1W2GA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with deoxythymidine (dt) (2.1 a resolution)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
208
structure length
196
Chain Sequence
b'MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERRDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE TMK
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title The Crystal Structure of Mycobacterium Tuberculosis Thymidylate Kinase in Complex with 3'-Azidodeoxythymidine Monophosphate Suggests a Mechanism for Competitive Inhibition
pubmed doi rcsb
total genus 76
structure length 196
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2gA00
4P0TA 4W5HA 2H5EA 4B32A 4NH0A 1JNYA 1EFRD 1G7SA 3FFAA 2JDIA 3C16C 2IS6A 1Z3IX 3W3ZB 4B6EA 2MSCB 4IKEA 1XNJA 4BLOA 2JIZA 1XF9A 4IXNA 2W0SA 3CZQA 2ZAOA 1K6MA 2X1VA 2FZ4A 2GJSA 1L2TA 2XB2A 4KFRA 4MGYR 1E32A 2Q21A 1A7JA 3Q5DA 4TL8A 2OBNA 2XZPA 1Q20A 2CJWB 4TLAA 1G5RA 4P33A 3P26A 1KAOA 3EIEA 4IFBA 4LZZA 2LCFA 2HLDA 4WOPA 1N6OA 4FI3C 3X1ZA 4DEXA 4LHZA 4LHWA 2JATA 5CLQA 3AF2A 3MFYA 4OK5A 3VR3A 2QL6A 4B34A 2DBYA 2QAJA 5JWRA 4DHEA 3OAAA 1ZU4A 4M1MA 1D2MA 2DR3A 3IPYA 2RHDA 2OE2A 1JXMA 5DE3A 3QJYA 4OI1A 1KY3A 1UEJA 3ZDQA 4Z54A 1S3SA 2GNOA 2GJ8A 3E70C 3QF7A 4DB2A 2ZM5A 4PO1A 2NIPA 2W2TA 1SKYE 1P2SA 1QHNA 4DLYA 2ZTSA 2A3RA 2CHGA 4FINA 4MRVA 3RANA 4UJ5A 4MRPA 2W00A 2YINC 2FEOA 1G8GA 1ZNZA 2IXEA 2OILA 2RGCA 1ZP6A 4IW3B 4D4LA 1EWQA 1CF4A 1BO6A 2ZYVX 1U0JA 1OW3B 1IY1A 3KQNA 4LRWA 1TU3A 4EPTA 5EP1A 3ADDA 1CJVC 1KK2A 5KDDA 1Q21A 1VHLA 4PZYA 1GNPA 4H1VA 5C4MA 5KHOC 5FUWA 4GBMA 3NEJA 1W36C 2ZR0A 5E7IA 3NBXX 1WP9A 3VNVA 2NO0A 1C1YA 4B44A 5B64A 3IUYA 4HAVA 1OPXA 1WA5A 4LJ7A 5CB6A 4DT1A 4HZUB 5KNCA 2KBEA 1KOFA 1W0KA 1E6CA 2O8DB 2VYFA 2H17A 3GLHB 1LNZA 1SXJA 2WHXA 3QKSA 4Q1EA 4A6XA 3BFVA 1EFTA 1KJWA 3J81k 3FYHA 1L8QA 1QHYA 1AGPA 1IN6A 1CULC 1ZM9A 3CIOA 3PVSA 4LSGA 3DPUA 1SKYB 3CWZA 4O2RA 1GL6A 1G8YA 2HDNB 3EIQA 1TEXA 1NKSA 2WWFA 3SC3A 4ZV4A 4B48A 2IF2A 1R7RA 5KPJA 5F3WB 4RD3A 4A0GA 1MABA 3AVUA 2KB0A 4DRZA 2DHRA 2ZEJA 3GJ8A 3WMGA 2ZI5A 2IBMA 2OCYC 2BBSA 4V0LA 3GP8A 1E4YA 1XBTA 2J0QA 2JLWA 4MH0R 1IJFA 1G17A 3K0FA 5FH9A 4Q9KA 4C0SA 1AS2A 4HDOB 2SHKA 1G41A 3VTKA 2AKYA 2VHJA 4PANA 2OT3B 3OEEA 1MO3A 3RYTC 2GXAA 1XJQA 1FNNA 2PX0A 3ZS9A 5JCZA 1WXQA 3GFOA 2GZHA 4HAZA 2JJ1D 3HR8A 2C04A 2P67A 2HYIC 1G8HA 1W44A 4NHOA 4QGFA 3O8DA 4TTQA 3NG1A 2AFIE 2GF0A 1AQYA 1SVKA 4KYUA 4RFVA 5KU1A 2REXB 1II8A 2R44A 2O8FA 5TV2A 1FQKA 4A15A 2GXUA 2QAGA 1RW4A 1RRPA 4AG5A 2WAXA 4BLTA 2ZVPX 3MAAC 3LXRA 2CLDX 3VFDA 2Q9BA 4B43A 1LFDB 1Z0KA 3F3YA 4DVGA 4PO9A 3KUDA 1Z63A 1E2MA 1RC8A 1FTSA 1XCGB 5FOTA 1GKUB 4R2IA 2QRNA 2ZROA 2IK8A 3NIBA 4RCYA 2OBLA 1GOTA 3K53A 3P4YA 5ANRB 4EFNA 3FHTA 4R71A 3VAAA 2CCJA 2QORA 3RRMA 1I4LD 3MCAA 3EW9A 4IEEA 2QBYB 2R6GA 4JVSB 3A1TA 3A1SA 5EJEA 2GZAA 2GAOA 2JLYA 3RHFA 2R6DA 3ZZTA 1TF5A 3K9NA 3A37A 1SVOA 3ZH9B 4QHSA 4URWR 3A58B 1XXHB 2YV5A 3U5ZB 1ZRHA 1IONA 2BM1A 4QGHA 3I61A 4KAXA 1DVRA 1TNDA 1IY2A 4LV6A 1J7KA 3QQ5A 4YC7A 3CO5A 5FL7A 4Z51A 4QBIA 4Q9IA 1ODFA 4EFLA 2VL7A 3Q7PA 3QPUA 3FOZA 4RD1A 4BZXA 5A5GA 3IBYA 1B0UA 4OQLA 4NCHA 5EXSA 2O5VA 3CRRA 4IXMA 5B58C 2PMKA 5BYJA 3EXAA 1JR3E 4HB2A 4ZPXA 5KTYA 3ZGXA 2P6RA 2Z5FA 2CE2X 3BGWA 2QPOA 4O0MA 1Q0UA 1NMZA 2GEUA 1Q12A 2GCOB 1GVNB 5C4GB 5DN6A 4OQFA 3K8YA 3B9QA 1R2QA 2WOOA 1E94E 4NMMA 1UADA 2G83A 3EPHA 3NKVA 3PUXA 1UFQA 3B60A 3K0AB 5EQTA 3VR1A 1G21E 5FFMA 2IWHA 1KI6A 1NIPA 1BYUA 2GETA 4ZDKA 2BBTA 4JSYA 3ZIAD 3RRYA 5CK4A 1KI7A 3GEEA 1FMJA 4US2R 4QM6A 4C0HA 2YJTD 3AF1A 3K1JA 4GMXA 5L3QA 2ZI4A 2I1VB 2QQ0A 2ZJ8A 1G18A 2UVQA 4HSEA 4LYFA 3WP1B 3R9IA 1GL9B 4D0NA 4DDWA 2ZE5A 4LYJA 4A8JC 1YR8A 3CX6A 5E95A 4DLRA 1KI4A 3DKVA 2DFNA 5JHGB 1EXMA 1Z2AA 2QEQA 1Q1QA 2V4ZA 3M4YA 1U0HC 2VLIA 121PA 1KNXA 1YZQA 2H92A 3GJ3A 1FL9A 3PV0A 3WY9A 4RFSA 4XD7D 2WJVA 5DYIA 4ZI3A 4Y0AA 3CNLA 5SZHB 2WSSA 4BFYA 3RS0A 2YHSA 1KO4A 1OFHA 5HE9A 1U81A 1R5OA 1NIJA 1S9DA 2PEYA 3PCRB 4B75A 5GJCA 1E4VA 2XNSA 4KITB 3H84A 3R20A 3VHXA 1HV8A 1HYQA 5IK2D 4DLWA 4GSYA 1BMFA 2G0NA 2FSHA 2H18A 3LV8A 4KFTA 5IHPA 1PVOA 4FIDA 1AA9A 1NKTA 4FWIB 4CF7A 5FI1B 3DKPA 4DJTA 3NC1C 1BH2A 1YKSA 2Z0MA 4KODA 2J45A 1ESNA 1G291 1MRSA 4US1R 2OHFA 4TQAA 5LB2A 2ZRFA 2ZSEA 3CRQA 4JL5A 4A1FA 1IOZA 4DLTA 2A5DA 4C2TA 2G0TA 5J5CA 3AKYA 4Q9HA 4AC9A 1OFTA 3PENA 2CL6X 1R5BA 2CCGA 3NBYC 4DDUA 4MKIA 1VMAA 1ZD9A 2J46A 3NTUA 4G1UC 2WIBA 2GWHA 4NONA 3TBKA 1CU1A 2HYDA 2CMKA 4QGAA 1TUIA 4ZIRA 4MUBA 3SS8A 1D9XA 4OK6A 2ZRIA 2VSXA 1Z06A 4XJXA 2IHYA 3DDCA 2BOVA 4JYCA 4BFUA 1M34E 2RKOA 2N42A 4U5XA 1L4UA 3X1WA 1TL7C 3QVUA 3K70B 4TMKA 1E0SA 2QGZA 4D80A 1MT0A 2ZRBA 2H1LA 2DB3A 1VTKA 2GAAA 1UBEA 3EA0A 4LI0A 5F98A 2C96A 2ZANA 5LBIA 1NRJB 1Z6AA 4WIAA 2QMEA 1CLUA 4QJ5A 3GLFA 5BWMA 4OYHA 3CONA 4NDZA 2WOJA 2YNMA 1W0JD 4V0ME 1E9RA 2PLFA 3GJXC 5GJVC 3EARA 1F2UA 4IJMA 2WBLC 1II8B 2XNDA 4PPNA 3X2SA 3C41J 4PSKA 4XD7A 5IRCD 3AP2A 4G3XA 2GVDC 3K0CA 4UQOA 4RD2A 4RZ2A 1QZXA 2ZS8A 4QGGA 1H8EA 1OHHD 1UBGA 4QHYA 1RRFA 2O0KA 2EFGA 4Q47A 4AWXA 3OIVA 2ZE8A 4P4SB 1G5PA 2AKAB 1ZIPA 4DSUA 3G5UA 3Q85A 1TMKA 