  1HNZ O;  3QG5 A;  1EBO A;  2UXC B;  3APO A;  1MSD A;  4NYK A;  2OCC C;  2F43 G;  5JCO C;  3ZJZ A;  1SES A;  4WF9 V;  2PYJ A;  4DYL A;  4UUJ C;  3CCS V;  4LF5 O;  3CPW U;  4ICG A;  3RYF A;  1SZT A;  2IJK A;  3K0G A;  4JYA O;  2F93 B;  5LHH A;  4DUY O;  2HVK C;  4GX0 A;  4X9Q A;  5JJN B;  1UJW B;  2EIM B;  3K58 A;  2XAH A;  2E74 B;  2WLI B;  5KUK A;  1SKV A;  3E83 A;  4N23 A;  4KHP O;  4JZ2 A;  3B4S A;  2DN9 A;  4X8A A;  1PNL A;  4GKJ B;  3OFN G;  5J2T A;  4YHH B;  1AI7 A;  1V55 B;  2Z0A A;  3K06 A;  4OPA A;  1FPO A;  4NXN O;  5LMU B;  1PP9 H;  2AHZ A;  2EIK C;  2YC0 A;  5DN6 G;  1JFF B;  3I5D A;  4MVZ A;  1K34 A;  4ZHQ A;  3CE2 A;  2P4V A;  4DR1 O;  2PI4 A;  2ZD9 A;  4WCE V;  4I5S A;  3WFV A;  1H8H G;  3FKS G;  3DC6 A;  1N8R W;  4KUM A;  3J7A U;  3HKE B;  4NTX A;  5DED A;  4P9P A;  2YIC A;  4Q6G A;  3ZHQ A;  1SRY A;  5FNV A;  4RUF A;  4JV5 B;  2DE0 X;  3L73 H;  1EM1 A;  1ZL8 B;  3HKD A;  3X2Q C;  2WLL B;  1FJG O;  2Q0A A;  4JI7 B;  4JI0 B;  3UT5 A;  1GN4 A;  3RWR D;  5FPO A;  1OCR B;  3STL C;  1H2S B;  2Q69 A;  2QWO B;  4W4L A;  1XOU A;  2JRI A;  4MVM A;  2Q8V A;  3CCJ V;  2OTJ V;  1Y76 B;  3VBB A;  4CS4 A;  2IW5 A;  5KX5 B;  4DR2 O;  2ZNI A;  1YZB A;  1F23 A;  5H6Q A;  1DK1 A;  3DTU B;  4X1K B;  1XHZ A;  4IIJ A;  4IGG A;  2KQX A;  1RM1 B;  3RBZ A;  1BL8 A;  2ARH A;  4DV4 O;  1BZK A;  2ZE5 A;  2E5L B;  2LGQ A;  2JEU A;  2BTQ B;  5KHJ A;  1IBK O;  3C3T A;  1WPX A;  3LNN A;  3ZMT A;  5CB4 A;  2ZQM A;  1L1F A;  3BRC A;  3E2E A;  1BS3 A;  2AHY A;  2L35 A;  1M57 C;  1RPR A;  1T5E A;  1ZTE A;  4JI8 O;  4K3A A;  2WPD G;  1LUW A;  1N0J A;  1P7G A;  3K9A A;  4LF4 B;  4YY3 O;  3HKB B;  1GN6 A;  3JAR B;  1QR9 A;  3NR7 A;  1NBM G;  1XNR O;  1M90 W;  4JAS A;  2G38 A;  4X66 B;  1EZJ A;  4U7N A;  4ZIB A;  4NXM B;  2LQT A;  2UUB B;  4MTG A;  4LF8 O;  3RT3 C;  1FXH A;  4TV8 B;  1SQP H;  3CCQ V;  2QKC A;  4PEL A;  4FVM A;  1JOY A;  1Q3E A;  1YCI A;  1MG1 A;  4ZI7 B;  2CUG A;  1KB9 F;  1XMO B;  1VMG A;  1SF9 A;  3OR6 C;  3D3Q A;  2AGA A;  2W6J G;  3B09 A;  4GKK O;  1FFX B;  5B1N A;  1DGS A;  1F4N A;  1R3K C;  3IC9 A;  2K9P A;  1DF5 A;  3CB2 A;  1KKD A;  4CC6 A;  3RYI B;  2FKX A;  4XDL A;  4FLW A;  3F7Y C;  5IYC O;  2UXD O;  2QKA A;  5GON A;  3APQ A;  3JAM