1W2GA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with deoxythymidine (dt) (2.1 a resolution)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
208
structure length
196
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERRDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of Mycobacterium Tuberculosis Thymidylate Kinase in Complex with 3'-Azidodeoxythymidine Monophosphate Suggests a Mechanism for Competitive Inhibition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE TMK
total genus 76
structure length 196
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2gA00
1W0JA 1U0HC 2GESA 2F55A 2BV3A 4HEJA 2HXYA 3AVQA 4DCTA 2WWWA 4B3BA 5DN6D 5GJCA 1Z07A 3AV0B 4KV9A 2FPLA 4EQ6B 2IYWA 1X1SA 1E2MA 2RH5A 5B30A 1YZLA 1EFRA 2CLCX 2YC4C 1A7JA 5LDDC 1T3HA 1PUJA 4B35A 3RSOA 3SI7A 4FMDB 3WP0A 5JFGA 1YKSA 1EGAA 2FG5A 3W5JA 3PEYA 3PUYA 1D2NA 1JXMA 2RCNA 2C77A 4GOKA 3ONWA 3PR1A 5FR1A 1CR4A 2QSZA 3ASZA 4CEHB 2J0UA 4GP7A 2JATA 1OH6A 4I1UA 4XTCS 1T3LA 5E7JA 2JA1A 2W6IA 2ZR7A 3H4MA 4TL9A 1G3MA 1I4LD 1KI2A 3K0CC 4W5JA 1ZU5A 1ZC4A 3TBKA 4Q4AB 2C98A 2OCAA 4NPHA 3LBHA 2KE5A 4A2QA 1WBDA 1GKIA 4IOMA 1E2IA 1XCGB 2OBLA 2IBMA 3LAWA 1JQJC 4TYYA 1P4SA 1TF2A 1W1WA 3LFUA 3MWJA 2PCJA 2REOA 5FI0B 3HYTA 3N5CA 3JVUA 3NHAA 4CRWB 2AL7A 2H7VA 4WXPA 3GMTA 4DSNA 2R62A 5TB5A 3QKSA 2A5FA 4Q4LA 2WWXA 4M2LA 2WBLC 2GDJA 1Y3AA 1RRPA 1UFQA 3SBDA 2XOKD 3DHWC 1JJ7A 3WBJA 5KSZA 2C95A 3QXHA 1U8AA 1G18A 1NIJA 4NU0A 3AGQA 5J47A 3KQKA 2CK3A 2ZRNA 3PXGA 2C9CA 2EYUA 1GILA 3D7MA 1DG1G 2ZIAA 2H16A 3CPHA 2BKEA 2JIZA 1XTRA 1GZSA 1IOZA 3W3AA 3SFVA 1GL7A 3RS7A 1YJ5A 1FQJA 3S1AB 5CM8B 5TV2A 1T0HB 3O8DA 4WZAE 3UWKA 1Q12A 2ZRPA 1COWD 2ZJ8A 1BYUA 2X2FA 4GL2A 3AVTA 2D62A 1KAOA 1P2SA 1GDDA 3QF4B 3N2IA 2YYZA 3TR0A 1OH8A 3QNUA 3CKLA 4FMDF 3WHKA 2JLZA 1IN6A 2O52A 4MYUA 1TEVA 5JMTA 2P5SA 2F43B 1IAQA 1O87A 3KQHA 1JB1A 221PA 3WYFA 4Q7JB 2B92A 4PHGA 2IUUA 4KBFA 1L7VC 4CEHA 2O8CB 3WRYC 2GHIA 2GZAA 1KOFA 4RD3A 4XD7D 3U3OA 1KY3A 4MDFA 4KJZA 3UKDA 1Z0KA 1NY6A 4GT1A 3KJEA 3IO5A 4BLOA 1G19A 1G7SA 4NHOA 4URUR 5SZKB 2IYQA 1ZNZA 4NYJQ 1AA9A 1SKYB 2RHDA 4DWJA 3A1TA 2CHQA 3EX7C 2QE7D 3SR0A 3SEAA 3UIEA 3AVPA 2YOHA 3VR6A 1G9XA 4PPFA 4LJ7A 3AVXA 3BH7A 4OI1A 2DWQA 3MRSA 2BHRA 3M1IA 3ZZ0A 2XZOA 4RZ2A 3WYGA 3H84A 3QENA 3ADCA 4D25A 1YQTA 2G88A 2ZYWX 1T5LA 2P6UA 1XMSA 2WKRA 1R8SA 4WZ6A 3GJ0A 1RRFA 4EFLA 1CIPA 5FBLB 4MKGA 2X8AA 3T15A 3CIOA 5G41A 1T9HA 4MKHA 2WJJA 4JLAA 3B1YA 2QT0A 1IN5A 2B8TA 3NDPA 2OLKA 5B2ZA 3PFIA 4NCIA 3K0EA 3AF4A 3BERA 2GF9A 2ZR0A 1EWRA 2XXAB 1R7RA 4Q02A 4M22A 3AUYA 1MH1A 4RD0A 2RGBA 4Q4HA 1XEXB 4MUAA 3QF7A 2IXFA 2EW1A 4DIEA 5FTLA 3GLGB 2OAQ1 4Q7MB 1SXJD 2FPKA 2X1VA 1DAHA 1NP6A 4ASUD 4B3DA 2O8DA 1VG0B 3S1AA 2VTKA 2IW3A 5B57C 3ETLA 3BAFA 4TL8A 5HCNA 3EZFA 1DAIA 4AKGA 3A4LA 4UNSA 5TARA 4WIAA 3I92A 1ZIPA 4UNPA 4V0LA 3I3SR 1RYHA 1W0JD 3TIFA 3CRQA 2PZEA 4I99A 5JRZA 2EU8A 4G01B 1XPOA 4HUQA 5DN6A 5HE8A 1G1MA 1LY1A 3Q3JB 3CRMA 4NONA 2HEIA 2F1JA 1VCMA 2QPAA 4V0OA 1W36B 1MO4A 4XJXA 1WP9A 2FZ4A 3OIUA 4LHWA 3KKQA 2J87A 3VNVA 1G8GA 1JAHA 4AYWA 4JJZA 2B7CA 4XVRA 1TEXA 2P6RA 2PLFA 3HR7A 2OSBA 4HLCA 4F4IA 5JWOA 1OYYA 1I4DD 1P60A 1YHNA 2MSDB 4OHVA 4OYHA 1ZM9A 1IJEA 2GZHA 4MRNA 4B47A 1NLYA 2X77A 1GNQA 5BN3A 4Y0VA 4Q4AA 1CRQA 5HZHA 5AJVB 1W4BA 2ANCA 2ZREA 2WIAA 5FOWA 2W0MA 4HB4A 4GOXA 4JJKA 3E70C 3JZAA 3ZZTA 2X19A 5EE3A 2QSYA 1U9IC 1BO6A 2XITA 3GJ3A 3T61A 4YMVA 3ZD6A 4FCVA 4B73A 2QP9X 1G291 4JBXA 5AJWA 5FBVB 5FPSA 4GSYA 3K53A 4PSVA 2LKCA 1G3QA 1Q1EA 4Q66C 4ERNA 5K8UA 4RCZA 3V9PA 4KITB 2J45A 2W0SA 1MR3F 1UM8A 2QG6A 1CRPA 2ZS9A 4PPGA 1Q1QA 5CK5A 2NMVA 4C0AC 5JI3E 1CKEA 4Q4JA 3OIWA 1SXJB 1LS1A 2XOKA 2ZJ5A 3CUEF 3NEYA 1BS1A 5L3SA 3A36A 4Z8XA 1R5NA 2FZLA 2IYSA 1GKUB 1KKLA 3QXJA 2GCOB 1E2LA 2CK3D 2F3TA 3DKVA 1XTSA 2ZS7A 2RGXA 4TL6A 1X6VA 1SXJE 2VSXA 3OHMA 3NVAA 1AJEA 3OAAD 4AYTA 3LQRA 3SYKA 4A8JB 1P9NA 1RKBA 5C46F 1FZQA 3R20A 4TTPA 1G3RA 1COWA 5SZHB 1P73A 4UXHA 2CL0X 4BECA 1YZGA 1A2BA 2J5XA 4M4SA 1W7AA 2ZJYA 5CDFA 2Q0HA 3KUDA 3MMPA 3AM1A 3WHLA 4OI0A 3OEEA 1ELOA 3OIYA 2ZRCA 2CE2X 2C9YA 3FWYA 1WA5A 1W4CA 1AS2A 1J70A 4HLDA 3TVTA 4L16A 3L82B 3NH6A 3CR8A 2YJTD 1W46A 2Y8EA 3PEUA 4PC7A 3TQFA 1MRNA 4A6PA 1CJMA 2GVDC 1RIFA 3K0SA 2RHMA 3B5JA 4XD7A 1G5RA 4B74A 1X8LA 3MLEA 1IBRA 3O47A 4IHQA 4LZZA 1TTTA 4JKIA 1HA3A 2FPMA 1CR1A 1YR7A 3B2EA 3TGPA 1E32A 3GD7A 4LHYA 3W8NA 2G1KA 4A2WA 4Q21A 4D82A 1S3SA 3HJNA 3HYRA 4H1VA 3CB4A 5TMPA 3IO3A 3SN6A 3TRFA 1EX6A 3Q7QA 2WVJA 3EPJA 4RKEA 1E3MA 2AK2A 2CNWD 2C96A 2GCNA 3I4LA 4FIDA 4B43A 4POAA 2HF8A 1EWQA 3DVLA 4C30A 4ZI3A 3IIJA 3K0FA 3ZDQA 3KXKA 4FCWA 2JLWA 4H1UA 1GG2A 4PQYA 1G8FA 4HAXA 3WXMA 3NC1C 4Q1DA 2G3YA 4DLYA 4FMBB 1N0WA 1SXJC 3DZDA 2AXPA 2G9NA 3NBZC 1ETUA 3U3MA 4OHXA 3U60B 2XB4A 2FFHA 2QTHA 5EZ5A 4BLPA 3I62A 2H57A 1RZ3A 2C9OA 1Z47A 2ODWA 1PLKA 5F98A 1T8TA 1DELA 1IXRC 1IY1A 3SJCA 2NIPA 3L43A 3HDTA 1OW3B 4TWZA 4HATA 4DLSA 4BPBA 4RD6A 4NH0A 4IDHA 1E6CA 2W58A 1FNMA 4P32A 3C5HA 2BJVA 4ACBA 1WF3A 3THYB 2CHGA 4CVNA 4EAQA 1ZM7A 4M9SA 2IXGA 4HI0E 3E5HA 1IONA 2VP2A 4WBSA 1KO7A 3AVOA 3KFVA 3BOSA 