2GCOA 2IXFA 2DFKB 1Z83A 4DUGA 2IX3A 2JLUA 4MDEA 1Z28A 1L4YA 2WM9B 4JL8A 4C2UA 1XEFA 3HU3A 4L15A 2I3BA 1N5LA 1UBCA 1QHSA 1ZUIA 4RZ3A 5FOUA 1XZQA 4TZ6A 1AM4D 2O8CB 3B5JA 3L43A 5GVRA 3V00A 3CBQA 4RCZA 5AK0A 3RWOA 3A36A 3ECCA 2ODEA 1YZUA 3W6PA 3WHLA 3UXMA 4NYJQ 4BLQA 1KJZA 2QTFA 4M2LA 3LBHA 4PC6A 1FUUA 1T3HA 2QSYA 4OJKA 5H1YA 5K8TA 3TH5A 3EPLA 3MWKA 2BKUA 4L5BA 1MV5A 1OXVA 2YWEA 1MKYA 1E98A 1WDTA 1FQJA 2D7CA 3NBZC 3OESA 2QI9C 1D9ZA 2QP4A 1NBMA 4I1SA 1NBMD 2J9RA 2O8CA 1ONBA 1UBFA 3T15A 1XTSA 3E1SA 4B71A 3Q7QA 1T3LA 3B13B 3CM0A 4MYCA 1KTVA 5J4VA 2ZRNA 3M1IA 4HAYA 1DO2A 2B6HA 1R8SA 1OB2A 2ZVQX 2F1IA 3LLUA 1HUQA 1TX4B 2NZ8A 1W46A 3MSXA 3PEWA 1HQYE 1XMVA 3VMFA 4DLXA 1F48A 3KKPA 2VRWA 1G9XA 2A5GA 1GILA 2F1RA 5DIFA 1YHNA 4HB0A 1Z07A 1T3SA 4KLNA 4XIGS 4KI0A 4BRWA 2GK6A 2CEAA 4LJYA 1AKYA 4IDOA 1JAHA 1Z6GA 1YQTA 3C5CA 3EASA 821PA 4B3DA 2RGAA 1B23P 1TQ4A 4UJ3A 5HCNA 1MO6A 3CKLA 5B2ZA 4MITA 1N3BA 2FMXA 2D3WA 4JMPA 4KFUA 4G01B 3H0KA 2EFEB 5J4HA 1JECA 1W0KD 3RSOA 5BQ5A 3I1FA 1P61B 1ZM4A 3IIMA 4MRRA 4W5JA 2GCNA 1P5ZB 2A5FA 2IYVA 3B85A 3KKMA 4XVQA 5EE3A 3S1AB 3DM9B 4UNQA 2WWXA 4TYYA 1M74A 1KDRA 2CK3A 3W9YA 4BLSA 4NYJR 4BFSA 4OQXA 2CLSA 3REFA 1COWD 2ATXA 4LGMA 1GITA 1UDWA 3FHCB 1O3YA 3PITA 4IDPA 1V5WA 1CS4C 4JLKA 4C9BA 1RIFA 3OF5A 1JR3A 1T9HA 2ZJBA 2JJ2A 3T1QA 5KSZA 3FWYA 1E2JA 4EDHA 2ZSFA 3LA6A 4JSTA 1OKKD 2QY9A 1UKVY 3K0EA 4GOJA 3W5IA 221PA 4TL6A 3KQUA 2XZLA 3E5HA 2UKDA 4P4SA 1EX6A 1X3SA 3I4LA 4JLVA 1ZNXA 2RGEA 5DHAA 5EE1A 1II0A 4U7DA 1IXSB 1GG2A 2E87A 5CIQA 2EW1A 1XMJA 5AUNB 2I4IA 1EFUA 3TSZA 4BWYA 2DFTA 2R6FA 4ZCLA 2ZJOA 4P31A 3RS7A 5JS8A 2J7PD 1AJEA 4R98A 2E9SA 3T1OA 3QSYA 3RS2A 3SQXA 2G77B 4CEIB 3PFIA 2WAYA 2O52A 3TR0A 1BS1A 2L0XA 5E7JA 4U00A 4IOLA 4Z1MD 1HTWA 1W49A 2GEVA 4K81B 5UKDA 3W90A 3L8YA 4I1UA 3ZIAA 4M9XA 1P2UA 1SULA 1U8YA 4JLDA 3EC1A 3TQFA 4DC9A 5FOWA 4I4LA 4EQ6B 1UPTA 2AK3A 4IOKA 2ZRCA 4YONB 2ZU0C 1XTQA 3K70D 1DS6A 3W8RA 1ZM7A 2IYZA 5H8WA 3QKSB 3WBJA 4EPYA 1W36D 5AJXA 3GLFE 4UXJA 3UKDA 2WJHA 5FPYA 1R0WA 2FA9A 4UKDA 4TLEA 4OJQA 3EZFA 2BBOA 1KDTA 2BBWA 3MUFA 1CJTC 1VG0B 3EWSA 3PEYA 1E99A 2FN4A 3U2QA 1OKKA 3QF4A 4I1VA 3HPQA 4C0QC 5AJZA 5FL7D 1OH5A 4B3CA 2EFCB 3CH5A 5EP2A 2QTVB 3SFZA 1N5IA 4TZ0A 1QVAA 3NH6A 3LXXA 4M1TA 4KJZA 1E2GA 4YMUA 2R6CA 3SJBA 3SE0A 1P3JA 3GQBA 3KTAB 2PJRA 1PLKA 1ZNWA 4R2HA 1NMYA 3DMDA 1W47A 3GLIA 2OM2A 5AUOB 5FTMA 3BB3A 1E79D 4ACAA 5J4LA 1E9SA 5EXTA 3EPKA 1E2PA 4WAUA 4DCUA 1A5TA 1FP7A 3M6AA 1Q3HA 2TMKA 2W83A 1I4DD 1F60A 2Q6TA 2PCLA 2JLSA 3QPWA 3IBGA 1BIFA 1T6NA 1QHXA 4MRNA 4QJ3A 3UATA 1Z2CA 1R0YA 3I62A 1CKEA 2D2FA 2QPTA 1P60A 3Q3JB 4JLJA 1N6LA 2VSFA 4PHFA 1E9FA 4HDQB 3SJZA 4XTRA 2O8BB 1OLOA 1SHZA 1YE8A 5JCPA 1DAFA 2C9CA 2VP0A 2OUKA 2BMDA 3AVOA 1ESMA 1E2DA 3KB2A 3OE7D 4JLAA 4P4UA 5JMTA 3U4QA 1E2EA 1KYIA 3QG1A 2NQ2C 4NYIR 3AVXA 4L16A 2RB4A 4JLBA 4UNSA 4H1UA 4EFMA 2QBYA 2QE7A 1RZ3A 2QM8A 1K5DA 3SYLA 3LVQE 5K8IA 3VU9B 3RS5A 4M9ZA 5FOXA 1VDZA 4FN5A 2OBMA 1W4RA 2JLXA 2VHCA 2BHRA 2XTMA 3T1TA 3B1ZA 5G3YA 1T4GA 2WZQA 2QAGC 3BE4A 3U3JA 5KSOA 2BC9A 3TLXA 2CBZA 1NF3A 4P4TA 1OV4A 1GRNA 2XJ9A 4A9AA 3KB1A 2DWOA 1XEXA 1ZC4A 2WJIA 4Q4JA 1UJ2A 3CH4B 1GKIA 3AUYA 5H68A 5JBQA 2ZRJA 2ZUDA 1JB1A 3CR8A 3THWA 5CM9C 2IYLD 2F6RA 3OHMA 2DYKA 5BXQC 2IHBA 3T34A 2FFHA 3B1XA 4G5SA 2FPLA 1AIPA 4JYBA 4LJ5A 1SXJB 5FBLB 2ZRLA 1S9HA 4KYIB 1KZ7B 4KXFB 5KNBA 1XTRA 4BRUA 3NDPA 5AUQA 2B21A 2FG5A 3FMOB 1E1QD 5GJWC 3UWOA 5KDOA 1GKYA 4PHGA 1NN5A 3PG5A 2D7DA 5TY0A 2R62A 3AKDA 3IHLA 4HEJA 1BYIA 1ZIOA 2WWGA 3AVVA 4BUJA 2ONKA 2LKDA 4TQUS 1LB1B 1FOEB 1X86B 1T8TA 1OH8A 4IDNA 4YMWA 4WXPA 3LBNA 2JJ8A 2C9OA 2HF9A 4Y0VA 5FTNA 1G8PA 1NSFA 2OZEA 4FCWA 3SHWA 2XNDD 5JEEA 4GP7A 1NNEA 1QVRA 4E22A 2JGNA 3GLGE 1J70A 3RC8A 5FBVB 1N0VC 1I2DA 4EKDA 4LDJA 2FOLA 1XEWY 2A2ZA 3OIUA 4B3GA 4AI6A 3UMFA 3AQ4A 3HU1A 4QL3A 1FUKA 1Q1BA 1Z8FA 4Q4JB 3EZ6A 1GNRA 1XDBA 2JCSA 3QXCA 1U9IA 2V7QA 1GAJA 3W5JA 1JALA 2QUZA 4NCJA 2W2XA 4W9MC 1YR6A 2FF7A 1ZCAA 2WMNB 2DPXA 1KK3A 2GF9A 4G5OA 2ZI6A 4GPTA 1LTQA 4M1KA 3U44A 2XEXA 5JI3E 2YYZA 1TQDA 4JLMA 1VCMA 4BEJA 1A82A 2WKPA 3NBFA 2BJVA 3PQCA 1N6HA 2ORVA 2GESA 4Z1MA 3FPAA 3WYFA 2IEYA 3BOSA 1DTSA 4E5UA 5GJBA 1M7BA 2J0SA 3EIHA 3LW8A 3DM5A 4DZZA 2FGKA 2O0HA 1OIWA 4KVAA 4MGIR 2VPPA 4B33A 3KXLA 3I5YA 1W48A 4DDVA 3A4MA 3WNCA 5BYKA 2J41A 2JIZD 3QE0A 8OHMA 4AG6A 3WXMA 2ZYTX 4ZKDA 1NY6A 3I3SR 4DUGD 3LBIA 4M1YA 1XEXB 1YJ5A 4OHVA 2DCUA 5FUYA 5F9HA 3FKQA 3T5GA 5IT5A 2ZJZA 3IEUA 2O8DA 3GLHA 1P2VA 4DLUA 2KWIA 1KDPA 2HUPA 1GDDA 2ANCA 4POAA 1KI1A 1M6NA 2AFHE 4LV5B 2O8EA 4OI2A 2VQSA 4IFEA 1C4OA 4Q5IA 2PZFA 5DYGA 5KYKA 1VYUA 3K70C 2ZUCA 2RGGA 1XEWX 1NL3A 2AL7A 3RS4A 3TMKA 3DEFA 4QM7A 1NG9A 4F7WA 3AVWA 4JZKA 1LS1A 4Q4AB 1AZTA 2NPIA 1N6KA 1OYYA 3CWQA 3MLEA 3AV0B 1T91A 1GWNA 1OE0A 2CE7A 3ZQ6A 3BRWD 2C77A 1EGAA 1P9RA 3AGPA 3NDBB 4HI0E 2BVNA 1P9WA 3RRZA 4OHWA 3THWB 3OIYA 2RGDA 5TDHA 1Q1EA 2AD5A 3QKUA 2ZJAA 1GUAA 4G5RA 3UMRA 2XGJA 4O2LA 2W0MA 3U7EB 4GT1A 3CPJB 4X8HA 2FE4A 2OEPA 3WHKA 4C0KA 2AXNA 4CEJA 1OXUA 4TQ9A 2FSGA 3QVVA 4FD2A 3TAHA 4YQFA 4ERNA 2J0UA 1DAHA 2K5UA 5J40A 4ZO4A 4TMZA 1H8HD 