1W2GA

Crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with deoxythymidine (dt) (2.1 a resolution)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
208
structure length
196
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERRDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE TMK
publication title The Crystal Structure of Mycobacterium Tuberculosis Thymidylate Kinase in Complex with 3'-Azidodeoxythymidine Monophosphate Suggests a Mechanism for Competitive Inhibition
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 76
structure length 196
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2004-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1w2gA00
4KVAA 2IT1A 5ANRB 5KSYA 1N6RA 1GNPA 4ESVA 3OESA 1EG7A 4C7OB 1GNRA 1NIJA 5FUYA 4KFRA 3ETLA 4C3ZA 3B9QA 3CF6R 1D5CA 2GXSA 1MO3A 3DM5A 3NKVA 2YVUA 2A9KA 2DPXA 2W2VA 1DAKA 4YXWA 3CR8A 1GSIA 1KJYA 2ZJ2A 3W3AA 2HT1A 1GAJA 2GJAA 1KMHA 2FFQA 2HYDA 1LV7A 1VG9B 2YNMA 4BECA 4XWKA 5H1YA 2ZAMA 2Q0HA 5DN6D 3DHWC 3MMPA 4Q02A 2OUKA 1H8HD 5AJVB 3TLXA 3U4QB 4BRWA 2W6ID 1ZM9A 1NMYA 3U60B 1NLYA 4DEXA 1IN8A 2Y8EA 1YZTA 1G6HA 3UMRA 2ORVA 1XEWY 4BFWA 4TLBA 4M21A 3L0OA 2ODNA 2VP2A 3GFOA 5EP1A 2BOVA 1S3GA 2REBA 4D2IA 1N6LA 4HATA 2ZU6A 2ZRMA 2QAGB 4Q7JB 1M6NA 4LYHA 3OIWA 5TY0A 3A1WA 1WBBA 1VIAA 2FEMA 1M74A 4U00A 1OB2A 4DB2A 4MGYR 3CH5A 1Z29A 4NHOA 1TUEA 2QG6A 1G7TA 2WKPA 3T12A 4D81A 2MMCA 1GP2A 2F1RA 2DWOA 3VKGA 5AUOB 1E2DA 4GL2A 3Q5EA 3ADKA 3TVTA 4DUGD 2YZ2A 3DOFA 1GL7A 2IL1A 4PC3A 2ZR9A 2O8CB 2OSBA 4X8LA 4WZAE 4M0LA 3X1YA 4ARZB 1CJTC 2DR3A 4JL5A 3PUXA 4RD3A 4EPVA 1P62B 3FWYA 2VH5R 4U02A 1MABB 2FFBA 4CYMA 1SVKA 4LX0A 4BZQA 3QG5A 2ZUCA 2CNWD 2F43B 3KJIA 2FWRA 4IVQA 4XTRA 5HZKA 2PLRA 2P67A 3DOEA 3C5CA 2BM1A 3BJIC 5K8LA 1XU4A 5JRZA 4BE7B 2ZRPA 2V1XA 3TMKA 3OE7D 3B2EA 1BKDR 1OW3B 1EGAA 4PHGA 5JMTA 2VP0A 3GJXC 3KX2A 4LC0A 1EFHA 3MFYA 4CIDA 3LBIA 4P4SA 1OIWA 3QXSA 1R0ZA 4JLJA 3FHCB 3SYLA 4URVR 4EFMA 4Q18A 5B57C 3LQRA 3LO5A 2B8TA 4HZIA 2GCPA 3U44A 4FD2A 1MO5A 1P6XA 2JATA 1KO5A 2RGEA 1J90A 3R9WA 1YKSA 3KKNA 3LY5A 1KK0A 4ZI3A 2V55B 4DEYA 4A6XA 3FKSA 1KSHA 2HF9A 2OLJA 2VSOA 4TMWA 3UG6A 1Y63A 4AC9A 3LNCA 4UNQA 5BN4A 5SZKB 1I4DD 2GJSA 4LHXA 3W5IA 2W0MA 2IC5A 1AGRA 4TSFD 1BOFA 4CGZA 1W44A 4W5HA 1E0KA 4ON9A 2PJZA 4OK6A 2NGRA 2QMUA 3H84A 2D7CA 3IBGA 4B3DA 2ZSEA 3R8CA 2NZ8A 3WP0A 4B47A 1NIPA 2AWNA 2QGZA 3VR5A 1A82A 1VYVA 4G0NA 5IF9A 4FMDF 4H1VA 3GFPA 3T35A 1T3SA 1XF9A 3OFND 3K09A 2JDIA 2AL7A 3Q72A 3CKLA 4BZXA 1SKYB 1SULA 3P4YA 3WHLA 4EJSB 3BERA 1ZP6A 1E9RA 3SEAA 1GUAA 2QE7D 1E0AA 1Z0KA 1JAIA 2GK7A 3C16C 4GNKA 5AK0A 4F7WA 4ZCMA 5CLLA 2BMJA 2NG1A 3AKEA 2P65A 3QBVA 1R0YA 1XCMA 4JLNA 2NO0A 1W2GA 3NC1C 1TX4B 1NY5A 3CUEF 4QHSA 3P20A 4U7DA 2OBMA 4KLNA 4MA4A 4B33A 2J0UA 1YE8A 3T61A 4BQSA 5FOVA 4M9ZA 4Q5IA 1KKLA 3KL4A 4R7ZA 5A0FA 1PLKA 1SHKA 4Q7KA 4Q4JB 1KI6A 3K0AB 1WA5A 4IHQA 4NMMA 1TQDA 3I73A 3GPLA 4MKGA 1E96A 2J3EA 3UG7A 1RVDA 3QVUA 1CJUC 2JIZD 3LRPA 3RHFA 3VKWA 4OJKA 1ZCBA 3QXHA 4JVMA 3TRFA 2ZI3A 4LOAA 2HT6A 3WMEA 4ASUD 4BLOA 1Z06A 1AKEA 4B76A 1X3SA 1X1SA 5GVRA 4QGFA 1XTIA 2RMKA 3BGWA 4YMVA 1RRCA 2BJVA 2HCJB 