N;  1QR8 A;  3R65 A;  3OMN B;  2EJ7 A;  4QGP A;  3TK1 A;  4FFK A;  2N04 A;  3E86 A;  4GZR B;  2YDE A;  2IU0 A;  4JI2 B;  1BMF G;  1GO3 F;  4Z1M G;  1V9P A;  1I94 O;  1K4C C;  2HR3 A;  2JIZ G;  1VQ5 V;  4DV2 B;  2CE4 A;  4P2Z A;  1XNQ O;  1VEW A;  3WU2 Z;  3CX5 F;  4PDV A;  4PDR A;  5JWP A;  4DV7 B;  2OIG A;  3B2E E;  5J2U B;  5LMN O;  2ZCE A;  2WAM A;  1BGY H;  2YXH A;  1HNZ B;  1NJI W;  1YDX A;  1OCO B;  2IH1 C;  1R1B A;  1Y6X A;  4R50 A;  4O2A A;  1SQF A;  4L8J A;  3D36 A;  3ZRX A;  3BA9 A;  5CBG A;  4LF7 B;  2DW4 A;  1AI5 A;  4J7Z A;  3SYC A;  4DR5 B;  4A5U B;  4LF5 B;  3W7W A;  3G4S V;  2ITC C;  4HZ3 A;  1JVM A;  1WP8 A;  4EB6 A;  4GLX A;  4FLX A;  2B5U A;  3KKY A;  4JYA B;  3O65 A;  3VQW A;  2DYR B;  2CTP A;  1IBL O;  3JAW B;  1ARO P;  4KHP B;  3FAV A;  2ZDI A;  2MW2 B;  4ASU G;  3ABM C;  1SA0 A;  2R9A A;  3ZIA G;  3VOU A;  1GAX A;  1YJW V;  3GVM A;  4RUE A;  1VQM V;  4PV1 B;  2ZR3 A;  4DK1 A;  4AIL C;  2UXC O;  4MTO A;  1TUB B;  4FZ0 A;  1A32 A;  5IYD O;  5EBW C;  1VP7 A;  2D2C B;  3ZBH A;  4DR1 B;  1L8D A;  5LGT A;  1Q81 W;  2X6A A;  4FM1 A;  2Y48 A;  1BHA A;  5LA6 B;  5EIB C;  3ZHV A;  1I08 A;  5B1O A;  1SQX H;  2Q9L A;  4HNA B;  4LNU A;  4DV3 O;  3EFF K;  1QU7 A;  4GKJ O;  1DF4 A;  5TIS Z;  4DR2 B;  1XHX A;  4PA9 A;  2ADQ B;  2WA4 A;  3JAL B;  4JYY A;  4UCR A;  5KA6 A;  4HYO A;  1NVP B;  2XND G;  1Z2G A;  3E8B A;  2QEX V;  5JJJ B;  5DM6 V;  4RO2 A;  4DV4 B;  3CSX A;  4K0K O;  1G4Y B;  1SQQ H;  3BPZ A;  4IT5 A;  2YEV A;  1Q6I A;  5LOV B;  1IBK B;  1P4R A;  1NTM H;  4DO2 A;  4PDM A;  1HP8 A;  2Q0O C;  1SQB H;  4UCU A;  4MTF A;  4JI1 O;  2DWD C;  5IT9 N;  2LGW A;  2Y0P A;  3H1L H;  2VQF O;  1HNW O;  4KP4 A;  2P4K A;  5JH7 A;  4F6E A;  4LF9 O;  2XAQ A;  2YIB D;  2B9Z A;  4J80 A;  1WJZ A;  1AP6 A;  5B3S B;  3WB1 A;  1GKF A;  3BAB A;  5DEC A;  2HHH O;  1XNR B;  1W0J G;  1S5J A;  5JCO A;  4ZBM A;  4AI8 A;  1YJ9 V;  1Q90 D;  2DQ3 A;  4TUY A;  4JTA B;  1FFT B;  3AG4 C;  4WFF A;  2ILM A;  3H1K H;  5BR8 O;  4PHZ A; 
#chains in the Genus database with same CATH homology