2QAGB 1PZNA 2FX3A 3T35A 2QTHA 3RABA 4LK2A 2ONJA 1P75A 4QHTA 3FHOA 4PFSA 3FB4A 4Q48A 3THYA 4PSVA 3L82B 2GVZC 4HLQB 4Q19A 1JQLB 3TVDA 3UMSA 2O8EB 4DCTA 3B9PA 1XD2B 4L9SA 2GILA 2GK7A 2XJ4A 2ZPTX 4M8NE 4DEYA 2OCAA 4EIWA 3ICEA 2X77A 4LC1A 2C98A 3TUIC 4A0RA 1G6OA 1S3GA 3CRVA 3O8CA 3I8XA 2CNWD 4HDCA 2Q0HA 2PCJA 2X2EA 3AEZA 1SVMA 2IS2A 4GOXA 4X8OA 5FBWB 2P5SA 2F1HA 4O25A 4QBFA 2V8OA 2WICA 3BH6A 3MGCA 2G9NA 4LPKA 1XMIA 3ZZUA 5TXGA 1E9DA 1SQ5A 2R6AA 4KFSA 4ZDWA 4M4SA 4Q18A 2YKGA 5C46F 3SHFA 1JJVA 5CIWA 4ZDJA 1P6XA 3I73A 3LVRE 1PLLA 4ESHA 4JT4A 5HZHA 1NLZA 3VKGA 2ZYUX 1KI8A 2HLDD 1JEDA 4LV8B 3BORA 1GRQA 4PC3A 2GCPA 4M1WA 2WTUA 2ZU6A 5LD2C 3GLGB 2AHOA 2VTKA 1NN0A 1I4TD 1S0UA 1SVLA 1DAEA 5DSZA 1M7HA 4QNMA 2XSZA 2RHMA 2EU8A 4TT3A 2QE7D 3SYNA 1LF5A 4Q66C 4TL9A 2F43A 3GLHE 4PQFA 1XPOA 2P65A 4EPVA 3IIKA 5HR5A 4Q4LA 2GBLA 2R2AA 2VP6A 3GFPA 2ZETA 3QUSA 2WKQA 3T5DA 4RY2A 3UIEA 4A2PA 3OEHD 4A0FA 1KZGB 3AP3A 5KPDA 1Z0DA 5GVSA 3PUYA 5FL3A 1F6BA 1LS6A 2QU8A 1ANKA 4PZZA 721PA 2JLZA 2ZR9A 1G20E 3B82A 1M1YE 1CRQA 2J87A 4ACBA 1NG1A 2WIAA 1G1MA 4BLRA 3PXGA 4TL7A 3KJGA 3GLFB 3CNOA 1OT3A 2ZRKA 4AURA 1NVVR 1FW6A 3EZ7A 4L4UA 1U94A 3SBEA 4ASUD 2XTZA 3ZLJA 1Z29A 5ELXA 1YZLA 2WWHA 1DG3A 2GA8A 2WJGA 4AKEA 3TQCA 1OYWA 3MWYW 2WJYA 1X8LA 5CYPA 3ASZA 4LBYA 2O8FB 1TADA 1CBUA 4GNKA 2F9LA 2BWJA 2KBFA 3AB3A 1HY3A 3RWMB 4LYAA 5LPNA 1HE8B 4KVGA 1TU4A 2B7CA 2ODNA 4HAUA 2H16A 4KBFA 1FZQA 2HXYA 4BFVA 2IUSA 2ATVA 3QXSA 1PUJA 1Z47A 3F5FA 4CEJB 1P7CA 3K0SA 4Q7LA 2H57A 4IVRA 4PQYA 4PZLA 4R7ZA 3RRNA 3SBDA 3R8FA 4V02A 4IVQA 1QHGA 3LNCA 1FP6A 1KO7A 5KDLA 1JPNA 1XU4A 4D82A 2AR7A 1KO5A 2EVWX 3D3QA 2LWIA 1ZNYA 2GJAA 4CYMA 1YR7A 1EG7A 5SZIA 4TYWA 1E9EA 3DOFA 1EFHA 2FEMA 2VIIA 4DB4A 3Q8XB 2W6JA 4DLZA 5BN5A 2J3EA 1P9NA 1CIPA 3AGQA 2QP9X 4FMDF 4A36A 4YMVA 2VP4A 4Q4AA 2QM7A 1L7VC 5CM8B 5FUVA 3CF2A 2REBA 4AKHA 4CEHB 1VHTA 1Z22A 4D0LB 1N6RA 1R4AA 2CK3D 3EZ2A 3C14C 3LY5A 5EUQB 2J7KA 5D3MB 2P6NA 3CRW1 2F43B 4N1AA 1VYTA 2ODWA 4EUNA 3C15C 1TF7A 3WYGA 4AIIA 2CVFA 2D2EA 3P27A 2F55A 2IYSA 1OB5A 2PMDA 3SI7A 5EE9A 4D0GA 1SXJD 4PAQA 1E9CA 2VH5R 1XTIA 1ZUNB 3VKWA 1YZTA 2B8TA 3B1YA 2ZRHA 2OCBA 4DCSA 1R8QA 1Z0IA 2QSZA 3NH9A 4GZMA 3HR7A 4B6FA 3VR4A 2PT7A 2ZUBA 4NU0A 1SVWA 1G3MA 3D6TB 3B1VA 4LJ4A 4TLDA 5HTKA 5JHHB 4KHZA 1TUEA 1Z6YA 1EWRA 2UZ3A 5DLQC 1KNQA 5DNYB 4Q9LA 2OG2A 4MGKR 2C2HA 2VBCA 3LO5A 2AXPA 2CJWA 4HLDA 3IO3A 5LD2B 1RJ9B 1F2UB 3N2EA 4PR0A 2WMOB 5A4JA 2IW3A 3TUJC 3AVYA 1U90A 5GADl 2BKEA 2FU5C 2MSDB 4JL6A 4EAQA 5BN4A 1HA3A 1OFUX 3DMNA 5DN6D 1ZJ6A 1CJUC 1FMLA 1NVUQ 5HE8A 3S1AA 1W4CA 3OFNA 4LC0A 3QEJA 4CW7A 1S4QA 2GJ9A 1XTKA 3VR5A 1WQ1R 2IUTA 3A6PC 3CB4A 2BM0A 1I2MA 1N6IA 3PEUA 4MDFA 1G19A 1FFHA 1H8ED 5JI2E 4EQ6A 2IT1A 2ZSBA 2CVHA 1AZSC 2C95A 4RKEA 2CXXA 4QXAA 4HYYA 4C0AC 3QXJA 5JRZA 2O8BA 4F91B 3EPJA 4DLVA 2F9MA 1U0LA 3SU8A 3A4NA 4WZAE 1XX6A 2ERXA 3KQKA 5IDVA 1OIVA 4D25A 3P1JA 5E3HA 4DSTA 2F3RA 3P20A 1AN0A 4II7A 1JPJA 4FMCF 4I81A 4YDHB 3CX8A 2NOAA 4BEBA 1Z0AA 3KKNA 4DCVA 4CVNA 5KUTA 1A2BA 1DELA 1ETUA 2Q3FA 4I99A 1T0JB 2JLQA 3LFUA 4LHVA 1F5NA 2PT5A 4KSBA 1TF2A 5JSZB 3M0EA 3LQRA 2ZRGA 1IN7A 4U02A 1F3OA 4EJSB 1RYFA 5CYOA 1IXRC 2WWWA 6Q21A 3QXXA 4FCVA 2GBLC 2I1QA 1AGRA 3K9GA 2CL0X 3PIRA 2ORIA 2VA8A 4JJKA 5G40A 1XXHA 3B8HA 3PEVA 4HLCA 4PC1A 2FFAA 2E1RA 3SEAA 4D6PA 3CF0A 4NP6A 3THOA 2DWPA 3PUZA 1OXTA 4WW0A 2WVJA 1CR1A 2X19A 1F2TB 2PEZA 1RRGA 1AS3A 1E0AA 1N0WA 2DFLA 2XITA 2KE5A 3WNBA 4AK9A 3ND9A 1ZYUA 4GMDA 5EP3A 3R7WB 2YZ2A 1Z6TA 3IIJA 1BOFA 4LCBA 4LWZA 2G88A 4FWTA 1UKZA 4KU4A 3X1YA 3BS4A 3QI2A 2NG1A 3MRSA 2BDTA 1ZMXA 4D81A 3GJ5A 2OCPA 4NTZA 1NMXA 4MGZR 3KFXA 4DKXA 1D6JA 2VSOA 4RZXA 5JEDA 1E69A 3L0SA 4LBWA 3Q5EA 2ZJYA 4OBEA 3B2EA 1DAMA 3SDZA 1HEIA 3BJIC 4OQMA 2BCGY 4A82A 4TTPA 5DO9A 2ZS9A 1J8YF 4A6PA 3KKOA 1E9BA 3SYKA 1OFIA 1XZPA 2GDJA 2MSEB 1ZD8A 3I32A 4DIDA 5F9FA 3CPEA 3L8ZA 1T0HB 3ZQJA 5EXXA 1DO0A 1QHHB 5M04A 4G0NA 1X6VA 4HATA 4M9QA 1KAGA 4AYWA 1OHHA 1XTJA 2YC4C 2YWFA 1MR3F 3QOFA 2D62A 2Y8EA 4OHXA 4Q02A 2QROA 4HUQA 1VG8A 1KI9A 2C78A 1CP2A 3A1WA 4MKFA 3AVTA 4LY6A 1BMFD 4TMTA 1GRRA 3MWJA 2ZSAA 3AM1A 1VCIA 2HJGA 2IYWA 4OI4A 3AKEA 3DL0A 2FPKA 4HUTA 4OKSA 3SN6A 2CNWA 2RAPA 4Z8XA 5JS7A 1KO8A 2NO7A 4HLUC 2PX3A 1CJMA 3BB1A 4FW9A 3X1XA 1XJ0A 4RD6A 2A30A 1ZU5A 2P0EA 1N2CE 4BE7B 4IHQA 4KCGA 2ZRMA 3P4XA 2CL7X 4E03A 1HT1E 4V0NA 4J0QA 1G6HA 1E0KA 2R65A 1E96A 4HUQB 4ITRC 1M2OB 3EAQA 3I8SA 2OXCA 3U4QB 5KSPA 2IYUA 3KXKA 5FUXA 4BASA 4BECA 1RKBA 4GDFA 2QMHA 4OL0A 3GFTA 4LUCA 5G41A 2VHQA 2VP2A 4Q01A 5FR2A 4ASUA 2C9YA 5EUMA 1TEVA 3EWAA 3BXZA 2V3CC 3TR5A 4TT3D 4MYUA 4C0LA 4CIDA 3BBPA 2IC5A 1US8B 3FGNA 3ADBA 4RD0A 3NWJA 4A8JB 5FI0B 3WRYC 3THXA 3AKCA 1GL7A 4TSFD 3LH5A 1SZPA 1TQ6A 2B8WA 2V55B 3DO6A 4TMXA 3T1VA 3TW8B 4JJZA 1MOZA 2PZGA 3GCGA 3VX3A 3EX7C 3E2IA 3K9LA 3RC3A 4DDTA 3ZD6A 5TB5A 2HXSA 4M1OA 3F0TA 3PR1A 5JFGA 2QG6A 2G3YA 1KSHA 3LX8A 3JVVA 1ZCBA 2D4HA 4DBLC 1TQ2A 2BIFA 4RSGA 4TN1A 3EZ9A 1LV7A 1PJRA 2V7QD 2NO6A 4Q1FA 2XB4A 2OXRA 1Q1ZA 1KI3A 3LX5A 2ZI3A 3QIAA 5CJPA 5AWFC 2OSBA 5AR1A 5K8UA 1PUIA 3NC0C 1YVDA 4D2IA 1E3MA 3HYTA 4PAMA 