5TARA 1MRSA 3BB1A 2GXUA 2CCKA 2FFAA 4WA7A 1N6HA 4Q4HB 3ADBA 1ZD9A 5C46F 1Q3TA 4B32A 2HCBA 3EC1A 3T06B 5DNYB 4E5UA 2XB2A 3U61B 1OE0A 1I2MA 3CR7A 3AGQA 1G8FA 5TDHA 1HTWA 5G53C 1OXTA 2BCGY 3X2SA 2QROA 1WBDA 2QUZA 2A5FA 4MH0R 4AWXA 2WTUA 4GRAA 3TUJC 2WOOA 1G20E 3THWB 4PO1A 1II0A 3GEHA 3IUYA 1FOEB 2QRZA 2FE4A 4PPFA 3BS4A 1OT3A 4HAVA 1FQJA 4DJTA 2ZJYA 1RFLA 1ZD1A 4LCBA 4TQAA 3A1SA 2J0QA 1HYQA 4W5WA 2VRWA 2WSSD 2YWFA 1ZRHA 2ZVQX 3DEFA 2O0JA 3BXZA 3FB4A 4B2PA 5KYKA 1NMXA 2W00A 1Z0JA 3THYA 1YVDA 4DLZA 1XX6A 2R6AA 4LBVA 2P2LA 4BLRA 1G3RA 4BUJA 4P32A 4EIWA 1A2BA 4TTQA 2YWHA 1U81A 4HAZA 4OL0A 5E4FA 3UKDA 4DLYA 4M8NE 4G5GA 1D8TA 4B6EA 2BHRA 1KSGA 2UKDA 3A36A 3U7HB 4NCHA 2DWPA 5EP3A 2CLCX 3C14C 721PA 2QTVB 3C8UA 5DI9A 2EFGA 3HJNA 2WWWA 1FNNA 2GDJA 2J41A 2QP4A 3WRXC 3AEZA 3CF0A 2ANBA 5AR1A 4GDFA 4RD2A 2Z6VA 3LBHA 1QVRA 2GJKA 4C4PA 4JLBA 1BH2A 2Z5FA 1QHNA 3AVUA 1CULC 2WWHA 2OFWA 1E1QD 2IUSA 2N1BA 4E22A 2AD1A 1HT2E 1N0VC 4OHVA 1ZVQA 2XTMA 4NL4H 5DHFA 3MWYW 1SXJA 3PQCA 4NYJQ 4JVSB 3QQ5A 3HR8A 3FMFA 3PEYA 3CWQA 1Z22A 2ZEJA 4JZKA 2RGAA 2AN9A 4DSTA 5C18A 5H68A 2JEOA 5F98A 1OKKA 4RVCA 3VQTA 5JWOA 3RS7A 2P6UA 4IOMA 4QJ5A 4ILEA 4NPHA 3V4RA 2J7PA 1C9KA 1F2UB 4RCYA 4Q1CA 3QBTA 3QSYA 2KWIA 1ZM7A 1FZQA 3FKQA 3RC8A 1JAHA 2ZS8A 1HH4A 1P2TA 1R5OA 4JBWA 1YR8A 4IOLA 3MWLA 1QHHA 4I1SA 3ZZUA 2HLDD 4KXFB 1G6OA 1VHTA 3EW9A 1M1YE 4AKIA 3KFXA 4B3BA 5JWHA 1IAQA 4MKFA 1SQ5A 2MSCB 1UBCA 1E0SA 2YC2C 3UWKA 4D26A 1W5TA 1JQLB 2ZYWX 1IN5A 1S3SA 1KIMA 1Z6GA 1CLUA 3Q85A 3QUSA 5DLQC 3UIEA 4XWAA 1KTVA 4OQLA 3WHKA 1OXVA 3DKVA 1MKYA 1KZGB 3I62A 1JJ7A 4R9UC 1UM8A 1CTQA 1OXUA 1II8A 3EZ9A 3TAHA 3ZIAA 1S9HA 3F3YA 3R9XA 2UZIR 4WIAA 3CWZA 4IRUB 4KFSA 1G21E 3FTQA 3GEIA 4POAA 3L0SA 5FBRB 4A82A 1NJGA 1DAGA 2VL7A 4PFSA 1U94A 3D3QA 5FBLB 5E7MA 3EX7C 5EZ5A 3CRVA 3K53A 4FW9A 3JZAA 2BVNA 5GJVC 4KO8A 4EFLA 5J5CA 1KHTA 1E9BA 5DI3B 5EXTA 2FSHA 2HJGA 4L9WA 1NSFA 1E79D 3PIRA 3RABA 3TIFA 4AYXA 5K8UA 2O8EB 3LXRA 2B7CA 3PUZA 2G0TA 1P73A 1I2DA 1ESNA 2CL6X 4TLAA 1XEXB 1RJ9A 4I4LA 3T1TA 4I99A 1T5IA 2DFLA 3OEEA 1E32A 2GHIA 2VSXA 3E5HA 1G3QA 2QMOA 5E3HA 3QENA 3D8BA 4R2IA 1RE0A 4CEIA 4CW7A 5F9HA 5L3QA 5JJLA 2CHVA 2JGNA 1KKMA 4EKDA 1G17A 2OO7A 1K5GA 2WJIA 4GBMA 4YC7A 2JLVA 3THXA 3RRYA 3SBEA 4A8JA 4HB3A 1QG2A 2YWGA 1PV4A 4F4IA 2ONJA 4RD1A 2LKCA 4RZXA 3OZXA 4BFSA 2WMNB 3I8XA 2QTFA 1G5TA 4BRUA 3AF2A 1XRJA 1KI8A 3K0FB 4AYWA 1NLFA 4KCGA 2IK8A 4EPYA 3EIHA 2JLRA 2YKGA 5CYPA 4DIDA 3NXSA 4Q1FA 5E7IA 4NKRA 2XNSA 4EPWA 2R65A 4CZ2A 2AKYA 3X1WA 3WBKA 1IN7A 3EPHA 1Q0UA 3QKUA 4GOJA 1U8ZA 3DZ8A 3GLHA 2VO1A 1N5LA 2ZJAA 4DDWA 2WKQA 1WRBA 4LYAA 2ANCA 1Z3IX 4XIGS 4CT5A 4W5JA 3RRNA 2HUPA 3LFUA 4EFNA 4ZDJA 5JSZA 1Q20A 3KB1A 4MYUA 2EWVA 2GCOA 3RDPA 3QF7A 4YXWD 4QKQA 3A6PC 4M1MA 4S35A 1SVOA 2F55A 4D80A 1OPXA 1J8YF 4DSNA 4QNMA 3RS2A 2ERXA 1CR4A 1TADA 2ZSFA 4MGIR 2GBLC 2QY9A 5FL7D 4A1FA 2O8FA 3C4JA 4QC2A 4XD7D 1XWIA 4I1UA 5D3MB 5H8WA 1KO7A 1VCOA 2QT1A 4HYYA 2BIFA 3FMOB 2YOHA 5GVSA 3T1VA 3EARA 1GIAA 2IS1A 2MSEB 4E09A 4B73A 1EFCA 5L3SB 3AF1A 2FSGA 4EQ6B 4QBIA 4HB4A 1ZAKA 5AJYA 2NMVA 4D6PA 2FZLA 1H8EA 3WNCA 2R8RA 1J2JA 4OHXA 1KNXA 1E1RA 2XNDA 