1W36D 1OH7A 4QBFA 5EXPA 3U4QB 4TMZA 2J1LA 1WBBA 4C9BA 1YRAA 2A78A 5JCPA 1Z83A 4JL5A 5BQ5A 2UVQA 1YR9A 2WHXA 4MGKR 1FTSA 3GJ6A 2JLQA 2FN4A 5JJIA 5JRJA 1HH4A 2CXXA 1XD2B 1M1YE 4M8NE 3SDZA 3SZRA 4HUQB 1NVWQ 3K70B 1B23P 4I1OA 4D0GA 1XDBA 1RC8A 2PEYA 4LOAA 4B34A 1G20E 1TNDA 4BZXA 1BIFA 1KMHA 4TN1A 1OXXK 3F0TA 1UAAA 2FSHA 2IS2A 1XTQA 3MWKA 4Q48A 2QGZA 3WMGA 4KFRA 3SC3A 4AKHA 1Z2AA 1GNRA 1NVXQ 1HE8B 2GWHA 4TLDA 3FHCB 1W5SA 2G1JA 1CTQA 2VH5R 3DM9B 3FE2A 4P3YA 1ZUIA 4Q9IA 2O8EB 1XX6A 4A0FA 1XD8A 2VLIA 2G0NA 4PAMA 5JEDA 3ZJYA 5J40A 4DT1A 4K46A 4WAUA 2HYIC 4HAZA 4URXR 3QI2A 4GMXA 1DO2A 4KAXA 1F2UA 2R6GA 4TLEA 4C0QC 5JJLA 1SVOA 5EUQB 3HPQA 3KTAB 4G3XA 2GTPA 5C2JB 3B1VA 3BS4A 1Z22A 4LV5B 5C4GB 1TF5A 5HPYB 2ORWA 3I8SA 5CDFE 3T12A 2ZI9A 1E9FA 3RC8A 4FXPA 4AI6A 3CNNA 2G83A 3TMKA 4PHHA 4MYCA 2DFTA 2QY9A 3CNOA 4YMUA 3OAAA 1R0YA 3QKRA 1HURA 2AFIE 4A6XA 5H1YA 2CCKA 2ZUDA 1S3GA 3I73A 4V03A 2C5LA 3M6AA 3SHFA 4A0HA 3THYA 2ZI3A 1MRSA 3QEJA 1G4AE 2QA5A 2R65A 3DEFA 2I4IA 3W6OA 2GCOA 3SQWA 4B48A 5KYKA 4F38A 5L3VA 5DYIA 4W9MC 2FEOA 3VX4A 3OEED 3K0AA 3PV0A 4TMVA 3UK6A 3AF0A 4LJAA 4JVNA 1US8A 4Q00A 3EIQA 3L8YA 1U0JA 4QRHA 5CLQA 4EJSC 4M1WA 3EWSA 3X1WA 4C2TA 2JLVA 3H1TA 4P4UA 3QKUA 4PHTA 2VF7A 3BIFA 1OXUA 1KO4A 1G8HA 1HE1C 3DMDA 4JLDA 1KDPA 1N6PA 2ZRGA 3LRPA 3SBEA 2GNOA 5LPNA 1GOTA 1FQKA 3QIAA 3RLFA 4IVQA 1T3SA 2RGEA 4KI0A 1KI6B 2DWPA 2ZRJA 3T5GA 4MRSA 2NZJA 2ZRKA 3PQCA 4OK3A 3IQWA 2EFCB 1C4OA 2GCPA 4JSYA 1NSTA 1AK2A 3U6BA 2CNWA 2WSSA 4NCKA 2Z4RA 4EFNA 2WOOA 5EP2A 2YVUA 5AUNB 3W34A 4EPYA 1UADA 2SHKA 5FOSA 1N3BA 4A4DA 4KO8A 4MRRA 4C0LA 1Z8FA 1PUIA 4OQLA 2Z4SA 2FFBA 3BD9A 1KJYA 4LBYA 3TW4A 1MO5A 4PQFA 5K8IA 2ZE7A 3ZIAA 1SGWA 3TSWA 3GFPA 1XJ0A 1XJQA 3NBYC 4D80A 4DIDA 2YOGA 4N1AA 2OHFA 3AF1A 4M9XA 5DIFA 4L9WA 3K9LA 1P62B 5L3QB 3DL0A 1JEDA 4ZCLA 1FPMA 1NNEA 1G3UA 4DCVA 4Q47A 4GI7A 2PL3A 2ZVPX 2I1QA 4QNRA 3OF5A 2E87A 1KGDA 2ZYTX 3FPAA 1ZVQA 4B3XA 1K8RA 5BW8A 3TUZC 3VKHA 2VP6A 2JJ2D 2FNAA 1DARA 4QBIA 3FOZA 2BMFA 1KNXA 2R6CA 3VU9A 4DLZA 2FSFA 1JAIA 2D2FA 2IHBA 3U7EB 3HU2A 3FMIA 4ILEA 2DFKB 4N0EA 4KSBA 2ERYA 2NPIA 5LBIA 1NN5A 2ZVQX 5KSYA 1YR8A 2EFGA 1GAJA 4RD4A 1OV4A 2Z5FA 2A5YB 2J7PA 1QDEA 2GF0A 4M1SA 4QG7A 4C0KA 2Z83A 4URWR 1I4TD 1I2MA 3GLFB 4N3NA 2ZPTX 3W6PA 4KYUA 4YDHB 4TT3D 1E2KA 1AZTA 4BGDA 3EPKA 4XIGS 2CVFA 4W7SA 2FFQA 3QJYA 2GEVA 4MH0R 1CXZA 1OPXA 3MAAC 4B75A 4EIWA 2ZRDA 4QNMA 3TKLA 1KAGA 1FL9A 1KO1A 1NMZA 3GJ4A 1NY5A 3WMEA 4E09A 3A4NA 3RS4A 4BEJA 1XZQA 4YC7A 1NIPA 2V8OA 2ZROA 4LY6A 3B1XA 2A9KA 4PQRA 1OXTA 1VPLA 3QXCA 4C4PA 4DXAA 4P4SA 1E79D 3B1WA 2ZRMA 1BOFA 4F91B 2ZI5A 4TTQA 1KI1A 3K09C 3KB2A 4JZKA 5KDDA 4QM6A 1P9RA 3FFBA 4OQXA 1WB9A 2A2ZA 5CK4A 2UKDA 1RRCA 1ANKA 2EFHB 4Z1MD 3RS3A 2PZGA 3P4XA 1CR0A 3FKSA 1JPJA 5F2EA 2WMNB 1NG1A 4AKIA 3ZVLA 4MKIA 1DAMA 1DAFA 3U2QA 4B44A 2FOLA 3BB3A 2AKYA 1NN0A 2BKUA 5GJWC 1LF0A 3FFAA 5JS8A 3U5ZB 1P2UA 3CBQA 3I61A 2FDCA 3ZLJA 2KBFA 5HZKA 2CDNA 2PX0A 1RJ9A 3LQQA 4MYHA 4FW9A 3QPWA 1T91A 2V9PA 2ZSFA 4P0TA 4NKRA 4OK6A 3THWA 3SE0A 2QN6A 3RDPA 1NL3A 1XMJA 2XB2A 1JI0A 1KMHB 2PT5A 2J41A 4X8MA 1G5TA 2GK6A 1JJVA 5H8WA 2R6FA 2OV2A 1NF3A 2IXEA 5K8TA 4LJ8A 4DEYA 3SJZA 1OB5A 1R5BA 4PO8A 5BN4A 2A5GA 1E1RD 3GFTA 3EC2A 2XGJA 3LV8A 3LLUA 1QVAA 3WRXC 3KDSE 3EZ9A 2WPDD 1Z0AA 4NMMA 3VAAA 4YDSA 2WM9B 3QY0A 2ZAMA 4DKXA 3D8BA 2FGJA 2W2VA 1HYQA 3C7KA 4XSHA 2JLUA 5AUPB 1VCNA 4TTRA 1XP8A 3J81k 1JR6A 3K0AB 5FL3A 4Q1BA 2J3EA 2ODEA 1IY0A 1QZXA 3BBPA 2VA8A 2KJQA 3JVVA 1FNNA 1UDWA 3BC1A 1FMJA 1J2JA 1KI4A 3CWZA 4QJ5A 4IDQA 3KQLA 3X2SA 5KU1A 5AJXA 4TSFA 5J4HA 2WSSD 2R6DA 4R2HA 1AN0A 1IY2A 1S9HA 1QF9A 5FOVA 1G8YA 2AXNA 3D3QA 3K09A 3EC1A 2QMHA 3LBIA 1CULC 2NO1A 5E95A 1GFIA 2XNSA 3CH5A 1E94E 2WV9A 3T1TA 3CF2A 2QM8A 4PX9A 3ZIAD 2YWGA 2O8FA 1FP7A 2HUPA 4TQUS 1E4VA 1SVMA 4PZLA 4L15A 1X86B 1CJUC 1SKYE 2F43A 3MG9A 1J8MF 3QG5A 3BE4A 4E03A 4YLGA 5FI1B 5JS7A 4ESVA 2AFHE 3I8XA 4FCTA 2OCPA 2XZPA 2CEAA 2HCBA 1R0ZA 1UJ2A 2OE2A 3B13B 1NRJB 4RFSB 3D6TB 4LUCA 4PTLA 1G7TA 4WVFA 1II8B 2ZRLA 4Q9LA 3AF3A 2WOJA 2ZETA 3FMOB 4LDJA 4ZV4A 4NTZA 2QRZA 3TE6A 4AWXA 2QMOA 2JJ2A 1RVDA 1EG7A 3RWOA 1CF4A 4A1FA 1UBEA 4A0GA 1AS0A 4DVGA 2G6BA 2QBYB 3A58B 3QEOA 4KLNA 4AK9A 2HT1A 1Z6AA 3RS5A 2GEDA 1G16A 1NG9A 1E2PA 3KXIA 3SYLA 4IOJA 2CE7A 4IEIA 5JEEA 3UG6A 1Z0DA 5C4MA 4B3FX 2J7PD 1RPZA 2GETA 2ZTSA 1E0AA 3QPUA 3KKOA 3U7FB 1MOZA 4UJ5A 2LWIA 4A36A 4GZLA 5JHGB 2EFEB 3REFA 3H86A 2OFOA 3GLIA 2XEXA 3R8FA 4IDOA 4TT3A 1F60A 1U0LA 2FA9A 4F7WA 2VHJA 4Q7KA 3GFOA 4AIIA 4LJ5A 1P2TA 2YC2C 2DFLA 4DLXA 1OFUX 1CS4C 3LY5A 4O2RA 2GXAA 2GBLA 4G5RA 3QVVA 1NI3A 1S8FA 5ELXA 3ZZUA 2HJVA 4Q4JB 2PH1A 4HDQB 3X1XA 2GJAA 2P3SA 3QG1A 3GLIE 2AK3A 3NBXX 2NO9A 2Q9AA 5FPYA 4F4JA 1E79A 5CB8A 2GILA 2BMEA 3BH6A 3NXSA 4NP6A 1KJWA 3I5XA 3LD9A 2O8BA 1C1YA 3HU3A 4ON9A 3FHOA 5G3YA 3ZVRA 4BQSA 4Z1MA 3GLFE 1QHIA 3LVRE 1JXOA 2YINC 4OI2A 4M21A 1TU3A 2GAOA 3FKSD 5JSZA 2ZSEA 2HYDA 2CLDX 4Q19A 2ZE6A 4D4MA 1XTKA 5TDHA 3A8TA 1G8PA 2ZJBA 3RAPR 3LO5A 3MUFA 1DADA 4JMPA 1E0JA 4PZZA 2WJVA 2GXUA 2O0JA 3GLFA 4HLUA 3VFDA 3B7GA 4A92A 4IKEA 4JLKA 4MITA 4C0BA 3QOFA 