2FWRA 3D8BA 4Q7KA 1KY2A 1UKYA 1X8KA 4M53A 4C30A 3RAPR 5L3SB 1P4SA 3K0FB 2IYTA 3C4JA 1CRPA 1VKJA 1NBME 3MWLA 4QG7A 1G3IA 1OJLA 2J59A 5L3VA 3O47A 1EESA 1KMHA 1EFCA 4NYIQ 4CT4B 3KUCA 3NEYA 5EXPA 3VR6A 5EE0A 1CR0A 1NN3A 3TE6A 1NLFA 4QOSA 1ELOA 3SJAA 5FTKA 3P32A 4XWKA 3ZVMA 3U7GA 3GLIB 1XRJA 2W6IA 4NL4H 1T8UA 2EWVA 3U6KA 2FPMA 4IDHA 2PH1A 3L0PA 5JSZA 4OI0A 3D7MA 3NVAA 3QY0A 2AX4A 4QNRA 4A2QA 1DOAA 2IYXA 1HT2E 4FXPA 4QKQA 1TPZA 2Q9AA 1Q22A 2QNRA 1KMHB 1GM5A 5CJ2A 4NPHA 4EJSA 1R10A 3FKSA 5C18A 4PHHA 2KJQA 4D26A 4S2EA 1FNMA 3BB4A 3KL4A 4B35A 1IJEA 3CX7A 4B3FX 1J2JA 3QBTA 3LLMA 2VP9A 3VNUA 4DLSA 4HB3A 3IHWA 1R0XA 3A4LA 3SFVA 2X8AA 4IVPA 1W5TA 1US8A 2D74A 1FTNA 1W4BA 4YMTA 5HPYB 1QBKC 1E2KA 4PPQA 1YRBA 1JR3D 3W3AA 5HCIA 3SZRA 3U3OA 1NSTA 2GXQA 1WBBA 1MO5A 1XD9A 1ZC3A 3AF4A 2IYQA 2RGNA 3NHAA 4LPSA 2Q3HA 1X1SA 4JBXA 3MJHA 4IEIA 5JRJA 4TMWA 1A4RA 4NKRA 2MMCA 2EWWA 1XD8A 5EZ5A 3CPHA 4JKYA 1GTVA 3BH7A 3L0OA 3T12A 4EPXA 1MABB 2WSSD 4AD8A 1RPZA 1Q57A 1OXSC 4Q9JA 2P2LA 4B76A 1GSIA 1VECA 1YZKA 1AKEA 2OAP1 3D31A 2W6JD 4CZ2A 3KQLA 3FFBA 4Z8YA 1R5NA 2JLRA 3IKJA 4ARZA 4PXAA 4V0MA 3AVQA 621PA 1PV4A 3V9PA 2JEOA 3U3RA 1X1RA 5AJVB 1KHTA 2V6JA 3FKSD 3UG6A 5CB8A 4BFZA 1D8TA 4MUAA 5EP4A 3I92A 3A1VA 4CRWB 1KMQA 5AJWA 3O8RA 4G5GA 1OSNA 1GFIA 2NMVA 2DWQA 2QENA 3RDPA 3AF0A 1NN1A 1G4UR 3V4FA 4EPWA 1NVXQ 1G4AE 1KO1A 3OZXA 1HH4A 4KO8A 5JJLA 1KSFX 2RGXA 3IGFA 5EE5B 1KSJA 1KGDA 3HP1A 1ZM2A 2A5YB 1IY0A 2YC2C 1E2QA 2RH5A 2B92A 3H2YA 4HLUA 4LJ6A 2Q9CA 3H86A 2VHUA 4MA4A 1IQPA 5F2EA 4M21A 1RE0A 5CDFE 4WA7A 3U44B 4K8OA 3FE2A 4BGDA 3OEED 2ODBA 1JXOA 4PTLA 4DCNA 1R0ZA 2XZOA 1S1CA 1NJGA 4ILEA 1KKLA 1MH1A 3GEIA 4CT5A 5DI3B 5DHFA 2WJJA 4ZCMA 3K0AA 2FSIA 1W36B 3QBVA 2YVUA 1E2HA 3BWDD 3HU2A 1IN5A 2FFQA 2A5JA 5SZJA 4LX0A 2VHTA 2ZR7A 3VX4A 5KOYA 4LBZA 2CCKA 2FV8A 2OFXA 3U61B 3C8UA 5FTJA 2C5LA 3MG9A 5E4FA 4V03A 1XPUA 1AS0A 2HT1A 3OFND 3ADKA 4JT2A 1IN8A 3GD7A 521PA 1H65A 3Q72A 3BK7A 5J4YA 5L8VA 5LDDC 4WZBE 4C7OB 4JLNA 3BFKA 3FMPB 4XWOA 4KSCA 4JVNA 4CDGA 2V9PA 4WVFA 1G3QA 3UK6A 5J47A 2XOKA 1Q3TA 4AYTA 1MO4A 2ECKA 3WMEA 4IRUB 1G7TA 5FR1A 1XWIA 4PPFA 3TUZC 2JA1A 2J0UB 5H70A 1E2NA 3SQWA 1E79A 2W58A 3KDSE 1G7CA 4C4PA 1XCPA 2NO9A 1U8AA 5HZKA 3GLIE 2VF7A 1U8ZA 3QNUA 3W6OA 4M22A 2YOFA 2BJWA 5HKKD 1ZAKA 1ZW6A 4URZR 1UAAA 1WBDA 3WBKA 3TRFA 1YZNA 2REOA 4PC7A 5JWOA 3G82C 4ZDIA 1K5GA 3U7FB 2FH5B 2ZJ2A 2XXAB 4M9SA 3QKRA 5DI3A 4LHXA 5FBRB 1CR4A 3UPUA 3LWNA 1WE2A 2JJ1A 5C2JB 1IAQA 4IOJA 2WWIA 4B74A 2WWYA 1HE1C 3WP0A 2XSZD 2FDCA 3HYRA 3AH8A 3VKHA 3B7GA 3UANA 1YR9A 4Q03A 4A92A 4KV9A 2ZE6A 4BZPA 4URVR 2HF8A 4PQRA 3I5XA 1AK2A 3LAWA 5C1BA 3BAFA 4EJSC 1QHIA 3H1TA 4QFMA 4FCTA 1D2EA 3WNDA 5L3QB 4JKIA 1NY5A 4CGZA 4RD4A 1W2GA 4A2WA 2BCJQ 4ARZB 3SOPA 4B2PA 5G3ZA 3BERA 1XD2A 3LD9A 4HZIA 2JASA 1C9KA 3DOEA 3Q9LA 4OK3A 3QENA 4XVUA 1K8RA 1RVDA 3HJNA 3KQHA 4AY2A 4JLPA 2OO7A 3QG5A 1P62B 2A7QA 2GHIA 4R9UC 4JS0A 4Q21A 3RVBA 4XSGA 1S96A 1VCOA 4K46A 1UM8A 3REGA 5G53C 2H7VA 3U60B 5BN3A 2EQBA 3T06B 1G16A 3TIFA 3PJRA 1EFRA 3TW4A 4C0JA 3BIFA 2YWGA 2BEJA 4N0DA 4BFWA 2PZEA 3L0IB 4JBYA 4TYPA 3EC2A 5D3QA 4TWZA 3TJZA 1S2MA 1QF9A 2QMOA 3QKRB 1PLJA 4AKIA 1UF9A 2RCNA 4TMVA 3QEOA 4DWJA 1D2NA 3CNNA 4BFTA 4HB4A 4QC2A 4MYHA 4NCKA 4ON9A 3ZYCA 3K0CC 1OXXK 4A4DA 4BLPA 2BEKA 5K8LA 3KX2A 2ASEA 5IK2A 4LHYA 1VCNA 5IF9A 1YRAA 1JEEA 4M0LA 2X2FA 1CTQA 4BPBA 1CEEA 1S8FA 3IO5A 1P73A 3OE7A 4JBWA 4F93B 4XH9B 1NI3A 3ZVRA 4DT1B 5FTLA 4E09A 4G5QA 3CRMA 3CW2A 1NVVQ 2ZRPA 4KBGA 4YXWD 3BFXA 5TMPA 1OF1A 4MQBA 1LVGA 4N0EA 2EFHB 2WPDD 5FBQB 3NHBA 3OEHA 5DI9A 2IUUA 1G7RA 1N5KA 5A0FA 3SNHA 1A1VA 2P5TB 4MRSA 2OAQ1 2CDNA 4H9GA 5FPTA 1MRNA 4ZI2A 1SXJE 1J99A 4BZQA 3GLGA 1G5TA 1E2LA 3GMTA 2ZAMA 3DVLA 1GZSA 3LW7A 4L8GA 2IWRA 2GRJA 2HCJB 1U99A 1Y3AA 2YOHA 2ANBA 3QKTA 4KLZA 3K09A 3B6EA 3MD0A 1YU9A 4FMDB 1SGWA 1ZD1A 4FMBB 1G64A 3ZVLA 5E7MA 2OESA 1JAIA 1N6PA 1IXZA 3ETLA 2ZRAA 1RRCA 5JZVA 1XB2A 5TVKA 1U98A 3R9WA 4GP6A 4LJAA 3L2OB 4M1SA 1XPRA 4PPGA 3RSLA 2O0JA 3W6NA 4P3YA 4NE2A 2JLVA 2JDID 1ZVQA 1CR2A 3CUEF 2PL3A 1IHUA 1Z08A 2W2VA 1VG9B 1U9IC 4B47A 4B2LA 1JR6A 2QGNA 1XMSA 3C7KA 2QZ4A 4MYTA 4OHYA 1QHHA 1RYHA 3KZ1E 1RFLA 2Z83A 5JLJA 2ZS7A 2ZE7A 4O3MA 4PHTA 1FX0B 3ASYA 4D4JA 4MKHA 3THYB 2HEIA 4C7OA 3WRXC 4B3BA 3K9HA 4DSNA 4DSOA 2AD1A 4GL2A 2EFDB 4UNPA 4GRAA 1E2FA 4I1OA 5JJKA 1W0JA 4PAOA 2XX3A 4PO8A 3EA5A 4UXHA 5AJYA 4AKGA 1J8MF 2BV3A 5CITA 2R9VA 1DPFA 2DY1A 4YMSA 1UDXA 1LY1A 2WV9A 2A78A 4LJ8A 3GEHA 4NCNA 3RNLA 3ZVNA 3ICQB 3IQWA 1GNQA 4L9WA 4X8LA 2RGBA 2V6IA 4A8JA 3HDTA 4US0R 1HQCA 1UEIA 2NO1A 4QJ4A 4Q1CA 1IN4A 3KJEA 421PA 1VG1A 1JI0A 5FPSA 3FTQA 3FVQA 3R7WA 1E9AA 1RJ9A 2ZXUA 2ZJ5A 1OIXA 1VIAA 3MMPA 1E1RA 5L3RA 2GZDA 4JVMA 3VR2A 2KI5A 5TARA 4B73A 3HPRA 1ZUHA 3KJHA 3N70A 4URUR 1V43A 4YDSA 4Q4HA 1TTTA 2IA5A 2AWNA 3PUWA 4YLGA 2Q3MA 1QG4A 4F4CA 4FMCB 4F4JA 1T5LA 4RVCA 1G3UA 4JIMA 3GJ4A 1KK0A 3ZZ0A 2QPAA 1ZINA 4BFXA 1DAGA 3THXB 1FPMA 2NTYC 1VIYA 2HT6A 3HWSA 2A9KA 5JWHA 3LRPA 1E1QA 1FX0A 4XVRA 5KSYA 2VP5A 1DADA 4GI7A 4DXAA 1W7AA 2PLRA 3I72A 1S1MA 1QRAA 2FJUA 3GJ0A 4UNNA 2LKCA 3LDAA 3IEVA 1DAKA 