1AS3A 4B3XA 1DARA 2RGXA 3HU1A 4KVGA 5GJBA 1W48A 2QRNA 3NHBA 2A3RA 2QAJA 1TF7A 4B35A 5BN3A 1QF9A 2Z83A 2ZVPX 4M22A 3AF3A 4NCIA 1Z47A 3D7MA 4GMDA 4C0BA 1EX6A 4KLZA 1R0XA 3DPUA 4IOJA 2EQBA 2WIBA 4BEJA 2PMDA 3GCGA 1TTTA 4FINA 2QMHA 2VIIA 4NH0A 3IPYA 4DDTA 2E9SA 1VMAA 3VR4A 1OH7A 2R44A 3FGNA 4A0HA 2NO9A 1E2IA 2RGNC 4RCZA 2JJ2A 4JLKA 4URYR 2ZRDA 4YMWA 3CIOA 1Z8FA 4TMTA 4LHVA 4DT1A 1YU9A 5LB4A 5JI3E 4HI0E 1L8QA 5JJKA 2J46A 1W7AA 4DCNA 2LCFA 3TUIC 2R6DA 2CHGA 4A36A 4NYJR 1DADA 2G6BA 1Z28A 2BKEA 2C9CA 1VPLA 2ZI9A 3B5JA 2WM9B 1PLJA 3L0PA 3SNHA 2RAPA 3AQ4A 4PQYA 2QT0A 1CIPA 2ZXUA 1CP2A 4UNNA 4BLSA 2V7QA 3SQXA 2V6IA 2DHRA 3FKSD 1E2NA 3SJZA 4OQMA 4F4JA 1Q1BA 3ZS9A 1GITA 2D06A 2ZYUX 1ZNYA 4IXMA 4O0MA 5BYKA 1IQPA 1G64A 2ZI5A 4YMSA 3B6EA 1OLOA 1KO1A 5P21A 5AJWA 1GKIA 2C78A 3NTUA 3K9LA 4QXAA 1HQCA 4Q19A 2ZRHA 1E9SA 1JI0A 1QRAA 1Z6YA 4IEEA 1TF2A 4LUCA 4PXAA 1AN0A 1ZNWA 5B64A 1P3JA 2AHOA 4C0HA 2OXRA 2X8AA 2D2FA 4Q03A 5HKKD 1KK1A 3IGFA 2ONKA 4MRPA 4ZKEA 2MMGA 2WAXA 4AK9A 1SGWA 4C7OA 2FPLA 1EWQA 4TT3A 2Q3FA 4IEIA 5EE1A 2AWOA 2WWXA 1Q1EA 2WWYA 1Q3HA 4IW3B 1KJZA 5CIWA 2IYZA 1Z0DA 1KDTA 1ZIPA 4D4JA 3M1IA 4C0KA 1IXRC 4LYJA 2G1JA 3A37A 3PV0A 2J0SA 1NVXQ 3D31A 1E2EA 1FP6A 2PX0A 2JLQA 5FUXA 3T15A 1KSJA 4LGMA 3UK6A 3PUYA 4KFUA 1SKQA 2R6FA 1CS4C 1Q12A 3IQWA 1Z2CA 2AFIE 1WMSA 4A92A 1E2PA 5LD2B 3VMFA 3U4QA 3IKJA 1DBSA 1LB1B 1N6PA 1W0KA 3L82B 3GFTA 4RZ2A 3ZLJA 3EIEA 1XD8A 2BEJA 3BD9A 4WVFA 3ICEA 1E94E 1UDWA 3H86A 4UXIA 2DB3A 1ZIOA 3BFXA 1W0JD 1RPZA 1L4YA 1DO2A 1QDEA 4BZPA 3PEUA 5AJZA 2F7SA 1NVVQ 2XJ4A 1CJVC 1M7HA 1U8AA 4OBEA 4Z1MA 4ZV4A 5KHOC 1ZM2A 4EDHA 4ZIRB 4LBZA 4E03A 1KDPA 3FVQA 3OAAD 4RD4A 1KO4A 4JLDA 3L8ZA 1NVWQ 3ZD7A 1Z6TA 3IO3A 2OZEA 3R9IA 3QKTA 2GEVA 4GOXA 5HE8A 2ZRBA 4M1YA 4Q00A 3CO5A 4MKHA 4MYHA 1KNQA 3NBXX 1TAGA 3CW2A 3KQNA 2GVDC 3CRMA 4LHWA 1GKYA 4LBYA 1JALA 3RANA 4PC7A 2F9LA 2VF7A 3AKDA 2ODBA 2O8CA 1W2HA 3PG5A 1E9AA 4ARZA 3BWDD 3RAPR 1V5WA 3GEEA 3LLUA 4DHEA 1RRPA 2P6RA 5J4VA 1MABA 2EYQA 3GJ6A 3Q7PA 2XX3A 2JASA 3TSWA 4B34A 4US2R 3EPKA 5TXGA 1KZ7B 4RSGA 2F43A 2HDNB 4FMCF 5FPYA 5BXQC 1EK0A 3IHLA 1G7RA 1YR9A 2ZIAA 2LWIA 2P3SA 3BB4A 4QNRA 1II9A 4DVGA 2J1LA 4MRNA 2WICA 4RY2A 1GILA 4HLDA 3IDQA 5M04A 2DY1A 2CE7A 4ZCLA 4II7A 2J7KA 1KOFA 2AKAB 4G5OA 5B2ZA 2OCYC 3UXMA 4V03A 3I5XA 1OSNA 3FYHA 4C2TA 1N6NA 2FGJA 3IPXA 3W6PA 3RS5A 3I3SR 3UANA 4B44A 1DO0A 3GMTA 2W58A 5KSZA 4PC2A 4RFSB 1YQTA 3MJRA 3FE2A 4C0JA 1BYUA 4D0LB 3A1VA 2RCNA 3SC3A 1IXZA 1G7SA 3DL0A 4N1AA 2FEOA 5BN5A 3FFBA 4HAWA 5L3VA 2GTPA 1LS1A 2QSZA 521PA 4P0TA 5DYGA 1WE2A 2WZQA 5J47A 1X8JA 3MWJA 3OHMA 2QZ4A 4PHFA 5FTJA 1AGPA 4NCKA 3GLGE 1W4CA 5FPTA 4EJSC 3R8FA 1RW4A 4FCTA 3R20A 2QBYB 2OE2A 4R98A 3WNBA 4FMBB 4UNPA 5FTLA 4GZMA 4A0FA 4KITB 4V0NA 2B7BA 2FGKA 2ZUBA 3K9GA 2G3YA 3ICQB 4OQXA 4QBGB 2W0SA 1FX0B 3AVPA 3WMGA 2HYIC 4Q4LA 4HAUA 2PH1A 1IONA 2ZRCA 1QHIA 2H16A 4NCJA 2G9NA 3VTKA 1UPTA 4MRVA 2XXAA 3IIKA 2FSIA 2CEAA 2VPPA 1DPFA 2OG2A 1E9CA 1TMKA 3KFVA 5EUMA 1W5SA 4A0RA 4EJSA 3M0EA 2J7PD 3NDBB 1IXSB 3EC2A 1ANKA 4Z8XA 3RS0A 2CVFA 1S4QA 1Q57A 4NE2A 1OFHA 5EXXA 1XXHE 4TZ6A 1IJEA 2VHJA 4DKXA 4EAQA 2TMKA 1CR2A 2J87A 1R8QA 