5FFMA 2QI9C 5E7MA 2RGCA 4EJSA 2EYQA 2PT7A 2QM7A 3AKEA 3KJIA 5JECA 1AGRA 621PA 2A30A 4ARZA 5LD2B 5SZJA 2HF9A 4ZKDA 3B6EA 2OILA 4D4JA 1E96A 1UBGA 1GRNA 3FKQA 4LHZA 2FWRA 4EQ6A 2BBTA 4JL8A 3IHLA 3EG5A 3TAUA 1P72A 1W0KA 2VRWA 2QL6A 3IGFA 4DSTA 3AP1A 4PSAA 4CT5A 2YWFA 4S2EA 3R9XA 4D6PA 1E1QD 2IYRA 1E1RA 2QNRA 3FVQA 4B6EA 1A2KC 2IEZA 1F2TA 3EZ2A 5KSOA 3CW2A 4HZIA 4GPTA 2WPDA 1XFAA 4DLTA 1AIPA 2J7KA 5L3RA 1KZGB 4BFZA 1RE0A 4UNRA 2GRJA 4Q1AA 1P3JA 1LVGA 4BLQA 1KSJA 3HPRA 5KTYA 1US8B 4JVSB 4NYIQ 5H68A 4DLRA 4DDUA 2CL7X 5DI9A 2DWOA 4NYJR 3WNDA 2GBLC 3MFYA 4URYR 5UKDA 1XWIA 4AYXA 4Y0AA 4TSFD 4LBVA 2XSZD 3Q9LA 4CEJB 3NIBA 3O8CA 5BWMA 2VIIA 1Z0JA 4X8OA 3NEJA 1GP2A 4NCJA 5G3ZA 1YR6A 3MWYW 5IDVA 4XWOA 3X1DA 4IJMA 1Z06A 2HT6A 1W2HA 5FTJA 2IYXA 3RANA 2ZITA 1M7GA 3MSXA 1P61B 3EPLA 5E3HA 2AN9A 2EVWX 5GJBA 1N25A 3ECCA 5FUWA 1PV4A 3AVVA 1E2NA 4HYYA 1XMIA 3KKMA 2JDID 1L8QA 8OHMA 3CRW1 4JYCA 2C2HA 4JLMA 4HB0A 4PC2A 4V0NA 3VKGA 1E0SA 1SVWA 4ITRC 4QGGA 1U90A 4DB2A 1W47A 2VYFA 4KFTA 2N46A 2EFDB 1BKDR 1JALA 1N6HA 4B71A 3U44A 4D0NA 5CB6A 1XPUA 4AKEA 1QVRA 1KI3A 3GEEA 4OK5A 3K70D 2OAP1 1OKKA 5BXQC 2HXSA 2VP0A 3PEVA 1R8QA 5JJKA 5CLLA 2MSCB 2MMCA 4JLOA 5FR2A 1DE0A 2WAYA 1PJRA 1ZRHA 2NZ8A 1K5GA 1VTKA 4DHEA 1OF1A 1R6BX 2WJHA 4DCSA 3JZMA 4ARZB 4J0QA 3OE7D 1F2UB 2XTZA 3CPEA 1QHHA 1HY3A 4RFVA 2P2LA 3LW8A 3TUIC 1E2DA 2GJ9A 1QHHB 1YVDA 4JYBA 3HR8A 5JWRA 2FEMA 4CF7A 2PCLA 3IDQA 4JS0A 5FUVA 1N6NA 1OXSC 1KK0A 1S0UA 4Q03A 1W49A 3LNCA 1WMSA 4KXFB 3Q8XB 4V0MA 4ZCMA 3Q7PA 2OT3B 3A1SA 4II7A 4RZ3A 4KODA 1D8TA 2MMGA 5G53C 5H70A 1Z6XA 1SHKA 3VQTA 1E9AA 2VEDA 1FX0B 4URZR 2F9LA 4P31A 4TMKA 3KZ1E 3QF4A 3BB1A 1Z29A 2IA5A 3ND9A 4M1KA 1EK0A 1DTSA 2PJRA 3LA6A 4Q7LA 1LFDB 5EXXA 3I1FA 1JR3A 2OBNA 1XPRA 2ZUBA 1G7CA 3X1YA 2WTUA 3TSZA 3WMFA 3VR5A 1P75A 4BLSA 4YONB 4MGZR 2QAGB 4LYAA 1G4UR 4DUGD 1LW7A 1G5PA 3KUCA 4AURA 1LTQA 1U8YA 4DLVA 4C7OA 1XZPA 5DH9A 3BRWD 2VSOA 4RKFA 4CZ2A 5JI2E 2QGNA 4LYJA 5HTKA 2JEOA 1KI8A 3B9QA 2NOAA 2VHCA 4LC0A 3CZPA 3ZVNA 2X2EA 4QGHA 1AM4D 1WCV1 3CH4B 5EXTA 3UXMA 5CIWA 4DDTA 3NHBA 5LB4A 3LH5A 3T35A 4NYMQ 1N6LA 2J46A 3F8TA 2RGDA 1LS6A 4Q9KA 3SNHA 1HQYE 3H0KA 2KWIA 1OT3A 2J0UB 4ZCIA 3R7WB 2H17A 3AUXA 3FYHA 3RHFA 3TK1A 1W0KD 4XWAA 4A82A 4DLWA 3E2IA 4KVAA 2ZI6A 1E1QA 2D06A 3VR3A 1KIMA 1IXZA 2QPOA 3PENA 4YQFA 1UDXA 2QQEA 1Z6GA 1U81A 3REGA 1Y63A 2Q9BA 1ZNXA 5D3MB 2BMJA 4BFUA 4DC9A 1A1VA 1IXSB 2OXRA 3GJ8A 5F3WB 2AR7A 4TQ9A 4FMCB 3SHWA 2CVHA 2F6RA 1T6NA 2QP3A 2RGGA 2C99A 3QQ5A 2BEJA 2C03A 1VG9B 5DHFA 2IT1A 1KKMA 2ATXA 3DPUA 1G17A 5CYOA 2WJIA 1OHHD 2GJKA 1UEIA 3C41J 4HSEA 2XSZA 4JBWA 1JECA 1JQLB 5J4LA 4TMXA 1MO3A 1DOAA 1EFHA 1TUEA 3F5FA 5SZIA 1FX0A 5BYKA 3C14C 4HAYA 1VIYA 2LCFA 2ZS8A 2ZE8A 4CIDA 3A37A 3NH9A 4I81A 3T5DA 1U99A 1XCMA 1FOEB 4US0R 2ERXA 2RGNC 4DJTA 3TQCA 4IXNA 1IN4A 1W2GA 2QTVB 3BWDD 4KU4A 2VHQA 2ANBA 3MJRA 4LYFA 3AQ4A 3K0CA 2PX3A 4QJ4A 1GSIA 1Z5ZA 2JDIA 4D4LA 3BFXA 1S96A 3EZ7A 4HB2A 3QXXA 1VYVA 2IUTA 4TQAA 4HDOB 1NMXA 2ZU0C 2VO1A 4A0RA 1J90A 2N1BA 2ZSBA 4LJ4A 3AH8A 1Q20A 4B3GA 2B6HA 1GUAA 2FH5B 3T06B 3RRMA 4KHZA 4LHXA 3W6NA 4BZPA 3G5UA 2NQ2C 3EWAA 2HCJB 2R2AA 4LBZA 2EQBA 3LXRA 1OKKD 2JLXA 5FBQB 4NYIR 2BEKA 2WSMA 4GOJA 3C15C 3UATA 4OQFA 3L2OB 3LX5A 1ZCBA 5KPDA 1KDRA 5FL7A 1MV5A 4MA4A 1E2FA 3BFVA 5DE3A 2N42A 2BVNA 3OE7A 2YWHA 4LV8B 3PEWA 1Q3TA 3CX6A 1F6BA 3NC0C 1Z28A 5EQTA 2P65A 1D5CA 2ONJA 5FUYA 3WYAA 1I2DA 1ZBDA 3FHTA 4IFBA 3B78A 4EPVA 2RB4A 4PAQA 5C1BA 4AG6A 2PZFA 4MQBA 1ZW6A 1M7BA 1W48A 2BWJA 2H8KA 1N5JA 1ZIOA 3U3RA 4QHTA 2ZM5A 1G64A 2IWRA 1JEEA 2ZANA 1M34E 2ASEA 1KO8A 5J4KA 1JR3E 4Z8YA 5FUXA 1F3OA 1TADA 2I3BA 1Z08A 1VCOA 4LJ6A 4B33A 2CLSA 1DO0A 4US1R 1YZNA 2GEUA 1TF7A 2W00A 2XXAA 4HZUA 1MKYA 3B8HA 1XF9A 1N6RA 1ZM4A 4PR0A 3X1ZA 3THXB 1TL7C 2WWIA 1DAEA 4OHWA 3EA0A 4CEIB 3EAQA 2CJWA 5DYGA 2WJGA 1X8KA 3L0PA 3PVSA 4OQNA 3R9IA 4B3CA 5HR5A 1GL6A 1NJFA 3ASYA 1JR3D 4D4KA 3PITA 1DAKA 3MGCA 2J59A 3EARA 3T1VA 1TMKA 2E1RA 4MRPA 2FSIA 4DUGA 5FTNA 2WWYA 2O8FB 1KNQA 4OJKA 4UNNA 5CIQA 3U3KA 2DFNA 4QGFA 3GP8A 1N2CE 1KK1A 4IOKA 5FBWB 2WKQA 4NBSA 4ZO4A 1IM2A 2J9RA 2B21A 4Q9JA 1LNZA 4F4CA 1UEJA 5CJ2A 4ZPXA 1P6XA 1TUIA 3QBTA 4PHFA 2QMUA 4WZBE 2OXCA 2JLYA 3ND8A 1CLUA 3AP2A 1YZTA 4V0KA 1P2VA 2ZI4A 3IPXA 4JVLA 4CYMA 2WMOB 1G41A 1ZUHA 4IW3B 4C2UA 1U94A 2BDTA 4HB3A 3QUSA 5G40A 2O0KA 4GDFA 2E9SA 1PZNA 1JPNA 4R9UC 4LJYA 2D74A 5F9FA 4QOSA 1OXVA 1A5TA 3EW9A 3U4QA 1S4QA 1XXHA 3CX7A 4JBYA 4IDNA 2DR3A 1Z2CA 2CCGA 1D2MA 4BLTA 4HAWA 4LBWA 5FOTA 1E9CA 4M9QA 1TX4B 1QHXA 5FPHA 2CMKA 4FD2A 3GQBA 2XTNA 4HLUC 5DSZA 1OFIA 5AJYA 4L9SA 4MUBA 2F3RA 1E99A 2GXQA 4ZDJA 4BE7B 1CBUA 1KDTA 3ZH9B 3KX2A 1GL9B 1OIXA 4LX0A 4JLVA 3KFXA 4JT4A 4R98A 5DISB 4EDHA 3AVWA 4K81B 2CL6X 1XMVA 4HAVA 2V1UA 1OHHA 1EESA 2QBYA 2G0TA 4YXWA 2UZ3A 3TAHA 1OB2A 1KMQA 2ZRAA 4DB4A 2ONKA 4OQMA 3VR1A 2J0SA 3EPHA 5DHAA 5KSPA 3OZXA 3RYTC 5FOUA 1KTVA 2VQSA 4AD8A 3KQNA 1KI7A 1KHTA 3QVUA 4A8JC 1J99A 1E9BA 2ZYVX 3A1WA 2QPTA 3VR2A 4ACAA 4C3ZA 4DCUA 4C7OB 3NG1A 1S9DA 3F3YA 4BUJA 5GADl 3CONA 3ADBA 2BBOA 1FTNA 4QJ3A 5IF9A 1KK3A 5KNBA 1G7RA 4PZYA 