4NBSA 2F1JA 4Q1DA 4V0OA 4Q1BA 2ZSDA 4ZCIA 2W6ID 1COWA 2ZRDA 2ORWA 2IYRA 2IYYA 1WCV1 2IXGA 3BC1A 3FMFA 2ZIAA 2FSFA 2BMEA 1LF0A 2J1LA 4XTCS 2HV8A 2GXSA 3CLVA 3JVUA 2GKSA 3AF3A 1KI6B 3U7HB 4PC2A 2NZJA 1EX7A 1D5CA 2P6UA 1U2RA 3ZJYA 4LBVA 3AP1A 1SHKA 1DE0A 1N0UA 1W1WA 1JQJC 1Z5ZA 2OFOA 2QT0A 2QRZA 3DZ8A 5FOSA 4DIEA 1Q44A 3N2IA 3CZPA 3MJRA 4F38A 4RJLA 2QMUA 2AWOA 1LW7A 1T5IA 2JAQA 1XXHE 2FGJA 4WBSA 3H4MA 3LQQA 4URYR 1OH7A 3IQXA 2ZREA 4X8MA 1KK1A 3W8NA 5FPKA 1F2TA 3OAAD 2F3TA 2VF8A 4E07A 1JBKA 2Z4RA 4JVLA 5LB4A 5FOVA 1II9A 1NP6A 3C5HA 2Z6VA 4JLOA 4OQNA 4QRHA 3U3MA 4IOMA 1QDEA 4AYXA 4OHZA 5JECA 5SZKB 2OFWA 3QPVA 4RKFA 3DZDA 4CEIA 4TTRA 4V0KA 1DEKA 3KFVA 1KI2A 1YZGA 3SJCA 1N5JA 4XWAA 1ZBDA 5B57C 3FMIA 4F4IA 4WXRA 5BW8A 2Z4SA 5DGXA 4BQSA 1W4AA 3R9XA 3U3KA 1W5SA 4QBHA 1WB9A 3DHWC 1Z0JA 1KIMA 4URXR 1XP8A 2XTNA 2CHVA 4Q4HB 1N6NA 2ZI7A 1E2IA 4RFSB 4N3NA 4Q1AA 3F8TA 3N5CA 1EK0A 2G1JA 4CEHA 1P2TA 1JJ7A 5P21A 2OLJA 4GZLA 4TLCA 4B2IA 3VU9A 5D3MA 1VYVA 2C8VA 4W5WA 1UKEA 1ZM3A 5HKKA 4TYQA 2AK2A 5CLLA 1QG2A 2GTPA 3GJ6A 3B1WA 4WZ6A 1O87A 2D06A 1DARA 4EPRA 1SKQA 2ERYA 4NYMQ 4A0HA 3FDIA 2QA5A 2CHQA 2KSQA 3RS3A 4LOAA 4IDQA 5KNDA 2XOKD 3T61A 2PBRA 4S35A 4HZUA 3X1DA 3A8TA 2IEZA 2ZI9A 4Q7JB 2G1KA 4ZIRB 1SVIA 3KXIA 1A2KC 1WRBA 1R6BX 2VO1A 3BH0A 4TSFA 1KJYA 4NZYA 4W7SA 3V4RA 1DAIA 2WPDA 2BMJA 3AUXA 1KDOA 2G6BA 2C99A 3O8BA 2MMGA 4YXWA 1XCMA 5J4KA 3TSOA 1OH6A 1G3RA 1IM2A 4MKGA 3IILA 1G8FA 1NLYA 2EYUA 2R8RA 3TKLA 2FNAA 1NVWQ 4UNRA 4LYHA 3G0HA 1E0JA 5JJIA 1TAGA 5CK5A 2GJKA 2V1XA 3JZMA 2GEDA 2F7SA 2ZITA 1Z6XA 2B7BA 1GP2A 1Z0FA 3B78A 3BD9A 1AQUA 3TAUA 2CLCX 4XSHA 2JJ2D 4TYNA 1XJCA 2NPFA 2IS1A 2H8KA 3KJIA 2QP3A 3ZS8A 4D4MA 2FZLA 3KKQA 1H8HA 2P3SA 1N25A 1W2HA 2OLKA 3A1UA 3RLFA 1DG1G 1CXZA 1M8PA 5CDFA 1M7GA 2QN6A 4P32A 2OV2A 2WKRA 3WYAA 3QXHA 2AN9A 2VEDA 2HJVA 3QF4B 4UXIA 3TK1A 2RMKA 3VQTA 3UWKA 2YWHA 4Q00A 1CJKC 4F92B 1GIAA 1E1RD 3TGPA 2PJZA 1X8JA 4GOKA 1KKMA 2WSMA 2BMFA 3VHLB 3OIWA 4TLBA 4PSAA 4ABYA 2IL1A 4NYMR 3U6BA 1XFAA 5KO2A 5EZ6B 4ESVA 2QQEA 5DISB 3ND8A 3ONWA 3GJ7A 3KTAA 4GFDA 2J7PA 2RGNC 4LJ9A 3ADCA 3TSWA 1VPLA 5FPHA 2ZYWX 2N1BA 4HAXA 2V1UA 2NGRA 4QBGB 3EG5A 4C3ZA 4B3XA 1J90A 2ZQ5A 1WMSA 2J0VA 1BKDR 2IF0A 2XAUA 2FFBA 4Q7MB 2IS4A 1IBRA 4D4KA 3GPLA 3PUVA 1Y63A 3SR0A 5AUPB 3CR7A 2V54A 3CF6R 2QT1A 1SVSA 4NCIA 4RZUA 1KSGA 1P72A 2UZIR 3WMFA 2J5XA 3IDQA 4PX9A 4C0BA 3ZD7A 1SXJC 2N46A 5DH9A 3UG7A 2XXAA 5L3SA 1DBSA 1HURA 2C03A 3TNFA 1WF3A 3IPXA 2YOGA 3AVPA 5B30A 2Z43A 3NXSA 4HAWA 4XOIA 3R8CA 3K09C 2EYQA 1NJFA 4ZKEA 3TVTA 3JZAA 2HCBA 3W34A
chains in the Genus database with same CATH superfamily
5AOVA 1U0SY 3ZNPA 3DT6A 1LTKA 3GVIA 2JDIA 4NMWA 3C16C 1MC1A 4RGBA 5LU8A 2IS6A 4H17A 1VA4A 3PC2A 3W3ZB 3ZWOA 3IUPA 2RI1A 4IKEA 1XNJA 2PZBA 4MS1B 2HV9A 1XF9A 1A5ZA 2ZB7A 1JA1A 5K0LA 1X38A 3SG0A 5C80A 4KFRA 3RIMA 3QPCA 3B51X 2AW3A 1Q7RA 2Q21A 3JAKA 1ESCA 4RPKA 1JSZA 1WL8A 1X1DA 1QIGA 3FRHA 3B12A 4KE9A 1G5RA 1A8UA 2XXBA 4JENA 2IV3A 2XV1A 4IFBA 4KC0A 5ALVA 1U11A 2J6IA 1XTZA 2LCFA 5BW5A 5HUHA 1SFRA 3DLTA 2RBEA 4WY8A 2IEIA 2JFGA 4LHWA 1BU8A 3SXUB 4DMUB 2DBQA 3WK6A 3AF2A 2YL2A 5LA6B 2B0JA 4KPYA 2PFSA 2QL6A 2Y71A 3HCDA 4IIDA 4B34A 4E13A 4KIJA 1TLTA 1ULZA 3BQNB 2G5GX 1Y4UA 4N03A 4M1MA 4ARBA 4DHEA 3MGAA 2G5CA 3L6UA 4M0MA 2DECA 4KNVA 3WDLA 4HNVA 2R4QA 2RHDA 5I9TA 4V1CI 3PXBA 4W7IA 3R2JA 5M7EA 5BN3B 4MUFA 3NV9A 3VVMA 3GXBA 1UEJA 5CCDA 3HJGA 4M7RA 4UTVA 1YC2A 1UK8A 1R6AA 1DIBA 1NPDA 1I6LA 1T9DA 1Z37A 3G2MA 3K4HA 2VWGA 4DIMA 3HVJA 4XW2A 4NQZA 1Z13A 2D1SA 2QW8A 3QELA 3WHIA 5IVPA 1M83A 2DBZA 1G8GA 3DKIA 3AM3A 3VSCA 4JCOA 2EKPA 3H1GA 4YQZA 1BO6A 1S7CA 2YFQA 2CBGA 2A9FA 3U4CA 3FBWA 1OW3B 4F9GA 5HS4A 4QULA 4YUWA 5BWOA 3KQNA 3QUQA 3DJFA 4PFJA 1KK2A 2XHEA 2Y4OA 4E46A 1VHLA 1ES9A 2EJUA 3BIWA 3ZOKA 2HCRA 3LUHA 1XZMA 3L06A 4NICA 2OGWA 4UDNA 2YS7A 1V5FA 2G8LA 3A6EA 4S0XA 5K3BA 1W36C 4EO7A 1VE1A 2NO0A 3HFRA 1LLUA 4HAVA 1WA5A 4LJ7A 1JEJA 4QAQA 4DT1A 4LZAA 2FR8C 4HZUB 4HXFB 3K0BA 1Q84A 4OP2A 4MR8A 1KFEB 2OQVA 3PFCA 2IRWA 1W0KA 3IMFA 3ESXA 1ZN9A 3A4TA 4EYQA 1T25A 3D4BA 3E0XA 1WDLA 3IE0A 4YP1A 2VYFA 5F4ZA 3RLIA 3GLHB 1UZNA 4B7UA 3JVEA 4L0QA 1C3OA 3O4RA 4QASA 2OOSA 2PL1A 1SHJA 2AGVA 4Q1EA 4YAEA 1YULA 4A6XA 5DULA 4H6XA 1IN6A 2H7YA 3PYXA 1E89A 3CIOA 2H2DA 5TT1A 2VXYA 1AE1A 1O94C 1YQ9A 1KQPA 3CCBA 1ZEMA 3KYJB 3IULA 2PMFA 2HDNB 3C3DA 3EIQA 5FORA 3SVZA 1N9ZA 1NKSA 4IIJA 2WWFA 4E1BA 4ZV4A 1TM7E 2IU0A 1W59A 1KOLA 4B48A 1FUEA 2I2FA 1R7RA 5F3WB 4WK0B 3WJ1A 1HLDA 1MABA 5TEVA 2KB0A 1S2GA 1V95A 4QXMA 2ZEJA 4E12A 4UTPA 2ZI5A 2EBWA 4V0LA 1B15A 4EBFA 1EFDN 1E4YA 1F1BA 1HGXA 2A0YA 1IJFA 1HSOA 2FZVA 2FOIA 5FH9A 3G9TA 4Q9KA 5DIZA 4C6SA 3UVEA 1BS2A 3S3TA 1K0UA 4HDOB 3IUQA 5ILOA 3C8DA 4FJ1A 5KOHB 1G41A 2BZGA 2WU0A 3OHSX 3D4NA 3RFVA 4ZQCB 5KJEA 4DR4B 3CLSC 4PWZA 2GXAA 2W11A 1XJQA 4D3ZA 2PX0A 3I9NA 2NAFA 1VL8A 4FGLA 2OCKA 2N9UA 3LKBA 3OFSA 4Q37A 3RYIA 3K35A 1NVFA 5JCZA 1KYYA 2GZHA 1VQ1A 2JJ1D 4HGOA 2PPLA 2GN2A 4TKLA 4YN3A 2Q4BA 2Q4OA 3OZIA 5BYBA 1ATIA 1XF1A 4QGFA 3O8DA 1D2CA 1E1NA 4BP9A 1KVTA 3NG1A 5G1PA 1SVKA 2DHQA 4KYUA 2B6NA 4F3CA 2R44A 1XMOB 