 2LFS A;  4X89 A;  2WLL A;  4DXW A;  3K04 A;  3OR7 C;  4F4L A;  5L3G A;  3F7V C;  3WG7 B;  3CYO A;  5LHI A;  4PA3 A;  4RQE A;  1YIJ V;  3QO5 A;  2P90 A;  4QE9 A;  3QNE A;  1AJP A;  3X2Q B;  3ZN0 A;  4GT1 A;  3I55 V;  2IH3 C;  3K0D A;  1KC8 W;  3NXS A;  3IGA C;  3ZRV A;  4R7C A;  4UV9 A;  1EBO A;  3ASN B;  1MSW D;  1YJN V;  2ZXW B;  2OCC C;  1F4M A;  2F43 G;  4TT3 G;  3ZJZ A;  1SES A;  4WF9 V;  1PL0 A;  3AG3 C;  4UUJ C;  1NKD A;  3CCS V;  1VQP V;  3ABK B;  2GSM B;  3CPW U;  2LFR A;  4QNH B;  1SZT A;  4GX5 A;  1FXK A;  3ZRS A;  2IJK A;  3GB7 C;  3T4Z A;  2WSS G;  3K0G A;  1OCZ B;  5LHH A;  2WWW A;  2EBO A;  3SYA A;  2HVK C;  4GX0 A;  1UJW B;  2EIM B;  1KP3 A;  2XAH A;  2WLI B;  4PDL A;  5KUK A;  3MHH C;  2EZP A;  3E83 A;  2ITD C;  2X7R B;  4N23 A;  4WFB V;  3OW2 U;  2Q67 A;  2YEV B;  4X88 A;  1S72 V;  4X8A A;  1KQS U;  2C2A A;  1PNL A;  4J9Z B;  3OFN G;  4JGS A;  1F51 A;  1AI7 A;  1V55 B;  3K06 A;  1IXM A;  4MVO A;  3AG1 B;  5B3S C;  1FXK C;  3JCZ A;  2AHZ A;  4PA4 A;  2EIK C;  5CMU A;  3LUT B;  3SYQ A;  5CBH A;  5DN6 G;  4MVZ A;  1K34 A;  1NH2 D;  2PI4 A;  2ZD9 A;  4WCE V;  2HG5 C;  4I5S A;  1R3I C;  3CCV V;  2QA4 V;  3E8F A;  1H8H G;  3WFV A;  3FKS G;  1SET A;  1YHQ V;  4E2L A;  1N8R W;  4KUM A;  1MOF A;  2X6B A;  4P9P A;  1SRY A;  1SER A;  4RUF A;  2HJF C;  3ZN1 A;  3WG7 C;  1AJQ A;  2R9I A;  2BOC C;  1Q82 W;  2IU3 A;  1VQ8 V;  3ABU A;  3E89 A;  3X2Q C;  2WLL B;  3BY6 A;  3GWO A;  1QVF U;  3AG2 C;  1AJN A;  2IJJ A;  1OCR B;  4JAU A;  2ZXW C;  4KFM A;  1W0K G;  3STL C;  2Q69 A;  2NNU A;  4UVB A;  3CCR V;  4L87 A;  5IY5 B;  1R3L C;  3B8M A;  4MVM A;  4WFG A;  3CCJ V;  2OTJ V;  3VBB A;  4QE7 A;  2JEX A;  2QM7 A;  3ABK C;  4RAI A;  2IW5 A;  1K97 A;  1CP9 A;  4GX1 A;  1F23 A;  5H6Q A;  3DTU B;  4YXW G;  1ENV A;  1VQO V;  4BAY A;  1QLE C;  2EIM C;  2JK5 C;  3SYO A;  4MSW C;  1FXK B;  1RM1 B;  3RBZ A;  1BL8 A;  2WLH A;  4FJC C;  5EK0 A;  1S5H C;  2B1I A;  3JD4 A;  4RQF A;  5HFM A;  3K03 A;  2XAS A;  4N21 A;  5L3F A;  3LNM B;  3SPH A;  2HFE C;  4H37 A;  3ZMU A;  4JYB A;  5CN0 A;  1M1K W;  2JEU A;  5H9C A;  2XOK G;  5FL7 G;  4FPP A;  1WPX A;  3ZMT A;  2ZQM A;  1V55 C;  2A9H A;  2XAJ A;  3AG1 C;  2EZO A;  4XDJ A;  1L1F A;  3EHB B;  1B6Q A;  3W7S A;  2X6C A;  2OTL V;  3E2E A;  1VQK V;  4MVR A;  4U7O A;  2AHY A;  1NR1 A;  5KA5 A;  1M57 C;  1RPR A;  4Q20 A;  1QCE A;  2JDI G;  2ZR2 A;  3CCU V;  3AG2 B;  2WPD G;  3MHS C;  1K33 