3QXSA 4MGYR 1VCIA 3UPUA 2IS4A 2WAXA 2ZRFA 2IYZA 5D3MA 4I1SA 1GM5A 4BFYA 2W83A 3NTUA 1N6OA 1R4AA 1N0UA 3AEZA 2FGKA 3CPJB 4GNKA 2WWGA 3FGNA 3GLIB 4M53A 1R0XA 4O0MA 1L2TA 4HAUA 1ONBA 1SVIA 1UKZA 2P6NA 3TW8B 2R8RA 1T5IA 1EX7A 3GLGA 5HCIA 5FL7D 1AKYA 1RW4A 4TYNA 1Q21A 1W36C 2AKAB 1FW6A 2I1VB 3EA5A 4X8LA 1CU1A 2JGNA 1YU9A 4TYWA 5A5GA 3K9NA 3T1QA 2AHOA 5FPTA 1KDOA 2FV8A 3PUXA 2JASA 3GPLA 1EFUA 4LPKA 1TQ4A 4MGIR 1NN1A 1KSGA 3QE0A 1AKEA 2KBEA 4WXRA 1RJ9B 4D0LB 2OCBA 2BOVA 4RZUA 2BM0A 5EE0A 2ODBA 1XEXA 4M0LA 4ZDKA 3IILA 5FPKA 2D3WA 4URVR 3L0SA 5AUOB 2IYVA 5CYPA 3CX8A 1ZUNB 3SU8A 3GLHB 1HEIA 3ZS9A 1LF5A 2QZ4A 1VDZA 1NVVR 3PUZA 5AR1A 4ESHA 2QMEA 2VP5A 1N5IA 1PVOA 2C78A 1AZSC 1ZP6A 3CM0A 4RCYA 1VHLA 5EZ6B 3AB3A 1YRBA 2A3RA 2BCJQ 3W5IA 2WIBA 4V02A 2V6JA 3Q72A 5DO9A 2VF8A 1II9A 4RFSA 3T1OA 5CITA 5AK0A 2B8WA 1VMAA 5AJZA 4ZKEA 1UBFA 2IYTA 4RD1A 2JLRA 1M74A 4XTRA 1XBTA 1XNJA 4IVRA 1YZQA 1F48A 4D2IA 4M9ZA 1BMFD 2ZE5A 1M7HA 1E0KA 3RABA 5A0FA 2RAPA 3BFKA 2ATVA 2ZU6A 2QQ0A 4A8JA 4U7DA 3O8RA 4FINA 3TH5A 1XB2A 2XJ9A 4OJQA 1WE2A 4LJ9A 1N6IA 1XXHE 4KYIB 3BJIC 1O3YA 2VPPA 4XVUA 3VKWA 1AS3A 4JLPA 4WOPA 1H65A 3KKNA 2V1XA 1U9IA 5FTMA 121PA 3C16C 1AGPA 1TQ2A 4FWTA 2DCUA 4X8HA 1ZNWA 1XXHB 2RKOA 3CRVA 5FOXA 4C0HA 3K8YA 1EXMA 1KI6A 3P26A 4ZDWA 2BIFA 2OZEA 3B1ZA 3I72A 4XSGA 3DO6A 2IUSA 2LKDA 2P0EA 1KSHA 3ICQB 3QBVA 1VG1A 2QU8A 3DMNA 1MT0A 4RJLA 2GVZC 3K9HA 2ZJOA 3AKCA 5D3QA 3IIKA 1XJCA 3BORA 1L4YA 1GITA 2IF0A 5GVRA 1GVNB 3PUVA 1N0VC 1ZU4A 2QROA 3NKVA 2Q3HA 2ZR9A 2A5DA 5EP3A 3AP3A 1OIVA 4JT2A 2JJ1D 1SQ5A 4JLNA 4V0ME 3C4JA 1U98A 5EE9A 2IEYA 4E22A 4YXWD 3TSOA 2BBWA 1XCPA 2OG2A 2BJWA 1G3IA 3IBGA 4LWZA 3SS8A 1Z3IX 2J0QA 5KDOA 3A1VA 5GJVC 2ZSAA 3W3ZB 3TNFA 3ZYCA 4AG5A 1D9XA 2K5UA 3CZQA 4JIMA 4TLCA 4C0JA 2OFXA 2ZSDA 1Q1ZA 2DY1A 4BRUA 4BEBA 1QRAA 2O8EA 3AVUA 1XRJA 1K5DA 4JL6A 3QSYA 1R0WA 1VYTA 4MDEA 1E4YA 2FJUA 4KLZA 1VKJA 2FMXA 5IK2D 3IIMA 3R7WA 4CDGA 3ZD7A 2HLDA 2H5EA 4XH9B 3R9WA 4PC3A 1TQ6A 5BYJA 4EJSB 1NBMD 2BM1A 4KFUA 3KJHA 3IHWA 3ADKA 1KZ7B 3KKPA 4QXAA 1HV8A 1SKQA 2QENA 4OHYA 5FBRB 3U44B 3Q85A 3PUWA 3QPVA 1ZAKA 5TY0A 1KY2A 3VR4A 1Q44A 4EUNA 3VHLB 2CBZA 2O8CA 2D2EA 1CJVC 3M4YA 3U6KA 4Q1FA 4P4TA 2HDNB 2VHUA 1AQYA 3OEHD 2VP9A 2GJ8A 4IFEA 4Q5IA 2YKGA 3Q5EA 2FF7A 3TJZA 2RGAA 4GBMA 5FTKA 4BASA 2D7DA 5TVKA 2YWEA 2ZAOA 2ZRHA 5A4JA 4XWKA 3ZVMA 2QUZA 2VSFA 2IWHA 3VNUA 1GTVA 4GMDA 4IDPA 1IQPA 1E69A 3L8ZA 1E2HA 3SYNA 4DCNA 1J7KA 4NE2A 4FN5A 4RVCA 4DSOA 2F1HA 1Q1BA 2V54A 1UKEA 1R2QA 1ZM3A 5AUQA 1QHNA 1JBKA 3VU9B 4DBLC 1CR2A 4M1MA 4EPWA 2CHVA 4KCGA 3RRNA 4QHYA 4QL3A 4DEXA 3R8CA 2DYKA 1TU4A 1NVUQ 1T8UA 2F9MA 3FMFA 2IX3A 2WWHA 4JVMA 1E98A 4BZQA 1NLZA 4KSCA 4G5OA 3VTKA 3L0IB 3ADDA 3MD0A 1UBCA 2B7BA 3GJXC 3HP1A 1OH5A 2PMDA 4M1YA 1M6NA 1CJKC 3M0EA 4TMTA 3V4FA 4DZZA 1QHYA 1HUQA 4MKFA 1B0UA 1P9WA 2DBYA 4R7ZA 1IHUA 2WICA 5K8LA 3P32A 1WRBA 3QKRB 1GWNA 3LVQE 2Z43A 4MRVA 2PJZA 2F7SA 4W5WA 2D4HA 5C18A 4YMTA 4KFSA 4FMCF 4TLAA 4LYHA 4RY2A 3DM5A 2GA8A 3K9GA 2NGRA 1VYUA 1T0JB 3LX8A 1BMFA 4BWYA 4O3MA 3EXAA 4GRAA 2RGNA 2EWWA 5EP4A 4B32A 1ESNA 3MWLA 3DKPA 1E2QA 4G0NA 1IJFA 1Z63A 4PPNA 5IHPA 2FE4A 1ODFA 1SVLA 1WDTA 1R10A 4LK2A 1DG3A 2UZIR 3U7HB 3QKTA 3EIHA 1N5KA 3BH0A 4RZXA 2BMDA 2ZXUA 5KNDA 3HU1A 3L0OA 1XTIA 2VL7A 2IS6A 5JCZA 3UMFA 2JCSA 2ZI7A 1F5NA 4DRZA 3WNCA 4PO9A 3RWMB 2IHYA 2XAUA 3E1SA 4P33A 3C8UA 1OIWA 3UANA 3UMRA 3GLGE 2WJYA 4OI4A 3AVYA 4OL0A 1MABB 3GCGA 3LBNA 4IRUB 4Q9HA 4D81A 4H9GA 4D26A 2JJ8A 4PC1A 3B82A 2H92A 4B6FA 3RS0A 2ODNA 1XEFA 2V7QD 4A15A 5BN5A 1FMLA 4R71A 4W5HA 2QRNA 1ZCAA 1D9ZA 4LSGA 1OSNA 2GZDA 2YHSA 2KB0A 1Q3HA 1ZYUA 3KQUA 1ESMA 2FX3A 3A4MA 1BH2A 3OFNA 3OIVA 4FWIB 4MYTA 3NWJA 2Q6TA 3OESA 2ORIA 4Q4HB 1SVKA 2FFAA 5EXSA 1ZMXA 1SHZA 2JJ1A 2R9VA 1S1CA 4JSTA 4GZMA 4IOLA 4TL7A 1QHSA 4NL4H 1IN7A 1CEEA 2QAGA 2NO0A 4O2LA 4CEIA 1CP2A 1II0A 4O25A 3KTAA 4UKDA 1UPTA 1DVRA 2IL1A 3RC3A 1VHTA 5EE5B 1NBME 1X8JA 2TMKA 1TPZA 5CM9C 1H8EA 4HZUB 3WP1B 4UNQA 2F1RA 2XTMA 4R2IA 4I4LA 2QAJA 5DGXA 2OBMA 1II8A 2HJGA 1RFLA 5KPJA 5KO2A 4OKSA 2R44A 2ZJAA 4L5BA 6Q21A 2VBCA 5IK2A 1V5WA 3N70A 2HLDD 4IXMA 3FB4A 3IEVA 2AWOA 1NBMA 1H8HD 1QHGA 1D6JA 4G1UC 4ZIRA 2ZQ5A 2VP4A 2Q3FA 1HT2E 4F92B 1JNYA 4IVPA 3B85A 1C9KA 4BFSA 3Q5DA 1W4AA 3ZQJA 3DOFA 1EFTA 1KJZA 4WW0A 4XOIA 1Q22A 4ABYA 2W6JD 4PPQA 4ZDIA 4K8OA 2GAAA 3BB4A 3D31A 1LB1B 4LPSA 2QORA 3OEHA 4U5XA 4ZIRB 3GEIA 3MJHA 2QAGC 3WY9A 3FDIA 4G5GA 1GIAA 4TLBA 4M1TA 4WA7A 1W4RA 2IYLD 5IRCD 2NPFA 2NO7A 1GKYA 4PAOA 2G77B 4Q1EA 1E9EA 3EZ6A 3ICEA 2V55B 5DLQC 4DT1B 4QKQA 3FMPB 4BFTA 2WWFA 2NG1A 3THOA 2XNDA 3K0FB 1ZC3A 1XD9A 2R6AA 4B76A 1DS6A 3NDBB 2Z0MA 2XX3A 4JLBA 4US2R 3TLXA 1DAGA 4UXJA 2GKSA 2ZEJA 1W44A 3G0HA 4P4SB 1M8PA 2ORVA 2A5JA 5B58C 3UMSA 4KVGA 1LV7A 5E4FA 3I5YA 1ZD9A 1UKVY 3TVDA 2D7CA 2IYYA 1IN8A 2RMKA 4Q01A 1HQCA 3RSLA 1NN3A 3THWB 5HE9A 1N5LA 4JKYA 1G6HA 4NZYA 4LC1A 4GFDA 5FH9A 1M2OB 1P5ZB 3N2EA 4KBGA 4UJ3A 3RVBA 2PEZA 5J5CA 1WQ1R 2OUKA 4LI0A 1Z0IA 2ZRIA 1XTJA 4TMWA 5DI3A 2H1LA 3VX3A 1VECA 5M04A 1OLOA 1QBKC 4Q18A 4EPRA 3GJ7A 4FI3C 4QHSA 3U7GA 2V3CC 3U3JA 5DI3B 2VHTA 3AGPA 