2C61A 4C06A 1F9EA 2QAGA 1DNPA 1RRPA 1RMYA 1RW4A 2JCYA 2Z8ZA 3BL5A 1N78A 3A2NA 3LXRA 2CLDX 4G9GA 2OKGA 1ZIDA 4JGIA 4B43A 2E37A 4MJLA 4D8UA 1Y7LA 2C8JA 4MUMA 1C4WA 2QE6A 1GRVA 4DSAA 5ALLA 1U1DA 1RC8A 1T1RA 1DC3A 1GKUB 2J0EA 2QRNA 2OV4A 2IK8A 4FK8A 1V5IA 3HVKA 4RCYA 4YHBA 1JLLA 3P4YA 2EEPA 2RJOA 2FKAA 2JRLA 3CISA 4HBGA 1D2HA 5CURA 1EP9A 1DMRA 3VYSB 4G0OA 2YHBA 2R6GA 3U4IA 4M55A 5B1HA 3A1TA 2KPOA 5IABA 1AZLA 4F2GA 5JV5A 2IHZA 4JI8B 1KP2A 2HA2A 3T7SA 5GMOA 1NVDA 3LRXA 3ZZTA 1Y8RB 1QYVA 3WKCA 2UUOA 3IKLA 4Z7QB 3A37A 4TM7A 1FJHA 3DAGA 3N7AA 4LE0A 3ESDA 2VSNA 1ACJA 4HY3A 3I61A 4BWGA 1IY2A 1J7KA 3EQ6A 3LPLA 2HREA 3QQ5A 2M1XA 1L4HA 1V1RA 3ND6A 4Z51A 1XZDA 4QBIA 3EIUA 1FRFS 3R7NA 1J1IA 2QJWA 4W9NA 2CLHB 2VLBA 2BDUA 3Q7PA 4J0IA 3FOZA 1MHTA 4BXOA 4DJFC 3IBYA 4A6EA 3IAS6 4NCHA 3ANMA 2P0AA 2O5VA 4I5DA 1SOUA 1AKRA 1PIWA 2AN3A 2VYNA 4INZA 4KH1A 4LTDA 1JR3E 5BYJA 5BWCA 1QV7A 4F3NA 7MHTA 2P6RA 1E8NA 2ADOA 3PYMA 4PG4A 1RWMA 2QX4A 2RGYA 3D3KA 3FZEA 4O0MA 4JB0A 3UA3A 2DR2A 1Q12A 3CVXA 2G5PA 1D6SA 1GVNB 3OJXA 4QRDA 1JTVA 2QVBA 5CVUA 4OQFA 2H11A 4GM0A 4KO4S 1BWSA 2WOOA 1E94E 4NMMA 1UEXC 3VDXA 2G83A 3L77A 4Z49A 5EUCA 3P0JA 3PUXA 1J0AA 3L4BC 3O3NB 1VKOA 1SK9A 4BNGA 1DJOA 4R41A 1G21E 2XMSA 3ERCA 2WUFA 4ID9A 2IWHA 1M0WA 3JYNA 1BYUA 2RAFA 5KWJA 1T9GR 3L7CA 3ZIAD 2L18A 4BNKA 5CK4A 2GEJA 4HH0A 1F3LA 2JVKA 2V4MA 2CF5A 3GEPA 1NM5A 1NW6A 4US2R 3K1JA 3ZDEA 3GPIA 4Z1OA 1R12A 1BCRB 2UVQA 1FVFA 2ZJ8A 3H2IA 5EY5B 2ES4A 3EVZA 4R81A 3VOSA 4IR7A 3NQ41 4D0NA 4DDWA 1GNVA 4CKCB 4A8JC 3O3MB 3ZK8A 4DLRA 1S2IA 1DL5A 1ZK2A 4XI9A 1EXMA 1Z2AA 3VTFA 5HXAA 4TKZA 1Q1QA 4KDRA 3LQYA 1FL9A 1UJ4A 3KKZA 1Z4PX 3EH2A 3HCNA 3PZBA 5SICE 5SZHB 1GPYA 4JQZA 1AXRA 3WV4A 2YHSA 3NT5A 4GMFA 4IILA 3LE8A 3U09A 1LDEA 3E03A 1BX3A 3M5DA 3MELA 4X45A 3T9EA 1BXRB 2VHEA 5JVDB 4NV0A 1W88A 2XMGA 3PCRB 2XNSA 2H07A 5HM8A 3R20A 1CNFA 1HV8A 4Y2GA 1E3QA 1HYQA 2O8VA 1ZN7A 5DSXA 3PC6A 4ZC8A 3UV6A 3V1YA 1PT9A 2FSHA 2FMHA 4OB6A 5ALQA 2NVOA 2ADMA 2POCA 1ECJA 4ZREA 2AZ4A 3LUGA 4KODA 2VNHA 2X14A 1JVNA 5J1TB 4M54A 3VU0A 1ESNA 4DJEC 1WXEA 1WUKS 2YZNA 3EIXA 3OWOA 3STWA 3AL2A 4IJQA 5AVWA 3HXOA 3QVJA 1Y3CE 3QA9A 4C2TA 4JXJA 3PENA 4FFBB 4JP3A 2PS3A 1CC1S 4OLJA 1LEHA 3NBYC 4FR5A 3B3QA 1ZD9A 3OZ7A 4IZIA 1E0DA 3ID6C 3V8NA 1QZUA 1RFGE 2CLOB 1OWOA 3NTUA 4NEQA 5E1BA 5EFZA 4PCUA 4CUJA 4EHAA 4F8EA 4LDPA 3NHJA 1TUIA 4ZU6X 3HBJA 4I9GA 2R68A 3MQ2A 2F00A 2VF5X 5K5EA 3GO4A 1ORTA 3BGIA 4I66A 1UKBA 3K1TA 3SKXA 2ARKA 4CQMB 1M34E 1VPDA 1DWQA 1L4UA 2WZBA 3WLRA 3X1WA 1GEGA 2QLBA 2BSAA 3OZGA 3OCUA 2AKEA 4NMLA 2X8JB 2GN0A 4Z2YA 3LGAA 2G17A 1EVEA 5LZ5A 1UBEA 1MW9X 4J3JA 5F98A 2OFFA 2C96A 3V8PA 4G8CA 5F7ZA 1W5EA 2X4IA 3AY3A 3FPHA 4I5IA 4QJ5A 3HG7A 2FWIA 1JWBB 2VXOA 4JUDX 1GCUA 1LVHA 3NXKA 4EENA 5LWHA 6NULA 1CJSA 3BE8A 4G0QA 4V0ME 4X3PA 4BKQA 1W0JD 3R5KA 3WL4A 3UK2A 2D13A 3QOWA 4Q1VA 2UV8A 1QUFA 4A03A 4WFIA 2QRJA 3C41J 4XD7A 2FEKA 3PHIA 3ROKA 3WLTA 4DMGA 4G3XA 4EK9A 2GVDC 5LOVF 4RETA 2IDKA 2YASA 4KRYA 1PSZA 4OGWA 4QGGA 3DMHA 1FNSA 1H8EA 1UBGA 1A5SB 4MV3A 4Q47A 1S8AA 3PDWA 3OIVA 3FCOA 4PGMA 5ARBA 1LBTA 1J25A 1ZLXA 2BEVB 2AKAB 1OWNA 1UP6A 1U5CA 4R1NA 1TMKA 2GCOA 2PH7A 2DFKB 3HC7A 4N6OA 4RLFA 3ML1A 2ZT5A 3RSHA 5ADHA 5K9ZA 2IX3A 2Q7XA 4CKZA 1MT3A 3R4CA 4JBGA 3ED5A 2HPZA 2ZFUA 4JL8A 3NWEA 3ZGOA 2QTLA 5K01A 1MOQA 4KAAA 3ER6A 5AM4A 2R6HA 1UBUS 2YN0A 1EBBA 1PL0A 3JZDA 4AG3A 1Z3CA 2J30A 3SC4A 4XYGA 1AUQA 5AK0A 3MTAA 1ZCFA 2XCOA 5DX8A 4YPOA 1DBVO 4FUTA 2J8ZA 1O9BA 1YZUA 3W6PA 4HVCA 4RE5A 1KJZA 2QTFA 2FQYA 3U13A 4MZDA 2FF5A 4DIOA 3H3JA 1Y5IA 3MILA 3JALA 3NBUA 3PIIA 4FGKA 4CTOA 4G5YA 1XI2A 1RCTE 1AKVA 3PLRA 1AMUA 1Y80A 3L8MA 3EPLA 3FTNA 4GPZA 1V1MB 2BKUA 3ER9A 4TSKA 1EWTA 3GGGA 1MNQA 2AG6A 3CYFA 3FFWA 4U1RA 2YWEA 4I55B 3ZC3A 4KMRA 4RJTA 3FD8A 4XASA 3T8YA 4RQBA 2MT9A 1NBMD 3RRJA 1HNWB 1WEHA 3MCVA 2J9RA 3UUEA 3ETNA 4B71A 3E1SA 5T4FA 1T2UA 5J2TA 1J5XA 3GFGA 4MUJA 1KTVA 1YGYA 1U9ZA 2CVQA 2ZRNA 2ATIA 2VPZA 3PQFA 4H3VA 1DO2A 4HAYA 3VDRA 2DCMA 4QYIB 1R8SA 3QX8A 4F6RA 4V1CB 2PUTA 1PI3A 3KYIB 1H1LA 4AECA 2NZ8A 1W46A 1Z18A 3ROEA 2ZXFA 4EDFA 1XMVA 4LDQA 4Y2PA 2V59A 3HDYA 1F48A 1NXSA 3KKPA 5B55A 3LP5A 3E8MA 1IBLB 5A3SA 2RJNA 5HTOA 4RANA 4M37A 1G9XA 4A8HA 1Q0QA 2P77A 4PNZA 1P0QA 2OORC 3T3OA 3HKDB 1I1HA 4MCJA 2ZG6A 5SY9A 5KMGA 1GILA 1YHNA 2SKEA 3MWEB 4J03A 4P80A 4UVGA 1Z07A 3UB3A 2QTGA 3R3WA 1EAYA 2FMUA 4XIGS 3ZBTA 1CUVA 4G8JA 3RVMA 4DV2B 2IXDA 3I45A 2CEAA 2WTNA 1K8QA 4OSOA 4U4AA 4ZYWA 4QATA 5HA5A 1MX1A 3WWZA 3PT5A 1DC5A 3SBOA 3CLSD 2B4AA 3LDFA 1WUJS 1YCFA 4P58A 3EASA 4NFHA 4CN8A 1VI2A 4HNQA 3OTGA 2V3VA 4RZQA 1MO6A 5DBFA 2FW0A 3KQSA 1N3BA 3KEFA 2FMXA 3AR8A 4CG3A 2P5UA 1RLJA 2VAWA 4JQCA 5FO0A 4UFPA 5PNTA 1KRXA 1W96A 3KAPA 3RV3A 2J5BA 5BQ5A 2GCNA 4AMYA 4FDVA 3DM9B 2JZNA 3HYCA 1M74A 4RNCA 2CK3A 4BLSA 3NBAA 4RKYA 1XU7A 1ZI6A 2O1SA 4PYOA 1EK1A 4F45A 1AF7A 3RWBA 1CSEE 2H48A 1OAOA 1GGJA 3ZDDA 4MA5A 4YRJA 4LGMA 1GITA 1YCDA 1JGTA 2C7RA 1O3YA 1FF9A 4EX6A 5T3YA 5CDHA 1KFBB 1ORVA 3A9RA 2QG9A 3KELA 3W5UA 5K4HA 2IUFA 2GARA 4L72A 1W8IA 3ZHTA 4K28A 5M34A 1JR3A 1VIDA 5C53B 2DM6A 2JJ2A 2UVPB 3WKAA 2FN7A 