A;  3K9A A;  2EIN B;  3FB5 C;  1S76 D;  1QR9 A;  2D3O W;  1NBM G;  2Q68 A;  2WLK A;  2V7Q G;  1M90 W;  1M56 B;  4CZZ A;  4JAS A;  1JPX A;  3JD2 A;  1MAB G;  1EZJ A;  1E1R G;  1XL6 A;  4LC1 A;  4U7N A;  3QO7 A;  3CXC U;  5J9P C;  3P32 A;  4PA6 A;  3OUS A;  1S3J A;  5LBQ A;  3ABL B;  4MTG A;  1H2G A;  1OCR C;  1FXH A;  1QLE B;  2EIJ B;  1FXV A;  1R6K A;  3CCQ V;  5IY5 C;  3OUF A;  3JD1 A;  1K7D A;  4PEL A;  5EC1 C;  3ZMZ A;  5L3B A;  2OT5 A;  3OEE G;  1JOY A;  1AI4 A;  1NH2 B;  3SYP A;  1CEZ A;  1MG1 A;  2W6I G;  1J95 A;  4QPJ A;  1G8M A;  2DYS B;  3ML0 A;  4UVC A;  1YTF D;  1VQL V;  3OR6 C;  2EIL B;  2QTO A;  1GM9 A;  1AR1 B;  3RVZ A;  2W6J G;  1YSC A;  1RM1 C;  3OMA B;  3D3I A;  5B1N A;  1F4N A;  1R3K C;  4CBC A;  3KG2 A;  1M57 B;  1DF5 A;  1KKD A;  2JJ1 G;  3FYI B;  4XDK A;  1Q7Y W;  3SPG A;  1ORQ C;  1GM8 A;  1PKX A;  4XDL A;  1QLN A;  1S0V A;  3T1C A;  3F7Y C;  4JTD B;  5IYC O;  3CC2 V;  3ETG A;  3SPJ A;  1PNK A;  3RW0 A;  4JTC B;  1OCC B;  3PJS K;  2B1G A;  4I9W A;  4G28 B;  1QR8 A;  2Z5U A;  5EBL C;  2HKO A;  3SPI A;  3R65 A;  3OMN B;  4G2K A;  2EIN C;  3TK1 A;  3JD0 A;  3ABM B;  4OXS A;  2BOB C;  3E86 A;  2LP7 A;  4MVS A;  1E1Q G;  2IU0 A;  5GW7 A;  1JJ2 U;  1M56 C;  1BMF G;  1GO3 F;  4Z1M G;  3CCL V;  1KP2 A;  2DYR C;  1K4C C;  1COW G;  5L3D A;  4UVA A;  2HR3 A;  2JIZ G;  1JQ0 A;  3W7T A;  1K4D C;  1VQ5 V;  1VQ9 V;  4P2Z A;  4XBF A;  4MVU A;  1KEC A;  4P9O A;  1K73 W;  1K8A W;  4BIZ A;  3CME V;  3ABL C;  2H8P C;  2R9R B;  5LHG A;  1PNM A;  2EIJ C;  3K79 A;  4JF3 A;  3LSQ A;  2HVJ C;  2QKS A;  5HFL A;  3ZMS A;  4PDV A;  3SJQ C;  1NVP D;  4PDR A;  1W2B U;  3OGC C;  1QBZ A;  4R8C A;  1GMG A;  1XL4 A;  3QO8 A;  4PA7 A;  3P30 A;  2WAM A;  4JYC A;  4J9Y B;  3HPL C;  4HAM A;  2DYS C;  5LGN A;  1NJI W;  3M99 B;  1OCO B;  2IH1 C;  2IJI A;  2EIL C;  3OM3 B;  3STZ C;  2A0L A;  3OAA G;  5H6R A;  5CBF A;  3TCU A;  1BHB A;  4LCU C;  4R50 A;  4TWK A;  4ZKI A;  3W7U A;  1ZWI C;  1THZ A;  3D36 A;  2EJR A;  3ZRX A;  3IFX A;  1FS0 G;  4QIW F;  5CBG A;  2DW4 A;  1AI5 A;  3SYC A;  5EBM C;  2PI5 A;  3G71 V;  3W7W A;  3G4S V;  1YI2 V;  2ITC C;  4HZ3 A;  1JVM A;  2UXX A;  3CMA V;  4BW5 A;  2B5U A;  3B8N A;  2V1D A;  4JPR A;  3TET A;  4QJF B;  1K9M W;  3ZMV