5EP1A 2WZQA 3PCRB 2OO7A 1NJGA 1KSFX 5EE1A 4EFMA 4DDWA 4B2PA 2L0XA 4Z51A 3SJBA 5P21A 4CEJA 2IS1A 2DHRA 2OFWA 2PBRA 2YOFA 3VMFA 5L8VA 4G5SA 3UWOA 3P20A 4UXIA 4AY2A 4B2LA 5JLJA 5GVSA 3CRRA 2OESA 1G21E 4NYMR 4QC2A 5JZVA 4BFWA 3GLHA 1KO5A 3O8BA 4DLUA 2GK7A 2ECKA 5JHHB 1HT1E 4QGAA 4AC9A 3MCAA 3DZ8A 5HKKD 5KUTA 3K1JA 1A4RA 1K6MA 2V7QA 2J0VA 2HV8A 3WNBA 2OM2A 2Q9CA 3IBYA 1ZD8A 4LHVA 4DDVA 2O0HA 1YZKA 1GRRA 2REXB 4QFMA 1UF9A 1NLFA 1WXQA 821PA 4LGMA 3W90A 4CW7A 2BCGY 3VHXA 421PA 3T34A 1E9DA 3BGWA 4TZ0A 4Z54A 2NTYC 4NDZA 3OFND 2QTFA 3A6PC 4S35A 4U00A 1HTWA 1QG4A 3ZQ6A 2GJSA 4E07A 5F9HA 2Q3MA 1E2EA 3UG7A 1TAGA 1GNPA 1OYWA 2Q21A 2QT1A 3V00A 1EFRD 3SOPA 2NO6A 4QM7A 1MO6A 4E5UA 4PANA 4GP6A 3WBKA 1G6OA 2REBA 4L8GA 4QBGB 5TXGA 2W2TA 1L4UA 3KJGA 1NVVQ 4LV6A 2AD5A 2JLSA 1H8ED 3KXLA 3DDCA 4B2IA 3BK7A 3THXA 1SZPA 4F93B 3TR5A 1R5OA 5AWFC 1RRGA 4XVQA 4PSKA 1X3SA 2IYUA 4BRWA 3DOEA 2W6ID 1VIAA 1Z6TA 1YE8A 3PG5A 3ZS8A 5JSZB 2AWNA 1PLJA 3V4RA 2FU5C 1H8HA 1P7CA 2V6IA 3CNLA 5EUMA 3QKSB 2WKPA 5B64A 1E2JA 4LCBA 1J8YF 1DPFA 2CCJA 5EJEA 4TZ6A 1KYIA 1S2MA 1U2RA 1Q0UA 2FSGA 1E9RA 4LRWA 3SFZA 1PLLA 1UKYA 3U61B 1BYIA 1ZJ6A 2EWVA 4BFVA 4G5QA 1FUUA 3G82C 4PO1A 4OHZA 4L4UA 2W6JA 3RRYA 2DB3A 1NSFA 3SJAA 4HLQB 5E7IA 2C04A 4YMWA 5J4VA 5LB2A 1GRQA 5JWHA 5KHOC 1MABA 3LW7A 1OFTA 2Z6VA 2BBSA 1ZNYA 3IUYA 1OFHA 2PMKA 4IEEA 3W8RA 3AKDA 2YZ2A 3CF0A 5DNYB 2XJ4A 4RSGA 1VG8A 3AF2A 4DSUA 2XZLA 721PA 1Q57A 1FP6A 1Z6YA 2JIZD 1V43A 2IC5A 5CJPA 2AD1A 4PC6A 2XNDD 1F2TB 4HUTA 3IQXA 3IPYA 4TYPA 1E9SA 3KL4A 1E2GA 2GXSA 1S1MA 5L3SB 2C8VA 2P5TB 2V4ZA 1ZM2A 2IK8A 2IF2A 4U02A 1ZINA 1RYFA 3EIEA 3LLMA 4RD2A 1SVSA 3CWQA 4NCNA 2KSQA 5IT5A 3C5CA 1W5TA 3RNLA 1X1RA 3P27A 4N0DA 4ZI2A 4A2PA 4PXAA 3HWSA 4OBEA 3CF6R 4BLRA 5JBQA 5KDLA 3CLVA 1XEWX 1D2EA 4NCHA 3KB1A 1FUKA 1FFHA 2F1IA 3GEHA 1TQDA 2ZRBA 1U8ZA 1ZD1A 1OE0A 5KOYA 4YMSA 4C0SA 1NMYA 2ZJZA 3P1JA 3LXXA 1NKTA 4HDCA 4I1VA 3B60A 3RRZA 2QE7A 1A82A 2P67A 1SULA 3BXZA 3IKJA 3LDAA 2AX4A 1XEWY 3NBFA 1KK2A 2PLRA 521PA 4EKDA 1AQUA 2YV5A 2BC9A 1CJTC 1YZUA 4M1OA 4TYQA 4JLJA 2KI5A 2MSEB 2DPXA 3GLHE 3LWNA 3RS2A 5J4YA 2YNMA 2O8BB 2QP4A 2OCYC 3A1UA 1XD2A 1N6KA 4PFSA 2JAQA 5L3QA 1QG2A 5KNCA 2OLJA 2ZUCA 4UQOA 2O5VA 4BFXA 3H2YA 3P4YA 1Z0FA 2A7QA 1XU4A 4EPTA 1KI9A 4Q1CA 1EFCA 5LD2C 1T4GA 3FTQA 3W9YA 3EASA 1OJLA 3PIRA 1NKSA 3ZGXA 4CGZA 2H18A 2W2XA 3PJRA 3AKYA 3GJ5A 1SXJA 1DEKA 3B9PA 3TUJC 5HKKA 2CJWB 4ASUA 4A9AA 1DBSA 2QEQA 3K70C 3CO5A 3CR7A 3IEUA 2O8DB 4QBHA 4EPXA 3I32A 5ANRB 3SQXA 2OEPA 2ZYUX 2ZJ2A 4CT4B
chains in the Genus database with same CATH superfamily
1P9OA 4OB7A 4AS1A 3BE5A 3CT6A 3P2JA 3VSAA 3E3OA 3WGZA 3ELYA 1RWXA 5GY7A 4WE3A 1QFMA 1WZ2A 2WWWA 5DN6D 2Q6LA 2P75A 4LJLA 4RKRA 4HEQA 5EXDA 2HQOA 2CLCX 4XWYA 2NUPA 4E32A 1C3LA 4E5VA 1IQUA 4M38A 4R40A 2Q99A 4MI9A 4XKJA 1Y9AA 3FCEA 3CB2A 3HYCA 3QFTA 4L57A 4XVHA 4IINA 5JNWA 2C7OA 3NV7A 3AWDA 4UHDA 3PEYA 4L28A 1SXPA 2YZGA 5ERXA 1D2NA 4UM9B 4XCQA 2RCNA 3R5SA 4W5QA 4R1SA 2PVSA 3ZKWA 4ESOA 4Z7OB 1U3VA 5F35A 3JAWA 4CKXA 2IH2A 4J4BA 1GPKA 4I7EA 2H85A 4I1UA 1QOZA 4XTCS 4W5TA 2JA1A 4B31A 2ZYRA 4O08A 3WZLA 1G3MA 1I4LD 1KI2A 2GPWA 4W5JA 2IXDA 2F9FA 1TFRA 3D0KA 4G0XA 1ZU5A 1ZC4A 4WNAB 4Y9RA 3VZDA 1J0CA 5HZMA 5JNLA 3VDQA 1F9AA 1RM0A 2Y6UA 4NZ9A 1WBDA 2BR4A 5ES3A 4XB6B 1PYGA 2B25A 4IOMA 2Z98A 5TE9A 5MN4A 1RPTA 1TCCA 4YUXA 1JQJC 3RODA 1F5SA 1TF2A 1RI2A 3BL6A 3MWJA 2C07A 4IBOA 4MWDA 1O96B 3U4CA 3HN7A 3DXYA 1NZJA 3JVUA 1WM1A 3N2GB 3R5JA 4I8IA 3SSAA 3WV5A 3QBDA 3JZDA 3R0QA 2P3OA 4H7KA 4DSNA 4UUNA 1UQRA 3HB4X 3QKSA 3HJHA 4CF6A 3NDIA 4BU0A 2WBLC 3AJAA 2ZZMA 3O1LA 2YJ6A 3Q11A 5KAPA 3CCCA 5FA8A 1JLRA 2ISQA 1SRRA 4KLAA 1PBNA 3TRHA 4EF4A 1SKUA 3QXHA 1G18A 1PJSA 3V46A 5KKNB 2G1UA 4I1YA 4MB0A 4QPPA 4W8HA 3AGQA 3HY6A 2J9FA 5J47A 1OY1A 2C9CA 2DTEA 2GNPA 2NZXA 4QYWA 3CPHA 4P4NA 2Q2VA 3LPDA 2BKEA 3HRIA 3DWIA 1JT2A 4BNNA 1GZSA 3AHEA 1ORDA 3UAYA 1PDOA 3H2KA 1A5SB 1GL7A 4DA4A 1T0HB 2P11A 4F9GA 1D2GA 2PKQO 2A1TR 2X2FA 1HQKA 2D62A 3R3HA 3G17A 4I9GA 3LZDA 4K2AA 3I34X 3LKDA 4AJ4A 4Y6SA 1GDDA 3VYSB 1GU7A 2JLCA 2YYZA 4C03A 3FXAA 4C6SA 3RSCA 3CKLA 2Z2KA 4FMDF 4BKPA 4UAJA 3DSRA 4ZDJA 3LIPA 4MYUA 3DMHA 3JATB 1T26A 1NWHA 2RGYA 2F43B 3PL5A 4ZVUA 1J9EA 1O87A 2NT4A 5HK8A 4D9GA 2JGFA 3KQHA 221PA 3WYFA 3OSUA 4PHGA 3W2IA 4CEHA 5KYVA 4FS8A 2GHIA 2GZAA 1HE5A 3BK1A 4DBZA 4D57A 1KOFA 2OD7A 4RD3A 4BIMA 4LNUB 5CAEA 1QQBA 1DTWB 2EKPA 3A2NA 4YALA 1TAQA 2M6SA 1NY6A 4GT1A 4H7EA 4OXKA 2PNJA 4BLOA 1YASA 5G1OA 3G9TA 4NYJQ 1AA9A 1X14A 2C3UA 2QLMA 4MQ5A 3A1TA 3WG9A 4DWJA 3EX7C 3SR0A 1J20A 2B78A 2VHWA 4G1CA 4KQMA 3RVMA 3SQNA 1M3SA 1VI5A 2PX6A 2W2OA 5JANA 3IKTA 4GOMD 4H6XA 4IV5A 5KZMB 1L5FA 4YAEA 1SCAA 3ZU5A 1DIBA 4OI1A 3EDYA 5JJBA 2BHRA 1L4MA 4H0NA 2A4MA 2P9TA 4H35A 3GLVA 3B3AA 1T5LA 2OB1A 2P6UA 4MPPA 1XMSA 5D7BA 2CFRA 5HG0A 4CDMA 3GJ0A 5DIZA 1CIPA 2ATIA 1USKA 3HS3A 3MPUA 2H0AA 5KTKA 3CIOA 4II3A 5G41A 2XW6A 4WOJA 3DLIA 2QT0A 1IN5A 1WS6A 2I6SA 4FYJA 5HF6A 3IPRA 2EGHA 3NDPA 4C7VA 5DCYA 3PFIA 4NCIA 3P0FA 4MZXA 3USZA 4DNPA 4YRTA 4I19A 1YNOA 1B8PA 1JE1A 1EWRA 2ZVDA 1R7RA 3LHKA 1E7QA 4M22A 