2O3RA 4C2AA 5B3LA 1E2JA 3DUFA 1GFSA 1P6QA 1ZMTA 1BQEA 1FE8A 3EUEA 1KF0A 3L7IA 5HFAA 2JFFA 1M3SA 4GOJA 4IRMA 1UKVY 5AT1A 1D3AA 2XZLA 2PDAA 1PX2A 3ABQB 2HPAA 4RMNA 1H2EA 1GZ7A 4IWYA 4UFOA 2WYIA 1UFOA 3EZXA 4U7DA 1E7QA 1XR3A 3NOOA 4JLWA 4JH0A 1TJNA 1G21A 3PP8A 4U7JA 3DJYA 5K2MA 5JO0A 3HA5A 4XGNA 2ZDGA 2ZJOA 4O4LB 3EGEA 5T8KC 1A7AA 1TO6A 3AR7A 4R98A 2E9SA 5TMBA 4C07A 2A9QA 3T1OA 2CL5A 3RS2A 4HNRA 2G5TA 4CEIB 2FXVA 1E3WB 1WCIB 3JAWB 1T26A 2QD5A 3BJEA 1X1CA 1IHYA 1WMDA 2L0XA 3PFNA 2Z2IA 3O3OB 3N6RA 1W49A 2X5NA 5UKDA 5FAXA 3W90A 2Q3DA 4TOIA 3L8YA 4I1UA 1RQLA 4I50B 1A7UA 3H2GA 5BVHA 3FOEC 4UZFA 4E2ZA 3WMRA 4KIWA 4K9NA 4L28A 3NNNA 5CP8A 2P9GA 5BV8A 4IOKA 4RVHA 2X3UA 4HNSA 3RBXA 4LJSA 1BX1A 1QKIA 1CR6A 1XTQA 3BMNB 4Q05A 1TZBA 2JZCA 5IBRA 1LQTA 4BS9A 4J43A 4PLPA 2IYZA 3OO1A 1FFBA 2HR1A 3Q7RA 8MHTA 1KZHA 3ESBA 3DE2X 1H22A 5FPYA 2RFLA 1RJGA 4UKDA 4TLEA 1N0IA 3GT3A 2R86A 1NHWA 3EZFA 2JRCA 1KDTA 2BBWA 1E4EB 4EX7A 1CJTC 1E99A 1XTVA 1ZHOA 4H6VA 5EJMA 4P4GA 5G4LA 1OKKA 1ZZGA 3LY8A 4JJAA 3HPQA 3UOAB 4C0QC 5AJZA 1T5DX 2P40A 4ME6A 4CFSA 2E4AA 4MVJD 4Y3UA 1AH2A 4R84A 3KKKA 2QTVB 4ZV7A 4RX1A 2IOFA 1N5IA 3I37X 4R7TA 5AI6A 4TZ0A 3NH6A 2Y0DA 4KQ6A 3RE1A 1E2GA 2B5WA 2RKWA 1B0AA 1NQXA 4YMUA 1X7YB 2R6CA 3AUAA 3ORSA 1K97A 1P3JA 5GGYA 1RWBA 3GQBA 3KTAB 4Q93A 3WL8A 3IDFA 1NMYA 3DMDA 2G8NA 3HBAA 1Y6RA 4XPZA 3GLIA 1I8TA 3RIGA 4F56A 4YHHB 5FTMA 2ZTUA 3BB3A 1E79D 4ACAA 5J4LA 1C80A 2GMWA 3ONDA 2X0FA 1E9SA 2ZIVB 1FJGB 2R7KA 3P9NA 1Z7WA 3GA0A 3IURA 4RDHA 3RO7A 2XDQB 1YK1A 3D54D 1FP7A 4HVTA 2TMKA 2W83A 5FWAA 4WK6A 4BBPA 1EVZA 1FFAA 1G8MA 3K1YA 1F60A 3OH8A 4ZOEA 3K0HA 4PLZA 3QPWA 3F9IA 1H4SA 3PB3A 4O3FA 1QOPB 2WQ7A 1QHXA 1Q16A 1UBOS 2M6RA 4QJ3A 4YWHA 4GG1A 4WZAB 1Z2CA 3EVBA 1ZY2A 1QNFA 2PMWB 2QAIA 3EVFA 1FUYB 2ZBUA 5GM2A 3SJZA 2JJMA 5ALZA 2O8BB 3IQHX 3LNTA 1HRKA 2WHQA 3GEBA 3U4MA 1WHTA 4GKKB 2ZW9A 1YE8A 3A7DA 4HHEA 3O8QA 2J9FB 1CUJA 2OUKA 3KB2A 3TDNA 3EQ7A 3U4QA 1DQZA 1SHUX 3DVAB 4AJ9A 2BEUA 4BX3A 1FS6A 3QG1A 2PRIA 2HK8A 2Z58A 4BVHA 5JIBA 4GX5A 3HKEA 3DZGA 1K08A 1SH7A 2DBRA 1QGUB 1TAQA 4H1UA 5ALGA 2GFIA 4XEHA 3IP3A 4JEUA 3DQQA 3KQTA 5K0NA 3OLXA 1RZ3A 2IPMA 1K5DA 2QM8A 4DG9A 4NCAA 1UDAA 4EG7A 2EC5A 5HUQA 3IB6A 5FOXA 2P91A 3L92A 2JI6A 3AHGA 2PV0A 4IZ6A 2OBMA 1DIOB 1Q7CA 1W4RA 3G2NA 4X7PA 3D0RA 2VHCA 3D7SA 2JLXA 3T1TA 3ICVA 2IDMA 2QAGC 3BE4A 5KSOA 4EUHA 2BC9A 3DVSX 3RUEA 1GUZA 1ZR2A 1NF3A 1OYVA 2JLWA 3NUGA 2XJ9A 2DAPA 2JIQA 3SZMA 3AESB 4K1XA 2DWOA 1G8JA 1XEXA 4Q4JA 3NBQA 5HIAA 5JZMA 1ZBQA 3AUYA 3QFCA 3JQ8A 5KNDD 1RZRA 2ZRJA 5JR3A 2OZKA 3CN9A 5AM0A 1JB1A 2IZ0A 2NM0A 2SCUB 2WTAA 1A8HA 1VE6A 4OA8A 5AW5A 3R7LA 1NULA 1XQ9A 1NVAA 2DR0A 2DYKA 2HJWA 3E7XA 4JR1A 3KYCB 1SRRA 2JAWA 5JS1A 1NNLA 2I67A 3W5JA 1AIPA 1X80B 4QQFA 1TA9A 4DJ5X 2ZRLA 5KNBA 4AKSA 2GVNA 1UJ5A 2RK4A 3X1KA 1Q3KA 3N39C 4E30A 3AQIA 3ER8A 3QV1A 3T4PA 5K6TA 1DEAA 1JQ5A 2FG5A 2NSLA 3FMOB 5JCOA 4ND8B 3HVIA 1UBJS 5GJWC 3UWOA 3OCCA 5G0SA 4I50F 3RYCA 3VDQA 1N2OA 3C39A 4PHGA 2XMPA 4EATA 4D46A 1TM1E 2OBFA 3B8EA 5TY0A 3WGZA 5INTA 2B1IA 3RYHA 5KTSA 5KYYA 4EA7A 1E1CB 4DC1A 3NALA 1CYEA 3AVVA 5IUNC 3L6DA 3R6TA 2HW8A 4RGVA 4CTNA 3VR5H 3FYTA 2H0AA 1UC4B 4NATA 4UD6A 1L5RA 2ONYA 1JIQA 5L3ZA 1FOEB 2UDPA 1W73A 4FMPA 2Q6VA 3DPSA 4JLUA 1UPFA 2PRYA 1QOQB 4KFCA 4WXMA 3G9ZA 4RVGA 1RYMA 2HF9A 3HO6A 5FV7A 3IP7A 1G8PA 1NSFA 3OIGA 4K7JA 4YJ2B 3A1CA 1WBJB 2C82A 4RHTA 4H08A 1NNI1 2FSVC 4BMPB 1QMGA 3M34A 5DGIA 5ALRA 5LMNB 4KWHA 4WJLA 1I7LA 1RCFA 2NV6A 4RA9A 4EKDA 1GTL1 1XEWY 1DXHA 2AJTA 3TNJA 2P75A 3AQ4A 1QPZA 1FUKA 3H5LA 3GUVA 4I5EA 5HFNA 2PWAA 4W5QA 2ACVA 3M1YA 1RQRA 2FR1A 4WCVA 4AU1A 5AVQA 2ZDQA 2CB9A 3WMWA 1CUEA 2GF9A 4GPTA 3HY4A 1LTQA 2AVDA 2CDRA 2Q1TA 2YW9A 4M1KA 3PTLA 4JLMA 1VCMA 3HV2A 2W43A 1A82A 2VWPA 3DAYA 4XYMA 3UC5A 5ALEA 4YRGA 3PC4A 1A72A 1N6HA 5KNBD 1JUDA 1ZJYA 1Y4AE 4Z1MA 4K6GA 1TVKB 5L95A 1UZUA 5JS2A 4E5UA 1GDHA 1M7BA 3V2IA 3L4SO 2IXBA 5BW4A 2FGKA 2O0HA 2YFYA 3N2LA 2ZUTA 5L45A 1DTWA 1LJLA 2VPPA 3I5YA 1M2OA 5I3CA 3DYBA 2PAFA 4RHUA 2J41A 3V7WA 2H4FA 2ZUWA 1AMOA 1K3FA 4PONA 5I7AA 2X23A 3I3SR 4DUGD 5BSTA 2ZCJA 4WZBB 4CDRA 5KJFA 3R6WA 5F9HA 3O92A 3U1TA 3G2PA 3IEUA 1EMDA 1U4OA 4IH1A 3ZHOA 3W2TA 1LNSA 1Y33E 4G8BA 5JISA 3AR9A 4IIFA 3ZW9A 2IEBA 3GFQA 4UVDA 4KJXA 3EXEA 2F9FA 1GG5A 4F4UA 2AFHE 1SEPA 2HIHA 2C9MA 3EMKA 3KVNA 4URFA 2R1VB 3NW9A 4HFJA 2FW9A 4FX2A 3MRTA 4N5IX 4DNXA 2PZFA 2FRDC 5KYKA 1UOOA 2Q5JA 4BB9A 5IKXA 2PR2A 5KJ1A 4L76A 3K70C 3ICWA 3PQ7A 4HADA 4UM5A 4WA8A 1MN6A 4G1MB 1TJ4A 4U7GA 2FPOA 5GINE 4CHGA 3PNSA 4ZYTA 1NG9A 1N5MA 3OCYA 1YTLA 5IDYA 1DEOA 3B2NA 5AJHA 2NPIA 1OYYA 3MLEA 1M2KA 3AV0B 2IIVA 1GN9A 4KRGA 2Y93A 4JI6B 4IIYA 1T91A 3PWZA 2CE7A 3GHHA 4DC0A 1EGAA 3K2QA 4ZO7A 3TDKA 2YV1A 3VMMA 5K03A 5K3OA 3HGMA 3THWB 3OIYA 2JLAA 2RGDA 3D1VA 3ORQA 5F64A 1P7YA 2IZ6A 5GPBA 4F2WA 5ICEA 4IMIB 1RYDA 5H0IA 2W8BA 4QTUB 2ZAGA 5EJIA 4G5RA 4P84A 3A25A 3IDAA 4KQ9A 3RREA 4DMCA 1K7SN 4FQ5A 2QTWB 1CZLA 3DFIA 4LWOA 2ZJ1A 5F2KA 5FYDA 1L8XA 3U17A 3U7EB 3W6UA 2OEPA 5HP4A 2AI2A 3MT7A 5CDSA 4EA8A 3GBSA 4G0VA 5CVVA 3QVVA 3HNPA 4ERNA 2JHFA 1U2QA 2J0UA 4HRYA 5J40A 1QGDA 