A;  3K08 A;  1Y4M A;  5B1A B;  2DYR B;  3LDC A;  1OCC C;  2NLJ C;  3T2M A;  2Z3Y A;  3DGE A;  5C93 A;  3UKM A;  3LDD A;  4MT8 A;  1ARO P;  1ROP A;  1GK9 A;  3E35 A;  2CK3 G;  1LNQ A;  3ABT A;  4P30 A;  1YTF B;  2DQ0 A;  2ZDI A;  4ASU G;  3ABM C;  3H01 A;  3G6E V;  1V54 B;  3ZIA G;  3VOU A;  4FIP C;  1YIT V;  1YJW V;  1E79 G;  2XAF A;  3FYE B;  4RUE A;  1VQM V;  1NR7 A;  2XAG A;  2ZR3 A;  4MVQ A;  1K92 A;  4WFE A;  5BZB A;  4MS2 A;  4MTO A;  4UV8 A;  2MK3 A;  4WFA V;  3LSS A;  4R6Z A;  5IYD O;  5EBW C;  4QPK A;  3FB7 C;  4H33 A;  3B77 A;  2YSU B;  1VQ6 V;  1OHH G;  5LGT A;  1Q81 W;  2HLD G;  2JJ2 G;  1HWY A;  3CC7 V;  3CC4 V;  2X6A A;  3ZRW A;  2W0F C;  3BEH A;  5CA3 A;  3ASO B;  4LBE C;  2Q6A A;  2ZDI C;  3OE7 G;  1GTO A;  2UXN A;  4LP8 A;  3E8G A;  4G27 B;  3ETD A;  4MW8 A;  2Y48 A;  5EC2 C;  1H8E G;  3AG4 B;  1BHA A;  3W7X A;  3FB8 C;  2WLJ A;  1R6N A;  1I5X A;  2P6J A;  2IJH A;  1OCO C;  5B1O A;  1JCH A;  1CPY A;  3RVY A;  5IYB O;  1QVG U;  4UXN A;  1OZ0 A;  3OEH G;  1DLB A;  3OMI B;  1RPO A;  1VQ4 V;  3EFF K;  1M9N A;  1KD1 W;  1DTO A;  5KUM A;  3I56 V;  1DF4 A;  1R3J C;  2Y69 C;  5B1B C;  3CCE V;  1AI6 A;  2OCC B;  4MW3 A;  4PA9 A;  4GCZ A;  3JD3 A;  4WFH A;  2QM8 A;  2X0L A;  3FB6 C;  5KA6 A;  1Y66 A;  3AG3 B;  4HYO A;  1EFR G;  1NVP B;  2WLN A;  2XND G;  5B1A C;  3E8B A;  2QEX V;  5L3E A;  5DM6 V;  4RO2 A;  3ETE A;  3HB3 B;  4BIU A;  2WLM A;  5L3C A;  1K3E A;  1NQT A;  2WLI A;  2M7W A;  1PD3 A;  3JYC A;  3ASN C;  5E1A C;  3CCM V;  3UM7 A;  1G4Y B;  4JAV A;  4EKW A;  1V54 C;  2YEV A;  1GM7 A;  1K5S A;  1P7B A;  4GX2 A;  1P4R A;  4DO2 A;  4PDM A;  1JX9 A;  4MTF A;  1Q86 W;  2DWD C;  1K5Q A;  3E8H A;  1TUE B;  3F5W C;  1I5Y A;  2A79 B;  3T4D A;  4KP4 A;  1H38 A;  2K1E A;  2XAQ A;  1S77 D;  1OCZ C;  2KB1 A;  3IC7 A;  5IDJ A;  2DWE C;  1VQ7 V;  4FMT A;  5B3S B;  2QE7 G;  2P67 A;  1GKF A;  3LDE A;  2EIK B;  3ASO C;  3K3W A;  3SPC A;  5LGU A;  4FK5 C;  1R73 A;  1VQN V;  1W0J G;  2GHY A;  3AEI A;  1WLE A;  2H94 A;  1YJ9 V;  4ZBM A;  3A0R A;  2DQ3 A;  4MTX A;  3ZRW B;  4JTA B;  2Y69 B;  1FFT B;  3AG4 C;  3CP1 A;  2ATK C;  4WFF A;  5B1B B;  3ZCC A;  3CD6 V;  2FTK A;  3MD0 A;  4TSF G;  2P7T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...