4Q02A 2PUWA 1WX1A 4GOND 3ZXYA 5CFZA 1Z4JA 5FNZA 1XEXB 4MUAA 4K03A 4UZEA 4X54A 2IXFA 4EL5A 1NUAA 2XUHA 2XV1A 2OAQ1 5JFOA 5IM4F 4AY3A 2CHFA 4EA7A 2G63A 3BWMA 4JROA 2IW3A 5B57C 2Z30A 4ZK2A 1CHNA 5HJ5A 3KEMA 3RTBA 4ZALA 2AQKA 2EOAA 5TARA 3VPSA 4FT4A 3I92A 4WIAA 2VHZA 3CLHA 4V0LA 5ALUA 5SY6A 3N2KA 2HSDA 1E6WA 1WXIA 1WMEA 3F9RA 1RYHA 3HA5A 4P2BA 4ZJYA 4FOTA 5JRZA 4ZO7A 3GT3A 1KEWA 2FSVC 4G01B 1ZXBA 1XPOA 4HUQA 4ZOLA 4MQ6A 1P4HA 3J7TA 5DN6A 4EYEA 3DE0X 3CRMA 3FVRA 4G1MB 5A1TA 4NBUA 4WLFA 1PS8A 3T7EA 4YEDA 2F1JA 3UK1A 1W36B 5JMPA 3VZBA 4IH9A 1WP9A 2FZ4A 1XEAA 2JCYA 3KKQA 3NAZA 4LHWA 4PTZA 4XJXA 5DXJA 5EJ4A 2NVUA 4WMLA 5DWVA 4JJZA 4XVRA 3IELA 4IIBA 2P6RA 2I8CA 4GX1A 1SKBA 4HLCA 2H2HA 4F4IA 2HL6A 4LZOA 4KAFA 4FDAA 2IKSA 1OYYA 2MSDB 1GTZA 4OHVA 4OYHA 1IZ8A 2C20A 4R2LA 4RZSA 4DQVA 1GTJ1 1IJEA 1T3GA 5DEOA 3HDVA 5B55A 4ISCA 4KTVE 3C8MA 5PNTA 3GHHA 2IZ0A 2M98A 3G1WA 4NV3A 2X4DA 3GOHA 1XCBA 3RF6A 1XRQA 3DC2A 5HZHA 4ES6A 3E61A 4D7AA 3UFBA 3CRZA 4YRFA 1W4BA 2Z56A 5I4BA 5F21A 5LUBA 2W0MA 2GS9A 4GLBA 4HB4A 3S99A 5FH9A 2XRZA 3WFZA 4JJKA 3PQ5A 4KG7A 5EE3A 1K6EA 1BO6A 2XITA 4TYMA 4FX5A 2J5BA 3I01A 5CPFA 3T61A 2ZXFA 4UQPA 4JN6B 3ZI7A 1WVIA 3DPIA 3ZD6A 4ZOEA 1I5OA 4B73A 2EL9A 4Q4DA 1V48A 1VPVA 1SC9A 4JQSA 5AJWA 3X1KA 1HO3A 2PUAA 1HDZA 3IR7A 3V55A 5T4HA 1NI4B 1G3QA 4ERNA 3HC7A 4TWAA 5I5GA 5K8UA 1RC1A 2O1EA 3V9PA 1H1LB 1UM8A 3G8DA 5E7QA 3DJYA 3TLGB 3OMWA 1TKBA 4G8BA 2D1FA 5CK5A 3FUXA 2JJQA 3OE5A 4H15A 5HKOA 1UT5A 5FWXB 2Q46A 3OIWA 2TSYB 1BKYA 2B8NA 1W5EA 4H7IA 2AFHA 3A36A 3JZFA 1RWMA 4MSUA 4Z8XA 4X41A 1TYZA 2IYSA 3WLIA 2KMLA 1FFEA 1KKLA 4WK0B 5ILGA 2POQX 3NHYA 3ZNOA 4F3KA 5HIJA 1DQZA 1NONA 1PNRA 4TL6A 2OCGA 1A77A 1SXJE 1X6VA 2VSXA 2O2DA 3NVAA 3LCRA 3OHMA 4JLSA 3TDNA 1HNZB 4V2UA 1M1UA 1GCAA 1MAUA 3BBLA 3LQRA 1K63A 3OD5A 1P9NA 1C30A 1TYEB 2BEVB 1U3TA 2PIDA 3PFWO 5C46F 1WZIA 5BSKA 4TTPA 5F5LA 2QNBA 5AVRA 5F7XA 3P9SA 4JI7B 3FRJA 1NJ6A 3WMXA 2EIXA 4EBBA 4V2IA 3T4UA 1GLNA 3ICPA 3KR1A 4D9BA 3DZBA 1ESEA 2H8GA 2Q0HA 3K35A 3OM9A 1TGYA 1UDRA 2P9HA 3AM1A 4RNCA 4X3CA 2G9UA 3LF2A 1FJGB 1B41A 2DULA 3VTZA 1YT5A 2CE2X 2C9YA 4EUSA 4W6QA 1D1SA 3IJ5A 2YRFA 1UR5A 2VAPA 4JLWA 3CR8A 4NQRA 1N2BA 2YJTD 1S2DA 1XCJA 2PN1A 3K7EA 4MW6A 4ZC8A 2NU7B 4PC7A 3WDKA 1IJBA 4QARA 1EB8A 1NURA 1WMBA 1MRNA 1UZNA 2VSNA 4A6PA 1GU1A 3WAGA 3D02A 1UOQA 2FQYA 5CW2A 5AT1A 4WECA 4FBGA 1BTOA 4HQLA 4B45A 3VNSA 4B79A 4AF8A 1X8LA 4FTWA 5EY5B 4LZZA 4PYJA 4BV3A 5JJCA 2FPMA 3LUKA 4FDMA 1YR7A 1ZR4A 1HZZC 4EJ2A 3GWGA 4ZK6A 4BPRA 1WSWA 1E32A 3M49A 4JR0A 3W8NA 2G1KA 4RKWA 3T7TA 4Q21A 1U6JA 4FJ0A 5K0CA 4H31A 1HT0A 3KL2A 3SEZA 1OLXA 3FPSA 4DV6B 3CB4A 1QTQA 5CM2Z 3SLKA 4TVOA 1G2IA 2WVJA 4JC8A 4NG5A 2HUNA 5FWAA 2CNWD 3KB6A 2GCNA 1T1IA 4BWFB 5B2FA 5KNLA 1JB9A 4BO4A 5D1HA 3IIJA 1FFGA 3RIYA 3EXHC 4KX3A 4ZI3A 1WOMA 3HCEA 1YUNA 5CVDA 2WVHA 4H1UA 4KNWA 4PQYA 5CH3A 1G8FA 2B36A 3GEGA 5ILQA 2PSDA 5SYMA 2G3YA 3WXMA 5F1YA 3ZK7A 3HZZA 2Z9BA 1B00A 1SXJC 1H1DA 2VJAA 3RD5A 1BVYF 1JEJA 2BL4A 3ESCA 3IEKA 4INJA 4LWOA 3NFRA 1PE0A 1DFGA 2VJBA 5DM0A 1W85A 2ENWA 4EA8A 3U60B 1BQ3A 4QOEA 1QF7A 5EZ5A 2VUTA 5F98A 5DB4A 4PLZA 3VOTA 3ZX5A 1T8TA 3E48A 1DELA 4LY0A 3KQYA 3OLZA 2Q8PA 1X39A 4TWZA 3HDTA 3R3VA 3AR7A 3PC3A 1PHPA 4RD6A 1GGFA 5L6MB 2WUGA 3BKXA 3M3DA 5B5SA 2JD1A 4FR5A 3PT5A 2BJVA 3LX6A 4I8XA 1QP8A 5G2OA 5FF9A 4LCJA 2CHGA 1C0KA 4FGJA 1S4MA 4GXQA 4R4JA 2IXGA 2WIJA 3OJXA 3PTLA 2VP2A 3GFQA 3LCVB 1JS1X 2WR8A 3OPVA 3AVOA 3KFVA 1B26A 5EGNA 4ZA2A 3K1AA 3RFFA 1JIJA 1W36D 5EXPA 2OQ2A 2AG5A 2BW0A 3QMWA 4DIUA 5EFZA 2GBIA 4BNGA 4C9BA 3HBLA 4LDQA 4FDVA 2C2OA 5JCPA 1EX1A 1Z83A 2YHBA 3E9MA 2WUEA 3L7NA 4JL5A 1YR9A 3OSZA 2A5LA 3H9EO 3HRKA 3NFYA 3GJ6A 3A6ZA 3NWOA 1T5DX 2FN4A 4FZRA 5CTAA 5BYBA 2QB5A 5H0IA 4XLTA 1HH4A 3QYFA 1UBHS 1XD2B 1M1YE 2FPGA 2H7CA 2XNCA 2ZBDA 3GPDG 4GPZA 5DWDA 1MIHA 2M1XA 4KQ6A 4J0DA 4I1OA 3JQBC 4RZQA 3HDGA 4ZVQA 4D0GA 4YECA 2JZCA 4QOJA 5MGNA 4B7UA 5AK6A 4LOAA 4NI5A 3ZDRA 4H6PA 1GQOA 1Q7RA 2VNJA 1JU9A 4B34A 1G20E 1TNDA 1SR8A 1U2QA 1KMHA 2Y27A 1OXXK 1PTKA 2NXWA 2WTNA 3F0TA 4RHFA 2FSHA 2N9UA 1UAAA 3MWKA 2IS2A 4CCYA 1BC5A 4KFRA 4I3HA 5K0FA 3E82A 4HSGA 1AQIA 1NDQA 1HE8B 2DU8A 4GXRA 3CCBA 4TLDA 1J22A 3FHCB 1NI4A 1W5SA 2B5WA 5ALFA 1K68A 3PTAA 4NOLA 5F73A 4YAGA 3H5OA 2YIMA 1TD9A 2DKOA 1T36B 4A0FA 4LVNA 1OZFA 3L92A 4ROSA 4PAMA 5IJ9B 1XQWA 3BMOB 2EFYA 4DT1A 1UOOA 4DJFC 2NNLD 4WAUA 3IODA 4D96A 1U0OC 1GCUA 3HFJA 4URXR 2TMGA 1OWNA 1AOXA 2OBYA 1RYMA 4K0RA 1KOLA 2G7ZA 3T1HB 5K2OA 1K1EA 4TLEA 2O50A 4FSHA 4LC9A 3KZVA 3KTAB 5EUQB 4EUEA 2N3ZA 5ENVA 1N9GA 1LDYA 2AQHA 3C3DA 3ZHRA 4FB4A 1UPFA 4LV5B 5ECDA 2ACEA 5C4GB 3ROFA 1RAIA 1K7CA 5CDFE 3T12A 4QFDA 5EGSA 4DYDA 5FUQA 2OBXA 4GDMA 5GPBA 3FNRA 2PMWB 2IPNA 4JQOA 1Q74A 4LSWA 5EG5A 4BO0A 1SD5A 2GTHA 4NJEA 2Q5CA 4BV9A 2EKBA 3MAJA 5JO9A 5AQ1A 1NX6A 3QKRA 3EUWA 4G0QA 4J0JA 3SYMA 5G4KB 1DB3A 1B74A 1I0IA 2INGX 3DXXA 3I73A 4L6AA 2IHVA 1Z5OA 2C5LA 4M7OA 1U4OA 3HUUA 1FMCA 4YP7A 3T7IA 4D97A 3THYA 1EDDA 3HMKA 2QA5A 3DEFA 1DC3A 2E4ZA 2I4IA 1FNBA 3KDAA 2LE0A 3KQWA 3CX4A 3QVMA 3BJMA 4WCFC 3V8QA 5L3VA 3E9NA 1LPSA 2FEOA 3ZCVA 3ESAA 