1X2EA 1V2GA 4X6LA 1Q0HA 1DX9A 2W6ZA 1O2DA 1JZSA 4TMZA 2R11A 1H8HD 4Y67A 2FX3A 3T35A 2P3OA 2C2GA 2CFOA 2V3WA 3FVTA 4D8YA 3ZY2A 4ARCA 2PIAA 1A50B 3IAEA 1Q0TA 4BGVA 1R37A 4FGSA 5IW8A 4HLQB 3AMVA 1JQLB 4Q19A 3TVDA 3UMSA 4C4ZA 1OJ7A 2V6BA 4BBJA 5C35A 4JV5B 1IRIA 2HMYB 2GILA 4X66B 3ICEA 2QLNA 1I01A 2YICA 4I46A 3UENA 3OICA 2C98A 1IEXA 1QE3A 2QIPA 1N2BA 3DZJA 4KQMA 1DAOA 1C9MA 2IE0A 3C6XA 1RRMA 1RYZA 4HPXB 2FX5A 3VRHA 5BUSA 1DZIA 2X2EA 1GPWB 3VVLA 4RF3A 2CMGA 2GDZA 2V98A 1LDNA 2ZBEA 2RG7A 4OAPA 5BNZA 4X8OA 5FBWB 4RHFA 4KO2S 2OC9A 4CG1A 4QBFA 1I36A 3A9TA 3BH6A 3FUXA 2G9NA 3ZZUA 2DPGA 1E9DA 1SQ5A 2R6AA 3H16A 3MYRA 4UAJA 5ALHA 3D2AA 1RAIA 4ZYUA 4YJ2F 2XE6A 1IM5A 3N2GA 1BFUA 3PQ4A 2WAMA 4KQWA 2IVZA 4NZ9A 5BNTA 5D1HA 3SHFA 1JJVA 8ATCA 2UUPA 2HLPA 2P9ZA 3I73A 2OBYA 3A11A 3MJDA 1A2QA 3QIVA 4HN9A 4IINA 4JT4A 4WESB 2ZYUX 1KI8A 1MXFA 5ESDA 3VKGA 3PXUA 4X63A 4FBLA 4QAJA 4BVFA 2HSEA 3C6QA 4TKMA 4IGAA 1JDSA 4IV0A 3C43A 5LOVA 2VTKA 4KRFA 2BGJA 3JASA 3VZPA 4GHWA 4J76A 3W1VA 4AY6A 1DAEA 3AG5A 4HMQA 4K9OA 5DSZA 4EFKA 4JI4B 4RPIA 2WYVA 4RMHA 3MEQA 2RHMA 2V4UA 3TTYA 1JH9A 1JR2A 2QL9A 5L4NA 4JUAA 2F43A 3GLHE 4E2FA 4H4CA 4XQGA 4XM1A 1ADJA 2NV0A 4S3MA 2NWQA 5EWJB 4J91A 4CMEA 4K9RA 3IT3A 2H08A 4BXOB 1MQSA 4YRFA 3OEHD 3M6MD 4BB0A 4O1HA 2A0KA 1I2ZA 4JD5A 2QU8A 2PGNA 1NR5A 3IVCA 1I10A 4PZZA 1QS0B 3OOYA 2AF4C 1ZN8A 4MAMA 4CKCA 2ZR9A 3TXAA 3SICE 4YRSA 1X92A 2R8BA 5D51S 3UMMA 3G89A 3Q3VA 1NG1A 2WIAA 4RF2A 4ACBA 1G1MA 3PXGA 3LDHA 3L49A 2QW0X 4HMPA 3CNOA 4KXNA 1PGOA 3A7EA 1S3FA 2ZRKA 4AURA 4G4GA 1V6CA 1KY5A 4ESOA 1P5HA 1Z82A 2COUA 3EZ7A 3OLQA 4NK4A 4EI8A 5C3UA 2ZIWB 2QJRA 5AIAA 3OJOA 5ELXA 1P0MA 1DG3A 3QYJA 2XF2A 3HKCA 2R00C 4RGQA 3MZ0A 4D9CA 4UJ5A 1OYWA 3MWYW 3ZHRA 3AOEA 2RHLA 4DLPA 3S2EA 4CV3A 3ASZA 2IW1A 3U0BA 5DWDA 1ZL0A 2PMCA 2BWJA 1WW8A 1O54A 1HY3A 2AMYA 4X1OA 1LVUA 5BV7A 4D98A 3OHPA 4MVJM 2C5SA 1ST2A 2B7CA 2ODNA 4HAUA 1COZA 2YN2A 3MOIA 2HXYA 2MJLA 3R3ZA 5CHYA 3U39A 2IUSA 1O97C 4TKUA 4L5IA 3PJEA 1DIHA 3QW4B 1SIWA 2L17A 1PUJA 3HS3A 1OWMA 2WJ6A 3K5IA 3F5FA 1D03A 5DM0A 4LJRA 5BWNA 3UMBA 4AMBA 4B31A 3TGLA 1E58A 2GF2A 3EEBA 3HBLA 1WMFA 4PG8A 3K0SA 4R7ZA 4PQYA 2P9JA 3RRNA 1GAWA 3STTA 2Z2JA 2F3UA 4ALIA 1T1SA 3LNCA 3NJRA 4D82A 2BGNA 1Z34A 4GQIA 3BEDA 1Z35A 3TTSA 4JWTA 3VPSA 1KO5A 3D3QA 3W2GA 1A04A 1IQRA 1LPMA 3FSGA 4BO7A 3HACA 1ZEJA 4G07A 4KGDA 5SZIA 1FU8A 2HMWA 3K05A 1YBHA 2OCDA 4QEDA 5EZYA 2VT6A 3CEAA 3DOFA 3GC6A 4NH4A 1EFHA 5DNWA 1RADA 2AC2A 1ZI8A 3EZLA 1E6KA 3MS2A 2WTUA 3IR7A 1P3Y1 2M6SA 4ND6A 1DBWA 3V2HA 2PSEA 4TV9A 1VE5A 1EP2B 5DNEA 1VBNA 3N0RA 4JI3B 4CV1A 1P9NA 1UFVA 2QP9X 4G1BA 4GIBA 4YMVA 4UNIA 2R6R1 4JI1B 4U6SA 2QM7A 1L7VC 1QPBA 4ZD6A 1BE1A 2REBA 3UM9A 4ZRMA 2G4VA 1JHQA 4OPMA 4EGCB 1ML3A 2B4KA 5CT9A 1N6RA 5TQ0A 1EE2A 4D0LB 2CK3D 4WE3A 2YIVX 5HX7A 1B3RA 1KYXA 3BRSA 2OTCA 2QQFA 3JQBA 3P9QA 4HYQA 1U3TA 1VYTA 1J22A 2ODWA 3NASA 5CA0A 5MGBA 3C15C 3BGSA 3WYGA 1DDOA 3NETA 4MXDA 2JFZA 3DL2A 2PD6A 5IC4A 5K09A 5C37A 1L7AA 2PX4A 3PDIA 2WIDA 2IYSA 1QE5A 3NORA 3ZGVA 1U4NA 4C5BA 4HT3B 3GXOA 1FSPA 1J2UA 2OG1A 2WSIA 1SXJD 2B20A 3ECSA 4PAQA 4D0GA 4ESHA 4J7XA 2G71A 3H2JA 2X7HA 1T2NA 2WDZA 2YBEA 1MH9A 1DWOA 2B8TA 1SXGA 4JYMA 1L3IA 5EQFA 4DCSA 3EUFA 1Z0IA 2OORA 4TLLB 3KQMA 1N2CA 2XLCA 2Q07A 3GT4A 1G3MA 3INRA 5JHHB 1I5RA 4PLCA 3ZJUA 3IERA 2VPYA 4AX8A 2Q46A 1TUEA 4EYSA 4FYYA 2C2HA 2JBAB 3SX4A 1U8UA 3ZGYA 5FYQA 2Q4RA 3GDFA 1I7PA 3BPSA 3OUZA 4G26A 4HLDA 4NENB 4WK2B 2YTZA 1RJ9B 3OZCA 4X1IB 5HEKA 3TKYA 2YJ5A 3UOGA 5EEGA 5HK8A 2C2WA 1CPYA 1BW9B 2GNAA 3NLLA 2FU5C 2NQ8A 5DN6D 4YRDA 4NIMA 5BN4A 1WU8A 2OB1A 3CVYA 1GZ3A 1ZJ6A 3EQ2A 3WVNA 4BO0A 1NVUQ 2XQIA 3HKEB 4RY0A 3BFPA 1W4CA 4JJGA 4YBRA 2CT8A 2DVMA 2GJ9A 2PFKA 2PH5A 5IFLA 4G8DA 2IUTA 3IKMB 2Q5IA 2C59A 4X93A 4AUNA 1Q7EA 3A6LA 1NURA 2BM0A 2ONZA 4IH9A 5EHIA 5LZ4A 1JEAA 4HRXA 5LMCA 4HC4A 1RT9A 3PEUA 2GM4A 1N8NA 1G19A 2G40A 4N82A 4WEQA 4BLVA 4MDFA 3DS8A 2ISCA 2I4OA 5F9MA 1HR0B 3JW8A 2IEAA 3AEUA 2ZSBA 3S68A 3D8HA 3C45A 3NNDA 1GL3A 3NDBB 3NBKA 2FN3A 1OLSA 4HYYA 4ETMA 1VE3A 5JRZA 5LYJF 3IX7A 4IIXA 4AQYB 4WZAE 4COKA 4JI0B 4FHZA 1X3LA 3EIWA 3P1JA 4DSTA 2Z6AA 3RT1A 3SYTA 1OWPA 3WGIA 3BIXA 1AKQA 5FEMA 3VPDA 3NVMB 6ABPA 1AV7A 3IUMA 2NOAA 5H5JA 2ZTHA 1NP7A 5LIRA 2AJLI 4JROA 5AK5A 4DCVA 2WMYA 1I94B 2O8NA 1A2BA 4MWSA 2ZKLA 3RGGA 2ZKIA 4FT4A 4GZ6A 2NU8A 1F5NA 1P5RA 3VR0A 5JVDF 3QHQA 5LN1A 3WBBA 1IHPA 2GZSA 1OBCA 2B1GA 4XB6B 4EJSB 3P9IA 5T67A 4CMIA 3GFRA 2WWWA 6Q21A 3CLRC 3VNRA 4QG3A 2W48A 5CB4A 1NBAA 3IQIX 4DL9A 4J6FA 3NM6B 3G7NA 4YMLA 3K9GA 4PN7A 4HLCA 5JCJD 3SEAA 2MSLA 8ADHA 4IYJA 3FTPA 2C3OA 2PL5A 4W1RA 1JIUA 2BHLA 3DL7A 2FR0A 3JQ8B 3PUZA 4WW0A 4XX1A 1P1CA 3AERA 3THOA 1CR1A 3RVDA 3VOBA 2XVXA 2X2PA 1RRGA 3RAGA 2FPSA 1DV2A 1N0WA 5JC1A 2DFLA 3OQPA 4QU0A 1VM6A 2FLVA 4AK9A 5E1DA 1ZGGA 3CCCA 5EP3A 1EK5A 3ZWBA 1Z6TA 1ZSVA 1BOFA 3IIJA 4LWZA 4BMDA 4C2BA 4MROA 5FADA 1TEZA 4H0CA 3VV3A 4FWTA 1UBNA 5TGDA 4D3XA 1OFGA 2NG1A 2BDTA 4JC4A 1TAUA 1MA0A 2OCPA 4NTZA 2BUBA 1T5BA 3KFXA 4MPRA 4DKXA 5I9BA 2YWXA 3C7TA 4U2FA 3RYHB 4U7FA 3I6ZA 2O1EA 4MEJA 4LBWA 5JEDA 3BDAA 5KYYB 4H18A 3ZKWB