2A2ZA 2GF9A 3C7KA 4NP6A 3GLHE 3FOZA 1GL9B 1P9NA 3K09C 3LX8A 3C5HA 3ZH9B 3LAWA 2RKOA 5FI1B 1E6CA 1ZMXA 3TQFA 2A78A 2IYTA 3SYNA 2X2FA 4AD8A 3TJZA 2XSZD 1N6KA 4C0SA 2KE5A 3WRYC 2AK2A 4XVUA 4Q4JA 4A6PA 3K0AA 4AY2A 3VKHA 2O0KA 1L4UA 5KUTA 2RH5A 1LY1A 1XEWX 5EXPA 1KDOA 1S0UA 3KTAB 3WXMA 3B1XA 1IY2A 4KYUA 1Z83A 4Q4AB 2OM2A 3NWJA 1NBME 2ORWA 3N5CA 2XZPA 1ZD8A 4Y0AA 1AA9A 3CPHA 3MUFA 3QVVA 3LWNA 4ZDWA 4KHZA 3I5YA 3ZJYA 3QXCA 2CMKA 2W2TA 4YONB 1YZLA 3W5JA 3U7EB 4F38A 5J4HA 3FHOA 3PEVA 4MGZR 4HLCA 621PA 3SQWA 1WF3A 2F1JA 3ZDQA 4AI6A 1SVLA 4M1SA 4EPTA 1DAMA 5G40A 1FW6A 4BGDA 4XSHA 3MRSA 1LF0A 5FI0B 1N5IA 3QJYA 1XPRA 1YRAA 4IOKA 4X8HA 4LHYA 3U3RA 3WYGA 2P6NA 4X8MA 3SYKA 2F1HA 4M1WA 4OQFA 3WMFA 3THWA 2HJVA 2BMFA 3SHFA 4PR0A 3RRMA 3BRWD 1K8RA 4R71A 3A58B 4LV8B 3BBPA 3N70A 2JCSA 1Z07A 2J45A 4HUQB 4IFEA 5JZVA 1DOAA 4KJZA 4XWOA 1BMFD 3DZDA 4UKDA 1NF3A 2J5XA 4BFUA 2HV8A 1OH6A 3PCRB 3JVUA 3FMPB 1JR3E 4Z54A 3IEVA 1GTVA 4CEHB 2C9YA 3GJ8A 1NKSA 3TR0A 3HU3A 1U90A 2NTYC 2W6JD 1HA3A 3T34A 2F3TA 1VYTA 2C5LA 2O0HA 5JLJA 1GG2A 1CJKC 2QPAA 4GPTA 3WNDA 4PQFA 4L9SA 1HURA 2BDTA 1Z0AA 4HEJA 2IF2A 4TMKA 2OLKA 5AWFC 5TV2A 4N0EA 1KK3A 2NQ2C 2REXB 4JYCA 4PAMA 3TUZC 4ZDIA 5SZJA 4QGHA 1D2MA 3H2YA 3F5FA 4QBHA 4XJXA 1YHNA 1R4AA 1YZNA 2A30A 1BS1A 5FOXA 2FZ4A 4US0R 3SZRA 3HDTA 1DELA 3B1WA 3THOA 1TU4A 4IDNA 1CKEA 4JYBA 1KJWA 1FUUA 4D4LA 2GZAA 1NVVR 3B1ZA 1COWA 2ZE8A 3DM9B 4JL8A 5A4JA 1H8HA 4JT2A 5CJPA 4IXNA 1T3LA 2OV2A 2FNAA 3ADDA 2W6IA 5KDOA 3QKRB 3SHWA 2CK3D 2J9RA 2QL6A 5EQTA 1F6BA 4AYTA 3AVYA 1Q44A 1MOZA 821PA 3G5UA 4FI3C 1W36C 3B8HA 1EXMA 1UKZA 4DCTA 2XGJA 2Z0MA 3VHLB 1NBMD 1MO6A 2ZYTX 1DEKA 4JKIA 1NY6A 1WCV1 4B2IA 3MWKA 5KNCA 1KO8A 3KJGA 1F2UA 3SFZA 4DLTA 3RS4A 1T91A 2A5GA 2WJJA 2CDNA 4PC6A 1SXJC 2IEYA 2PZEA 2H57A 2ZM5A 1WP9A 1UEIA 5FPHA 4AKEA 1LFDB 2XZOA 1US8B 2FJUA 1ZYUA 2XB4A 3OF5A 1GKUB 1DAIA 3OEHD 2WMOB 1H8ED 1YZUA 4URZR 3GLIE 1TU3A 2AXNA 4B3CA 1G19A 1D9ZA 2XNDD 1RYHA 2V9PA 1TUIA 4TL7A 1G8HA 4G5SA 5L3RA 221PA 1IJFA 2JLUA 4AURA 3TSOA 3P32A 3QOFA 1XTJA 3NG1A 4JSTA 1KAOA 3AF0A 2CLDX 2ODEA 3ZVLA 2OFXA 4HB2A 1FNMA 3AVOA 5CK4A 4DLWA 1NL3A 2H1LA 3BFVA 2EVWX 2CNWA 4H9GA 2EYUA 2N46A 1KDRA 2XOKD 3PENA 3AV0B 3IO5A 1QZXA 2QORA 3CNOA 3B13B 3QPWA 1KI7A 1KY3A 4EUNA 3ZVMA 4TL8A 3B1VA 3GLFB 1FMJA 3EA5A 1XTRA 3PUWA 2W83A 1JR3D 3THYB 3LXXA 4URXR 3OE7A 1F48A 3K1JA 8OHMA 2KB0A 1E99A 2B21A 4R2HA 3SOPA 1AZSC 1TEVA 4GSYA 3FMIA 2VQSA 3VFDA 1VTKA 3VAAA 1E9FA 2J59A 4C30A 3CONA 5DI3A 1T9HA 1OV4A 3GJ4A 3NDPA 4AKHA 3QEOA 3TQCA 2O8EA 4JLOA 3CNLA 2Q6TA 4DLUA 1S1MA 4LC1A 3QE0A 4PC1A 4KFTA 1GRNA 3U3KA 5E7JA 3W8RA 5FOTA 2IYSA 2CXXA 1XEXA 2C99A 4P33A 3BH0A 4Q9IA 4LI0A 1JQJC 1UBFA 2D2EA 4NYIQ 2JA1A 3DO6A 1RYFA 2QU8A 5FOWA 3A4NA 2OCPA 2ZE6A 2R62A 4QGAA 1HE1C 3DDCA 1KI1A 4TYNA 5D3QA 4TSFA 1CBUA 1OFUX 2WWIA 1OHHD 2R2AA 4DSOA 2HXYA 2IS4A 1G3MA 1GRRA 1WB9A 2NPIA 3U6KA 2WIAA 3EAQA 3K0FA 3LA6A 3AF4A 2ATVA 2L0XA 4P31A 3AH8A 1XCPA 3OFNA 4AG6A 1UDXA 3SJAA 2QSYA 4A8JC 4DLXA 1I4TD 1SVWA 2X2EA 2A7QA 2GZHA 3QF4B 1XZPA 2QE7A 2ZUDA 4PZZA 4Q1DA 4HAYA 4JJKA 2O8BB 2IYUA 4BFVA 5CYOA 1RRGA 2Z4SA 5FUVA 4YDHB 4L8GA 2BBTA 3VR3A 