3PV0A 4E1AA 1ISGA 1YA4A 2YYSA 1N1GA 3BZBA 3K5HA 4N82A 4Y67A 1US8A 1W1UA 3VO9A 3G1UA 5BSVA 1OI3A 1SUIA 4CDGA 2V74B 3IJRA 4PQEA 5CLQA 1UQTA 2DG2A 3EQ9A 3UM9A 5I7UA 1M10A 2JLVA 2PWYA 1AK9A 1OJ7A 1A97A 4P4UA 1KFJB 4XEUA 1RXSA 4KPYA 1SCBA 3HCOA 5E1DA 4DLBA 1GZDA 1HDEA 2AH5A 5CDGA 1BDJA 2B4YA 4K0KB 3BIFA 1OXUA 3DMDA 2D0OB 2O05A 1FS6A 2IDJA 1KDPA 4JLDA 3ML1A 2W37A 3QTLA 2GNOA 5GM2A 1GOTA 1FQKA 3ISJA 3OE4A 3QIAA 1Z6QA 3R7BA 4EYKA 1HNXB 3D7KA 5JAOA 1HR0B 5AYVA 4MRSA 4KQWA 1UQUA 2FK7A 1O6BA 1TO1E 2VYQA 4OFWA 1Z6PA 3MJ4A 1NHGA 4OK3A 2YWJA 3FVVA 1ADJA 1AF4A 1C7EA 3B52X 1PL0A 4PO3X 3OQMA 3ANYB 2QJWA 2QKYA 4FNOA 2YDYA 2YV1A 3OFKA 4NEQA 1E1DA 1XQXA 4QBTA 2BF4A 2WOOA 4KQ9A 2YVUA 4NZMA 5K2MA 5GV8A 1YVRA 4EPYA 3N0WA 4QULA 5JZOA 4BB6A 1VLQA 1V7ZA 3HBAA 3LBYA 3TI7A 4GLJA 1Z8FA 1PUIA 1YNSA 2FW8A 3LC0A 3A05A 3OJWA 2XLBA 4PQFA 3OF2A 3NOOA 4U2GA 4BEWA 1YQDA 1SGWA 1SQFA 1EQAA 1LX7A 2FZEA 2HFJA 3JVEA 2YWCA 4RL4A 5C34B 4OHBA 3M9LA 5A5EA 4XQ0A 3F96A 1EGVB 3DE2X 1NBHA 4EB6A 2G82A 2AW5A 2WFAA 5JNRA 1P62B 2JH3A 2Y67A 3UT6A 1EDEA 4Q47A 1GNVA 2YICA 3VUEA 4MW2A 4ZJUA 1GGNA 2I1QA 1JLLB 2E87A 3CEAA 3FPAA 3LS2A 3V2GA 3TUZC 3VKHA 4GRIA 3NQ41 1THMA 1UODA 2BMFA 3R3ZA 5DGHA 3O8QB 1A2QA 2FSFA 1JAIA 3K32A 4PSCA 4ZXPA 3HHPA 4DLSA 1ZITA 3K0HA 4GEKA 3MINA 2ERYA 4N0EA 4CMIB 3IVXA 1I7LA 3H8SA 1N7HA 2ZVQX 5CXSA 4M1EA 1P18A 2GN2A 4KDRA 1I13A 1GAJA 4EL0A 2C5SA 3QJ5A 4J9UE 1PF7E 2GN8A 1VL1A 4RD4A 4UDYX 3TL3A 1YHYA 3GY0A 2ODAA 5T8KA 4AO7A 3H13A 1RQRA 1NNSA 1X42A 2J7PA 3N86A 1CSEE 2RKBA 4K9LA 3WVNA 4RTLA 4IL5A 5IXYA 2ILVA 5KTOA 3L79A 2Z83A 4AZVA 4N3NA 4ZQEA 1K6XA 4KYUA 1JLKA 4YDHB 2J6IA 4TT3D 1E2KA 1AZTA 1EP1B 5IANA 4PGFA 2Z95A 3NEAA 3NJ4A 2CVFA 2X8WA 4W7HA 4XIGS 1C7IA 1KAHA 1EINA 4E12A 2F2TA 1CXZA 1JHVA 1PVDA 2I0FA 4REQB 1G8AA 3MAAC 4JMLA 3U26A 2HRCA 1T2NA 3WV4A 2QRVA 1KAGA 4BB0A 3NM5A 4GEGA 1DBQA 1S8NA 4AO8A 1G2QA 1M2WA 2DPLA 3UQZA 1WR8A 2V8OA 2ZROA 3LQFA 4A6DA 1QQ7A 1WKCA 4PNEA 4OAQA 4BCCA 1WHSA 4P4SA 4BKUA 3TCKA 1BOFA 4LK3A 1YAHA 1QG6A 2LRHA 5JAZA 4OSPA 2WYUA 4QRDA 3JQPA 1XTVA 1SG6A 3ZTTA 4HAIA 5CD1A 5CVJA 1DIGA 2EFHB 1YS2X 2QRGA 5LYJB 1NXPA 2IEDA 5H81A 2Y1EA 3WAJA 3P4XA 3IOMA 1O97C 1JU4A 1BQEA 3ON5A 5F2EA 5FA5A 2PIAA 1PKEA 5KOHB 4AKIA 1GUDA 3AYXB 3WYDA 4AJNA 1DAMA 1DAFA 1VJDA 3U2QA 1F8YA 4N6NA 5HQ3B 4NZOA 3WLTA 1IHXA 4JB0A 3P8ZA 5F9MA 3FFAA 5HJEA 2PJUA 2P4UA 3CBQA 1NPTO 5ER9A 3K5PA 3I61A 3WSTA 3AETA 3ZLJA 2UUOA 4Z7NB 4QEDA 2AN5A 4BKRA 4GBGA 4FW9A 3QPWA 1T91A 2ZSFA 4PFQA 1FTWA 3A0UA 3NHFA 2ZWPA 1AB6A 4UHHA 3RDPA 2PX4A 2XB8A 2IOHA 1JI0A 2AB0A 1B6TA 6REQB 1FP1D 2J9FB 1L5MA 5JCJD 5DW0A 4OXQA 4FGWA 1N75A 4KXUA 1H4TA 2VA9A 2R6FA 2OV2A 3H11A 1TYCA 3DZHA 1HEYA 3M89A 3GVIA 1OWOA 3OZRA 3AXSA 4DDKA 2XCTB 2VH1A 4PO8A 8AT1A 2E1PA 2A5GA 4BKMA 3UB4A 3AHFA 3JWIA 3HFGA 1V39A 4JB8A 4MQMA 2GPAA 3KDSE 2C5BA 3L1IA 3O1JC 1JA1A 4NMMA 4OU5A 4RMJA 1JV2B 1LLFA 1U1EA 4DKXA 2DF8A 3ETEA 4RHEA 2FGJA 2GGSA 2W2VA 3C7KA 3DT6A 4HEHA 4IIFA 5I7EA 3Q1KA 3IVMA 3K0AB 5FL3A 2J3EA 3TDMA 2WAOA 1IY0A 3ETJA 3CX3A 3BBPA 2GN4A 2VA8A 3DEHA 5JVDA 1JEYB 2VPIA 1FNNA 2UYGA 3CWZA 3NVMB 1Z33A 3HVUA 3WL4A 1VJ0A 3ZE9A 4D3ZA 3T99A 5I8PA 4WNAA 2R25B 1K2VN 4L7VA 3ONDA 4OATA 1CT9A 3AUSA 4MIKA 3MJSA 4R2HA 3UHFA 5CT8A 1ULAA 1S9HA 1Y89A 3LLCA 4NDAA 4YJ2B 1SIWA 3SMVA 3LBIA 3EC1A 5JNTA 2RGRA 1CB0A 2NO1A 2ZWVA 4U6NA 3SYKA 2HA3A 1EFVA 3W06A 5E95A 4MWGA 2XB9A 3BAZA 5AO9A 3ZE7A 4BO1A 4AWBA 4C89A 3DQPA 3HJAA 1LRLA 3CF2A 4CF5A 3T1TA 3ZIAD 2VG8A 3KZXA 5BUCA 1MTOA 2PSHA 2YWGA 4I50F 3ZCTA 1RM3A 2YCLA 4WINA 1C7QA 1CZUA 1UBTS 1E4VA 3E2PA 4CU2A 2P4QA 2XLCA 2EX0A 4L8VA 1X86B 1NVDA 1CJUC 4L08A 1QLJA 1JFTA 4BGEA 3AR8A 1J8MF 2I7TA 4AMVA 1ZGBA 3O31A 2VDWB 4QAQA 5FI1B 1KJNA 3UBTA 1Y98A 3ZD7A 4FCTA 2V7UA 4L4ZA 1TEZA 2BMVA 2OE2A 3VHXB 3B13B 3MD9A 1NRJB 4RFSB 5FX2A 4PTLA 5AESA 1MG0A 1YC5A 1S8OA 2W2LA 2XCIA 2ZETA 3NC4A 4QICA 3FMOB 4UTZA 4Q9LA 1KZ6A 4R7GA 4YACA 2YY5A 3ZKAA 2DHEA 3X3HA 1KFEB 1ZA2A 3QUTA 3RWOA 3SR3A 5BSEA 5JZSA 5ALSA 1UBEA 3WLNA 3L07A 4NXMB 5ENDA 2G6BA 4AICA 1BDHA 1R9NA 4AMGA 3GZTB 4KDEA 4MI1A 1Z6AA 3RS5A 5C8VA 4HDNA 4N54A 2YMMA 3BWEA 4UC0A 3G2OA 2W2NA 4FFSA 3STHA 4D74A 5IH7A 1WO8A 1WUHS 4IOJA 2CE7A 4IEIA 3N8IA 3UG6A 5EINA 1Z0DA 1IULA 1ZPDA 5C4MA 1C9YA 2J7PD 1RPZA 1FJHA 1NQAO 1ACMA 5AOCA 1MENA 1SO8A 2OO5C 2RB5A 3KKOA 1MOZA 3UJDA 3ZEIA 4HT3B 2WD9A 3C5VA 4JX8A 4PY2A 3H86A 3NAQA 3BD7A 3LCMA 2R84A 4HC4A 1ZUD1 2XEXA 4K6MA 4NU5A 4IDOA 4NBLA 1JLHA 1F60A 2LXNA 3UUFA 3R8FA 3EH2A 1NULA 4FQ5A 3FG9A 3NBKA 3VYUB 5K5EA 3FPHA 1T5TA 16PKA 2FX2A 3CTPA 1E92A 3DF7A 4BNKA 1I01A 1Z62A 4PAGA 4DLXA 2PGIA 3T4XA 1O0CA 2DEUA 3PWTA 3KK0A 4HNGA 1Y9DA 1FRZA 2GXAA 1IM5A 1NI3A 1S8FA 3QVVA 4TMFA 3EZYA 5J9FA 3UN1A 2A0UA 3LKVA 4MV7A 4HDQB 1M2JA 2QLFA 2R3SA 4Q4JB 5BSUA 3X2EA 4BYMA 3N58A 4XJVA 3O1IC 1T3TA 2I33A 4YH1A 1RKVA 2IXBA 3NBXX 6Q21A 2M9MA 3W1VA 2FHSA 5FPYA 1E79A 2E82A 2VJLA 4ZVMA 3VOBA 5TSDA 3AY7A 1ORHA 1KP3A 3BH6A 1CETA 2H2AA 2OGZA 3GPIA 3LLSA 3T0IA 1JFSA 4P0QB 3C3BA 1C1YA 3CWCA 1M8KA 3FHOA 3HU3A 1A4UA 1FFSA 4YT4A 3GLFE 1WB4A 5HX7A 1WMFA 3O4FA 1M6YA 1TU3A 3SBOA 4F9TA 1PT9A 2ZSEA 