2F3RA 3KXKA 2VHUA 3QXJA 1VYUA 3C15C 3P4XA 1N6IA 2VF8A 5JECA 1R5BA 4DDVA 4F93B 1T8TA 2GKSA 4LYFA 4O25A 4ABYA 1JECA 1G4UR 2DBYA 3HU2A 4NYMQ 1G291 3UPUA 1E2JA 2ZR7A 4N0DA 1VCNA 3TKLA 3BK7A 3IIJA 5CJ2A 5D3MA 2NZJA 2JJ1A 2JIZA 3LDAA 1N3BA 3TBKA 1XB2A 2XJ9A 1UKYA 1YR7A 5KSPA 2X77A 3ONWA 1JNYA 1GRQA 4LJ8A 4TL6A 4HDCA 4ASUA 3Q5DA 5SZHB 3EPJA 5KPDA 2OXCA 4M4SA 2ZE7A 1OH5A 5H70A 1KI2A 5G41A 4BLPA 2IX3A 5L3SA 1H65A 2H18A 4M2LA 5EE5B 5EZ6B 1UAAA 2AR7A 3SR0A 4RKFA 4EQ6A 4Q21A 3RVBA 1NP6A 5DIFA 1IHUA 2FA9A 3WY9A 4XH9B 1W4AA 3BORA 2VP4A 2GESA 1G5RA 1ONBA 4V0KA 1SVSA 3QI2A 2IYLD 2XTZA 4OYHA 1M2OB 2PT5A 3AVQA 3QPUA 3AUXA 4TLCA 4ZKDA 4MGKR 3TAUA 1NVUQ 2O8DB 1MT0A 2V3CC 3AVWA 1ZM4A 1OYWA 5JJIA 2OHFA 2QGNA 5CIQA 1ZJ6A 3A1TA 1R5NA 1WXQA 3MG9A 3GLGB 4W9MC 1ZM3A 4MUBA 1SHZA 1FPMA 2CL0X 2WSSA 3BB3A 2FSFA 4L15A 1C1YA 4URUR 4V0LA 4B43A 1PVOA 5DYIA 2AFHE 4TLDA 2WWFA 4MYCA 4V02A 1EX7A 4Q9JA 2BMEA 3Q9LA 1XD2B 2I1QA 2D3WA 2UVQA 4K46A 2V6JA 1GVNB 2GETA 3A8TA 1PLLA 3HR7A 3K0EA 2FF7A 4ESHA 4OQNA 5FBVB 4C0QC 3L8YA 3Q8XB 4LJ4A 1F3OA 1OXSC 4C9BA 2UZ3A 1E4VA 1XBTA 2QM8A 5HE9A 4U5XA 3QIAA 5BQ5A 1CXZA 3LVRE 4IDQA 3AB3A 1G3IA 1XXHB 2ZE5A 3B9PA 1ETUA 1J8MF 2IW3A 4KV9A 4Z8YA 4A9AA 5KDDA 4Q01A 3I4LA 1U98A 4N3NA 3TW8B 3UATA 1OFTA 4ACAA 5AUPB 4TYPA 1UADA 2PMKA 2QENA 6Q21A 4QJ4A 1RIFA 4L4UA 1G1MA 2VP9A 1YZKA 3E70C 4LJ5A 3I61A 4KAXA 1UBGA 5JI2E 2OESA 2ZSDA 1GM5A 1E2LA 1DG3A 1E1QA 1F2TB 1GL6A 4FIDA 3VU9B 4FCWA 2RGGA 1UBEA 1ZW6A 1OYYA 4DLRA 1EFRA 2H92A 1RKBA 3AP2A 1FUKA 3AP1A 4QRHA 3SS8A 3KKMA 2KBEA 3Q7QA 3FDIA 2WAYA 4GT1A 1Z63A 1B0UA 2ATXA 4JKYA 3KXLA 1ZU4A 2F9MA 3MSXA 3K70C 3V9PA 2FDCA 1NG9A 2ZSAA 3B1YA 3TVDA 4BFTA 5JFGA 3W3ZB 4HZUB 4Q48A 4QHTA 2CJWA 5K8IA 5IK2A 3LD9A 2P5TB 2ZRLA 1XTSA 3QKSA 4A2QA 2YC4C 3LX5A 3ND8A 1TL7C 5FPKA 2ZJZA 1S8FA 2HLDA 1VG8A 1Z6XA 2D4HA 4TTRA 5J4LA 3T1QA 2IXEA 4A2PA 3PITA 2IF0A 3ADCA 5EE9A 4ITRC 4XTCS 4BLQA 4Q1BA 5JWRA 3PEWA 2Q3HA 4JBYA 3W34A 2F6RA 5FR1A 3EA0A 2REOA 1N25A 3NBYC 5UKDA 1LTQA 1E2HA 3L43A 1T6NA 2NO7A 5K8TA 3KUCA 2VLIA 1X6VA 1P4SA 2ASEA 1HUQA 3GJ7A 1ZC3A 3TR5A 3EWAA 4JBXA 3K0CC 2DWQA 1GZSA 2PCJA 4JS0A 1ZNXA 4NU0A 2AX4A 4FMDB 1ZUNB 1KI4A 1VCMA 2IUTA 2JDID 4ZPXA 2A5DA 1YZGA 4XOIA 5E95A 1AQUA 1R2QA 2PJRA 1Z0IA 5FTMA 2A5YB 3UWOA 1QHYA 1A4RA 3I1FA 1D2NA 3KKOA 1E2KA 2ZJ8A 1JPJA 2JLXA 2WJHA 3BC1A 4ZIRA 4LWZA 4NYIR 2RGDA 3K0CA 5JS7A 4DT1B 4PHHA 1E79A 5HR5A 2PZGA 4UXHA 3SE0A 1G3UA 5BW8A 1YJ5A 3CM0A 3N2IA 2QAGC 4I1OA 3EG5A 4Q47A 1R10A 5JS8A 4DRZA 4H1UA 2DFTA 1HEIA 1W4BA 1SXJE 4FCVA 5EXSA 4LSGA 1KMQA 1NI3A 4K8OA 2WJVA 4LJ6A 1VDZA 4F91B 1NN1A 3GQBA 2H8KA 1N0WA 1G8YA 1P2UA 1ZNZA 4Q9KA 2BCJQ 2ZANA 3MAAC 4WXRA 3CX7A 3MD0A 4K81B 2QAGA 3LV8A 4KYIB 4NONA 3E1SA 1R8SA 3S1AB 1XEFA 2WPDA 1HV8A 4PO9A 2H7VA 4Q7LA 1KI3A 4Q9LA 2C9OA 2DFNA 3H0KA 4QBFA 3UMSA 5JHGB 3U3MA 3MCAA 3EIQA 5TMPA 1G8PA 3FHTA 1N5JA 4PANA 1CRPA 4YMTA 3W6NA 3B85A 3NBZC 1XTKA 4LV5B 4NYMR 4IDOA 4TYQA 4RFSA 3QY0A 4PPGA 4CEJB 3NBFA 1Z0FA 1QHXA 1W49A 4B71A 3X1DA 1SZPA 2FMXA 1HT1E 4Q7MB 2GILA 4UNRA 2BBOA 2OEPA 4KBGA 3GLIB 4CVNA 5HZHA 2BM0A 1AZTA 3LW7A 2ORIA 3CZPA 2ZETA 5FOSA 1GOTA 3RS3A 2BJWA 2ZTSA 1AS0A 4LJ9A 3L0IB 1EFTA 2ERYA 2RB4A 2H17A 2E1RA 1Y3AA 1CU1A 1E98A 3U2QA 2OAP1 4MUAA 2JAQA 4LV6A 1DAEA 3CPEA 2QBYA 1COWD 4G01B 4Q1AA 5FL7A 3R7WB 2R6CA 4PSKA 4XD7A 1UFQA 4D4KA 1YRBA 3CF2A 2I1VB 2ZJ5A 1FX0A 5LBIA 3CPJB 4NTZA 2CCJA 3O8CA 2B8WA 1AIPA 2QQ0A 4TYWA 4GI7A 1V43A 2OFOA 1T0HB 3A1UA 4L5BA 4DXAA 1N0UA 1R7RA 3RSOA 4HDOB 2GVZC 2FV8A 1XP8A 1NLZA 3B78A 2JLYA 3WYFA 5FL3A 1WQ1R 5IHPA 3DMNA 1P9RA 3MJHA 3KXIA 2CHQA 2CCGA 2V1UA 2KSQA 1JR6A 4P3YA 2EFCB 4UJ3A 4C0LA 2VBCA 4M1OA 4F92B 4J0QA 2ZI7A 4LZZA 1S1CA 3RC3A 2IHBA 3K9NA 1W36D 4JSYA 1ZBDA 3AKCA 4IVPA 1KMHB 1CR1A 3F8TA 1Q21A 1O3YA 4JIMA 3WP1B 2XEXA 1I4LD 4HUTA 3BFKA 2O52A 4GP7A 3REGA 5TVKA 2PT7A 1SXJD 1VECA 1T8UA 2IS6A 3L2OB 2YWEA 1XZQA 4MRSA 4BFYA 3PUVA 1XMJA 2KI5A 2Z43A 1OKKD 3CNNA 3KTAA 5C2JB 5A5GA 1E4YA 3SN6A 1KK2A 2YYZA 3H4MA 3IHWA 4OK3A 4PHTA 4M1TA 2D62A 4Q4AA 4PZLA 5EP2A 4TN1A 3T5GA 4WZ6A 3SU8A 4QM7A 1DS6A 2ZYVX 4QHYA 2IWRA 2IA5A 4WXPA 3TE6A 3AP3A 5CDFA 2YOGA 4JLAA 3LW8A 4RZ3A 4S2EA 5CITA 5KSOA 1P75A 4DB4A 1JXOA 3EASA 3EXAA 4L16A 1XMVA 2NIPA 2X19A 4EPRA 4O3MA 3OIYA 1XPOA 1CRQA 3NEYA 3AVXA 4O2RA 3J81k 1CJMA 1U8YA 2GAOA 4E07A 2ZRAA 4NBSA 4A2WA 2WVJA 4ACBA 2NPFA 2EFEB 2ZRGA 2GF0A 3PR1A 2WJGA 3EWSA 5HCNA 4TL9A 1UF9A 4FWTA 3ZIAD 3RYTC 3WYAA 3PXGA 1BO6A 2RHDA 2Q21A 4PPQA 4RZUA 1S2MA 4KODA 5AUQA 3TGPA 2QQEA 4HUQA 1O87A 2VSFA 2OBLA 2ZJOA 1AQYA 2FU5C 4TLEA 3FPAA 1C4OA 2FPMA 4MDFA 2YV5A 1FMLA 4QFMA 4JL6A 2ZSBA 2XITA 2IS2A 1RRFA 2ZS9A 5JCPA 4LPKA 2PZFA 2WV9A 5IDVA 3X1XA 4CEHA 2A5JA 3ZD6A 2OCAA 4QJ3A 2XAUA 2C04A 2IEZA 3O47A 4Q4HA 2GAAA 4LDJA 4P4SB 1AK2A 3P27A 2R9VA 2XXAB 1GNQA 1XMSA 3NIBA 1E69A 3N2EA 5HKKA 1TEXA 4MDEA 3ZYCA 2IYRA 3KDSE 3TW4A 3U44B 1E2FA 4G1UC 1TQ6A 4FN5A 5CM9C 3RWMB 3AUYA 4PTLA 3CRQA 2P0EA 3U3JA 4C0AC 4D25A 1XMIA 4IFBA 1G18A 1UJ2A 5C4GB 1FTNA 3W6OA 1LW7A 2WKRA 3OEED 2R6GA 4F4CA 3ASZA 1J70A 3CZQA 1QHGA 3G82C 4LJ7A 4OK5A 4XVQA 5J4KA 3CLVA 4B3GA 3T5DA 3EZ2A 1XNJA 5KDLA 4BASA 1A1VA 1IY0A 1ELOA 1VHLA 1NSTA 1IY1A 1NMZA 2QTHA 3T1OA 3VNVA 3NH6A 1E2QA 1AM4D 2ZREA 2GCNA 4BFXA 5KO2A 2OT3B 3AVTA 1Z2AA 2XZLA 2OILA 1LF5A 1D2EA 1JPNA 4OI0A 5F3WB 1ZUIA 1QBKC 3QKRA 3IEUA 1M7GA 2ZR0A 3ZVRA 4V0MA 1NJFA 4JLMA 3KKPA 1G9XA 1W0JA 2GRJA 5EP4A 4YMUA 2G88A 2JJ1D 4B3FX 2BBWA 2K5UA 4ZDKA 3KKQA 3NHAA 4DLVA 4A0GA 1TQ4A 1OIXA 1HQYE 1KI9A 1PJRA 3OAAA 4ZO4A 4AG5A 1US8A 1BYIA 2AXPA 2J0VA 2V4ZA 1MO4A 3SFVA 4DBLC 4DZZA 4ZI2A 1GWNA 4B75A 1T0JB 2QMEA 5JEEA 3SBDA 1OFIA 1ZC4A 3K9HA 2J0UB 4QL3A 5DN6A 1KGDA 3RLFA 1OB5A 2BEKA 4DIEA 1DAFA 4OI4A 5FH9A 1ZUHA 4IVRA 4TYYA 1W4RA 1KI6B 1DE0A 5L8VA 3CB4A 2EU8A 4IDHA 3GJ0A 2C95A 4QOSA 1XJQA 1P2VA 1XDBA 2PX3A 2F1IA 4LK2A 5FBWB 5BWMA 3KQUA 1XTQA 5JBQA 3SJCA 2IYYA 2H5EA 3CRW1 4URWR 2GZDA 2VEDA 3GLFA 5KPJA 2VTKA 3CRRA 2IWHA 1P9WA 3I92A 4DLSA 2G77B 2G0NA 4FXPA 3QPVA 1J99A 4PO8A 3SJBA 1IM2A 5DH9A 4JJZA 4D0GA 1FTSA 2WJYA 3GD7A 5GJCA 4WAUA 2QPTA 2QP9X 2RGCA 2QEQA 4OHYA 1E1RD 5FTNA 3B7GA 1G5PA 4IDPA 2C96A 4DUGA 3D6TB 1YR6A 2HEIA 4BLTA 4NDZA 2BKUA 4HLQB 4OI1A 1XFAA 2PEZA 4WOPA 4TQUS 2AK3A 2QM7A 1K5DA 5FFMA 5CK5A 1U0JA 5DHAA 3JVVA 3QNUA 2EFHB 3TK1A 1E2GA 1JEEA 1X8KA 3W8NA 1T5LA 5C4MA 1NNEA 2DFKB 2VP6A 