4C2AA 1T0IA 4HBZA 4EGCB 1XTKA 1KBQA 5TDHA 1N2OA 3MM4A 4G8JA 1I9CA 1CQWA 2ZJBA 1V8BA 1LLCA 2YCBA 5F78A 3RAPR 3LO5A 3V1KA 1KH2A 4JMPA 1TIPA 4PZZA 5HDBB 2GXUA 3V3KA 4M7WA 1Q19A 3H5NA 1MHTA 2CZGA 2O0JA 4QVKA 3RFCA 1BDMA 5EZYB 4DADA 2AG0A 4ZYTA 3ER9A 1QCYA 3B7GA 2GZSA 1C0PA 4JASB 1RAAA 2C4TA 4I55A 1JHPA 2ADFA 2BGJA 3K6RA 4PICA 5AVJA 3KALA 5BPFA 2QI9C 3V7NA 4YLEA 1PJ4A 3OQ6A 3ZY6A 4R1NA 2VAVA 5EPEA 1Y1RA 3K0BA 4R41A 1QQ5A 1TYDE 1QIKA 2LW7A 4XLLA 5CYGA 7REQA 5LXTA 2A30A 1T25A 3AW9A 4OQPA 3W79A 4ARZA 2GHRA 2HY7A 4ZKDA 4UHCA 3ILSA 4MTCA 1C0LA 3FR7A 5DK6A 5FP0A 5ALMA 4EMBA 1XKQA 4RA6B 5EWLA 3FKQA 1QX4A 2PUFA 2BBTA 1D7AA 3PHIA 3FFTA 2JBHA 5CNMA 1UCFA 3B8EA 2YWFA 4S2EA 2GPTA 5DTEA 1E5QA 2IYRA 4D6PA 2QNRA 3FVQA 1XP5A 4B6EA 4UD6A 3GRZA 4Q4CA 2IEZA 3EZ2A 1HFKA 5KSOA 3CW2A 3FVTA 3PWZA 3U9LA 4BNIA 5K8JB 6AT1A 4C6RA 2RFLA 2X0EA 3N28A 1AIPA 1NFRA 2IIQA 3AFIA 5L3RA 1KZGB 3IQHX 1CS0B 2VH2A 3H3JA 2GRJA 1QFSA 1PZEA 2I3ZA 1BXRA 3FPEA 3PC7A 4Q1AA 3HPRA 4RVDA 4EHAA 1US8B 4EKNB 5KTYA 2RD2A 4GKBA 1GUYA 2CL7X 5E9JA 4NV0A 1W88B 4RPCA 3MFYA 2FMIA 1XWIA 4EATA 4O8ZA 4F6RB 2ZLBA 4JIGA 3AEYA 3H5RA 5GQSA 3RC9A 3RM3A 5BWMA 1ONPA 1QK5A 1QSGA 4RPHA 1OI4A 3EXIA 3MWYW 2DM6A 2Q2WA 2JJMA 3OA0A 4X61A 5KYNA 1W8IA 3DP7A 2CDRA 3DL7A 1QH9A 1W2HA 2GRAA 2I6GA 3AWIA 1PI3A 3PPWA 4G9EA 5ISMA 4CN8A 4I2NA 1ZJZA 3D4LA 3QMVA 4GM0A 1WXGA 4X7BA 1FNCA 4CM4A 1VBFA 3AI3A 5FUWA 1JQ5A 1WEHA 1E2NA 3PF8A 4HYYA 4TUYA 3TRIA 3T5PA 3AVVA 2JDID 5GTDA 5AH0A 3SKVA 1O77A 3CRW1 3MCWA 4BMYA 5BUSA 4GKVA 1XKTA 2OK8A 2WTXA 4JLMA 4K6KA 4RPGA 5E8JA 5EMLA 1FYFA 5I3CA 3TW8A 3RSGA 1AC5A 1Q0LA 4Z9BA 5AVZA 4NATA 3VKGA 2FR8C 4UZFA 1EHIA 1NUTA 4FYIA 1CZRA 1ZKDA 4HWGA 2AA3A 3OKFA 2QN7A 4DC1A 2W2LD 2EFDB 5C1PA 1BKDR 1N6HA 3ITNA 3DFZA 4D0NA 4DWVA 2WM2A 3LPMA 3VZQA 1WHTB 3W8EA 4E7OA 4EYOA 3UMMA 1B43A 1OKKA 5BXQC 2HXSA 1GTL1 1RCUA 3RFVA 5L45A 4FYXA 3W1EA 4CIVA 2P4SA 2MSCB 3WJ7A 5FR2A 5FQOA 3ZGNA 1NOKA 4HNTA 4OHCA 2GQ0A 2NZ8A 1DEXA 2BFAA 2QTCA 2WQZA 2NYUA 1PJCA 3F47A 3OHSX 3TLZA 4BN4A 4O4HF 1DKNA 2WABA 2XTZA 3UJCA 3CPEA 4L95C 2J3MA 4OTZA 4ARAA 4RM2A 3A9UA 2PT6A 4ZEMA 1QANA 2AEMA 3TUIC 1CIVA 1E2DA 4E2WA 1C9NA 1YVDA 4N0QA 5EJGA 2X0RA 4D3FA 2PA3A 1Z12A 3EIXA 4J29A 5EVCA 5REQA 2PRKA 3G2KA 2DH5A 2GN1A 3A6HA 2PCLA 3IDQA 4LNUA 5G0SA 4CF7A 3HTXA 4UEJA 1IQ0A 4PWZA 5C31A 1W49A 2MTBA 3OZFA 2AR9A 3JQ6A 3AIIA 3INRA 4D9NA 2QQGA 3IEPA 1NC1A 1E58A 4CETA 1QZUA 4II7A 4YJFB 4FBMA 5MFZA 1UZUA 3A6GA 4O2BA 2R1VB 4MUXA 4R5MA 4KE6A 1OMOA 5C80A 3VNQA 1QH8A 4HRYA 4URZR 3T3EA 3SHTA 2C2BA 1B14A 3MNFA 3BB1A 3NM4A 1M73E 1DV1A 2C61A 1HE3A 3B7PA 4UOZA 2ZW9A 1XQ9A 5KOJB 2XCLA 1DTSA 1VJRA 2OHHA 2PJRA 2QN1A 1PG2A 3AUJB 1OBOA 4WASA 3JS5A 1YRYE 2VKQA 3DG9A 4M83A 4P6VF 3RRJA 5GZ6A 3A04A 5B6IA 3AINA 2PUBA 1WVMA 2WTUA 2NUPB 3SYTA 5E1OA 3TSZA 1UXJA 4KYVA 4B6JA 4BLSA 1CY7A 1N2EA 1RAHA 4U2EA 4F1WA 3C6YA 3BGVA 4GYJA 2HMTA 1G5PA 2VCYA 4NU8X 4KR9A 4ZTUB 2WWVD 1U8YA 2CXTA 2WSBA 4U7FA 5HJ7A 3SWWA 6LDHA 1TM2A 1XZPA 3W5DA 5D2CA 1S2GA 5BXYA 2ZT7A 1YL6A 4IJKA 2QGNA 2XMPA 5JNVA 3FWHA 4NXNB 4LYJA 3RIGA 1L1EA 3JX9A 3K1ZA 5HTKA 2PQ0A 2WFLA 2NOAA 3H9GA 3Q9NA 4HXEB 4BMXA 1RYBA 1QMGA 2W42A 3CZPA 3JAKA 4OHOA 3ZVNA 1R3DA 3FNFA 4QGHA 1AM4D 4LZAA 4MW1A 5TVGA 4F5YA 1T4CA 1TDJA 2WYWA 3I6YA 1CE8A 1V5IA 4LE0A 3BEOA 3LX4A 4P81A 5CIWA 2EJUA 3TNLA 4D9EA 3RIHA 2IOFK 2RONA 2RGDA 1VZ2A 4KPFC 2REQB 2DQZA 1RPAA 3IT0A 3SNHA 1KC3A 1HQYE 3E1GA 2KWIA 1WNFA 3LUPA 2X9QA 4JP5A 4LF6B 4P93A 5DHTA 4RELA 3R7WB 1Q16A 4BNFA 4TX1A 5BNIA 3FFXA 4DLAA 1RAGA 4YGXB 4DLWA 1JQ3A 5F2OA 3QW2A 4KVAA 1GQYA 1EZ4A 1PR0A 4MS1B 5CA1A 1RLIA 4HQNA 3NGMA 1XZFA 1DRUA 1UDXA 4MICA 3BG5A 4PIVA 3DFFA 2AE2A 1Z6GA 4NHEA 1U4NA 4NH4A 5CA1B 4KTTE 3KP1A 3QOXA 1AQ6A 1R16A 1W5FA 1X7WB 3OY7A 2QX8A 4BUCA 2AFIB 2QLNA 4FCCA 3WGKA 3SHWA 2LBPA 2CFOA 2RGGA 1PD1A 1M8GA 3FRIA 3KCNA 4NAUA 5DHFA 3AHGA 2IT1A 4A5SA 1G17A 2QUHA 1OHHD 1Z2DA 5AI9A 1PJLA 1Q0QA 3C41J 3L4EA 2IHUA 2W2MA 3RJ9A 3LY9A 3NOQA 5JATA 4A03A 1JQLB 2AF4C 4TMXA 5A4DA 2AR0A 2B1JA 4IPTA 4Y6QA 1W2WB 2C4NA 1SCDA 2HV9A 5KYXA 3SPXA 1QRDA 1SAYA 2X0IA 2IFTA 2ZTVA 3C14C 1VIYA 4L27A 5P8WA 4LF5B 3V7FA 3ASVA 2YXDA 4Q3LA 3T5DA 3R3JA 4KZPA 1J1IA 1RZRD 3GG2A 4JFAA 3FYCA 3LA8A 2D8AA 4M9UA 4Q3DA 1W2GA 2XPCA 1T5SA 3A9RA 3O9ZA 4XYEA 2VATA 3AQ4A 4QJ4A 2FUKA 2PX3A 4WXYB 2JDIA 3OQOA 3NTXA 4D4IA 3BFXA 5BNZA 2BFBA 3QXXA 4TKLA 5KNBD 4ZYUA 2ZBUA 2IUTA 1KOJA 2VJPA 2Y0BA 2I34A 1C3VA 3D1VA 4TQAA 4BVBA 4LFAB 4ITVA 4H0CA 4U7WA 2WHPA 5FEMA 1TC1A 4LJ4A 1Z16A 3AH8A 3Q7SA 1Q20A 4B3GA 1U0FA 4QT0A 3G49A 2FH5B 1MQ9A 2O3SA 3AEKB 4KHZA 4UFOA 4RXTA 3ANSA 3W78A 4LBZA 3ONNA 2O06A 3LXRA 3ZXIA 2J31A 4ESEA 3NJRA 5FYDA 5EYPA 5FBQB 4FNMA 4G8DA 4RK1A 5GWXA 4J0KA 4O02B 1TMGE 2NLOA 1DXQA 3OQHA 2BCEA 4GOJA 1VB3A 3F5SA 3UATA 5F3RA 2BEUA 3DUWA 3R9XB 2OK7A 3T3NA 5FLKA 3ISTA 3IQGX 1KDRA 2GBCA 5FL7A 2QMQA 4MA4A 4Z9AA 1U7OA 4R3WA 2RBGA 2BVNA 1R18A 1OI2A 1KJJA 3OU6A 4Y1FA 4EGFA 4S05A 2RH9B 3K2QA 4H16A 4TTIA 1AV6A 1F6BA 5K01A 1Z28A 1UJCA 1F4PA 3M33A 3G0DA 4MMXB 1TTPB 2ONJA 5FUYA 1YA8A 4P5DA 4PZEA 2FPPA 4OXRA 3ZZ1A 1KL7A 3P0JA 2J9YB 3FHTA 2SBTA </