1RZ3A 2ZI6A 2PBRA 5DE3A 4P4TA 2Q3MA 3QEJA 5C1BA 2FN4A 2EWWA 2QI9C 5TB5A 5LB2A 1HY3A 4NCNA 1DTSA 2Q9BA 4Y0VA 4HLUC 2FX3A 2IUUA 1NN0A 2VYFA 1QG4A 4LJYA 1EFRD 4RFVA 3EPLA 1CF4A 3P1JA 1UEJA 4LRWA 4X8OA 4UJ5A 2ZAOA 2ZRFA 1XJCA 4DSUA 2GJ8A 3TH5A 3B82A 4TWZA 2JJ2D 1M34E 5IT5A 1N5KA 2ZITA 4NZYA 4G3XA 4CF7A 1X1RA 1Z6AA 3I8SA 4D4MA 3ZQ6A 1Z08A 3LH5A 4OI2A 5HTKA 1VG0B 4GMXA 3OIVA 3PFIA 1NN5A 4HLUA 4MYTA 4KSBA 3FFAA 1EFUA 3QF4A 2B6HA 3NEJA 2IYQA 4LY6A 5IK2D 2O8BA 2PL3A 1E9EA 1U2RA 1G7CA 2GJ9A 1N6OA 2ZQ5A 1VIYA 1OIVA 2FFHA 1NN3A 3PJRA 2CVHA 1W36B 1FL9A 3KUDA 4BPBA 2Z4RA 2V7QD 3K70D 1JJVA 4G5RA 1DG1G 2IYWA 2KJQA 3JZMA 3ND9A 4KSCA 3LVQE 4HSEA 4I1VA 4ERNA 2KBFA 1Q22A 5BYJA 2XSZA 4QM6A 2I3BA 2VP5A 3OIUA 1SXJB 1TPZA 3REFA 2GWHA 2IBMA 2YINC 2GXAA 5DSZA 2OAQ1 2BC9A 2C2HA 4I81A 2AD5A 1AJEA 3KB2A 4MRRA 3M4YA 3DVLA 3RRZA 3KQLA 4RKEA 2QP3A 3CX8A 1PUJA 1JXMA 1U99A 1T3HA 1Z5ZA 4US1R 3U3OA 5LPNA 1VG1A 1R0WA 5J40A 1JBKA 4PSVA 3KJHA 2FH5B 5FUWA 3B60A 2GEUA 1CR0A 4TMZA 2OCBA 5F2EA 5B58C 4TT3D 1QHHB 1Q1ZA 4QGGA 4PSAA 1IN4A 3O8BA 4JMPA 2JLZA 1LNZA 1MH1A 2W2XA 4LHZA 3A4LA 3VR2A 4P4UA 1YZQA 4OKSA 1E2MA 5JEDA 3NVAA 4DWJA 3HPQA 5FTKA 4GFDA 2EW1A 2JLSA 1VCIA 2HXSA 3GP8A 1GFIA 1GDDA 5JCZA 3RNLA 1XD9A 4XSGA 4UXJA 1II8B 2GNOA 2O8DA 5GJWC 4M1KA 3IBYA 4D82A 2IYVA 5CLQA 4DCVA 1QHSA 3LBNA 2CLSA 4KI0A 1W0KD 3ZZTA 3ZQJA 2C8VA 2V54A 3GJ5A 1R6BX 4B48A 4Q9HA 1FP7A 3SDZA 1ZCAA 3GLGA 1BMFA 1L7VC 4WZBE 3LLMA 1A2KC 3U6BA 4RD0A 5KOYA 1XD2A 4PX9A 2BBSA 1P2SA 4V0OA 1SKYE 4Z1MD 3ASYA 4XVRA 3RWOA 2W6JA 4UNSA 2MSDB 2RHMA 5LDDC 4KU4A 2WPDD 1E0JA 2NO6A 4BFZA 2V8OA 3ECCA 3P26A 5CDFE 1MR3F 2IHYA 5EUQB 1U9IC 4GZLA 3CX6A 4YLGA 2N42A 2CBZA 2QA5A 3MGCA 1UKEA 4FWIB 1AS2A 3EZ7A 1XXHA 2P5SA 1ODFA 4PAQA 4MKIA 1RJ9B 2QNRA 1J7KA 4G5QA 5IRCD 2HF8A 2BMDA 5JHHB 4CEIB 1M7BA 3K8YA 3HYTA 3U7FB 5L3QB 2JJ8A 1HE8B 3U5ZB 3QG1A 1U0HC 1U9IA 3VHXA 1IN6A 4DDUA 3THXB 1DVRA 4PAOA 4A8JB 5KNBA 4C2UA 1F2TA 1SVMA 4M9QA 4PQRA 5FBQB 3VU9A 4A4DA 1W47A 2C98A 4TQ9A 4WW0A 2CL7X 4FMCB 2GA8A 1KSFX 3G0HA 2ZRJA 1G41A 5EJEA 1MV5A 1PUIA 3BE4A 1P5ZB 1ZINA 3HYRA 2CK3A 2BWJA 4B74A 2VA8A 2ZS7A 3DKPA 4PPNA 2XTNA 1U0LA 2ZROA 1P60A 3VX4A 2C77A 2Q9AA 3BH6A 4LBWA 1NBMA 5AJXA 5F9FA 1WDTA 4YQFA 1S9DA 1OF1A 2VHTA 4HZUA 2YHSA 3PVSA 3GJ3A 4Z51A 4WBSA 1L2TA 3K0SA 1X86B 1NRJB 2PCLA 3GLHB 4OHWA 5DO9A 5AUNB 2GBLA 3KQHA 5FPSA 2IXFA 3I32A 3M6AA 3OEHA 4DCUA 3U7GA 3BIFA 3CH4B 5JSZB 4D0NA 4IJMA 4JLPA 4JVNA 4TTPA 2DCUA 2GCOB 1G16A 1A5TA 4TZ0A 3Q3JB 1W1WA 4B6FA 2GEDA 2O5VA 2GK6A 3VX3A 2RGBA 3ZGXA 3IIMA 4HAXA 2O8FB 1P61B 2NOAA 2ZJBA 2YJTD 4GOKA 1P7CA 1W46A 3VR1A 1PZNA 4TMXA 5CB6A 1S96A 4B2LA 2XOKA 1NKTA 5G3YA 4BWYA 1NG1A 4GP6A 1DAHA 2ZI4A 4OHZA 1ESMA 3TSZA 5KNDA 5GADl 1G8GA 3E2IA 4V0ME 3IQXA 2ZRNA 2YOFA 3IILA 1JR3A 4UQOA 5FR2A 1ZU5A 3H1TA 3F0TA 2BV3A 5HPYB 1XJ0A 4PZYA 3AGPA 1D6JA 5LD2C 5ELXA 4ZCIA 3C41J 4TMVA 2QPOA 1T4GA 2CE2X 2ZRKA 5J4YA 1XPUA 1A7JA 3WBJA 2IYXA 3NH9A 2ECKA 4CDGA 2PLFA 1EESA 3EZFA 2G83A 1KY2A 3SI7A 3ZZ0A 5CM8B 4AKGA 4M9SA 2I4IA 1IBRA 2QN6A 1JEDA 3DMDA 2D7DA 1LS6A 5B30A 2ZU0C 3AKYA 1MRNA 1FQKA 4MQBA 5FOUA 3X1ZA 2EFDB 3UMFA 5JRJA 4RJLA 1OH8A 2RGNA 2FOLA 4CT4B 5KTYA 4M9XA 3HWSA 3VNUA 3EZ6A 2DYKA 1K6MA 2G1KA 1VKJA 2WOJA 3CBQA 3AVVA 2WHXA 2WBLC 4A15A 1OHHA 1RC8A 4EPXA 3MLEA 1KAGA 3HP1A 3RSLA 5EE0A 2WSMA 3VR6A 3S1AA 2E87A 3GLFE 2D74A 3O8RA 2FPKA 3KJEA 3BOSA 4IKEA 4O2LA 1LVGA 4M53A 1TF5A 4HB0A 121PA 3TNFA 2VHQA 2WWGA 4JVLA 4AIIA 3W90A 1UKVY 5DGXA 1G4AE 2LKDA 2FG5A 3ZVNA 2ZRIA 4Q1EA 2CJWB 1BIFA 2NO1A 1M8PA 4CEJA 2IXGA 3QKSB 4DC9A 1F5NA 4LPSA 4CRWB 2SHKA 2GXQA 1Q1QA 3A4MA 5G3ZA 5KU1A 4QG7A 3GLIA 1E3MA 1EWRA 3LQQA 1AKYA 2C03A 3K70B 2B92A 1JB1A 2VHCA 3BAFA 3V00A 1QVAA 1TNDA 3I72A 4JT4A 4MITA 1IOZA 1FFHA 4RD6A 5SZIA 2ODWA 5CB8A 3W9YA 3AM1A 2JLWA 1KYIA 1P72A 4LJAA 1CEEA 1OJLA 1N2CE 3BH7A 3KQKA 2PEYA 4HDQB 2ZPTX 4JLVA 5DISB 2Q9CA 4Q66C 3V4FA 3R7WA 2OBNA 1SVIA 1D9XA 5HCIA 4KBFA 1X8LA 3HPRA 3ZS8A 1B23P 1E9DA 1F60A 3KZ1E 2X1VA 4OJQA 1XCGB 1TQ2A 3NC0C 421PA 4DCSA 5EE3A 4YDSA 4BEBA 3O8DA 3QXXA 4W7SA 1OXXK
chains in the Genus database with same CATH superfamily
4QATA 4IEFB 1RXYA 4OMDA 4RXTA 3MN1A 4B3DA 3NFRA 1QC5A 4K0KB 1IBSA 1N6RA 1TIPA 4BMCA 4HNTA 3OESA 4RHFA 4ND1A 3M3PA 1ZN7A 5FLYA 1NIJA 1XJ5A 3MCZA 2C4VA 1UFOA 3CUUA 2CFCA 3ETLA 3LJKA 3NANA 4FJ1A 1MO3A 1RLUA 1U1GA 1PSWA 4MUXA 1KJQA 1R4NB 4MOWA 3AR6A 4YACA 4N18A 3VH3A 4A8PA 1DTWB 4RW0A 5ELMA 2IV7A 1DAKA 1JLHA 3CR8A 2F67A 1KJYA 1I80A 5LBUA 2Z2KA 1U7UA 2GJAA 1YS9A 3TTSA 1UQTA 1UPXA 3DP7A 2B83A 5GAJA 1L4GA 2YWJA 5H1YA 1L5RA 1TD1A 3C2QA 3H4VA 3FSJX 2OUKA 1H8HD 2ZJ0A 4LQLA 4KPGA 2W2NA 1GEGA 2XVMA 2W6ID 1NMYA 1QZUA 1YZTA 4MV0A 1G6HA 4OQDA 2I22A 4WFJA 4EYGA 1XEWY 4QUHA 4DCGA 5L7WA 4F5EA 1K3UB 1NF8A 2PGXA 3IA2A 3PT9A 4TLBA 3L0OA 4EGSA 2ODNA 2VP2A 5I8ZA 1V39A 3MBKA 4AMZA 3FBWA 4OKNA 4BVAA 4NXNB 3L79A 4Q3EA 4RDXA 3HBJA 3W6ZA 3OLQA 3H97A 4Q7JB 1M6NA 3SEFA 3OIWA 1D0VA 1GUDA 1M34B 2FEMA 3AETA 1OB2A 4JYAB 4DB2A 5G0TA 4MGYR 4ZCTA 1VJGA 4FFDA 3U09A 1J0EA 2QG6A 1G7TA 2QMYA 4R1MA 4AAYA 4D81A 5KTPA 1Z2OX 1LX6A 1RYMA 2F1RA 5HMMA 1E2DA 2AMFA 4GL2A 2PMBA 4QQKA 4Q4DA 3VPBA 3NEPX 4B4WA 2MYNA 4PC3A 2HOQA 2IL1A 2WDZA 1NOKA 2O8CB 3D3WA 3H42B 1K7CA 2EQAA 4H1TA 2RCYA 4EUSA 4WZAE 1G8MA 1Y98A 3HJCA 4LRXA 4MNTA 4ARZB 2DR3A 3G0GA 1TA9A 4RO0A 3WMXA 1AQJA 3QE9Y 1P62B 4U02A 2ALJA 4JJEA 2WZBA 3WSWA 5CH5A 1Z0UA 1N7JA 3KQOA 5FA6A 2VHVA 1I1QB 2FN8A 2GPWA 3QG5A 4N7BA 4R68A 2ZUCA 5BSRA 3RBXA 4ZICA 1QO0A 1I5OA 4Y98A 4JYZA 3ICWA 4BEWA 1KOGA 1O58A 1PD0A 2G09A 3BJIC 3LLCA 4M1EA 4C0WA 5IKXA 4BE7B 2ZRPA 4ITUA 4CM6A 3IUMA 3IT3A 3OE7D 3B2EA 2BGNA 4FQ7A 4F2DA 2PUCA 1A04A 1BKDR 1OW3B 2Q50A 1NJ8A 1W29A 3LC1O 3RYHA 3H8WA 4KQGA 1BKYA 4HDNA 4QO7A 4KIUA 3H2IA 4A27A 2G76A 1O57A 1S89A 1W8DA 5AW4A 3F4BA 2RHGB 4Z0TA 1GLVA 1VB5A 4LQ4A 5U4XA 2FYTA 1YL5A 3EF3A 1HGXA 2JFWA 2XA2A 3PWSA 2B0CA 2FEXA 4P4SA 2Q1WA 4EJMA 2Q2VA 3Q8MA 4JLJA 5FHRA 4GE0A 4EFMA 1F3LA 1YO6A 1OXBB 1NXQA 1F0KA 1EDBA 1P6XA 3FYDA 4WUTA 1B26A 3N05A 1MB9A 3BM5A 3OT4A 1FYWA 2KYRA 1K06A 3O0TA 4HQKA 4QQFA 3S1SA 3P9CA 1W85A 4MUKA 2H3EA 2NP7A 4LZOA 1JEQA 3LY5A 4G1EB 5F23A 1PG0A 2V55B 3EXG1 1UFKA 2MIIA 4RHEA 2V7EA 3FKSA 5BN5B 2OLJA 1NJ1A 3UG6A 1VSUA 1J23A 5IBCA 3HUFA 3ZY2A 2GZMA 4J0IA 1I4DD 1YFZA 1SWVA 2V8BA 3A2NA 4F3YA 5B7PA 2AMLA 2EKQA 1U3TA 3RC9A 5HSGA 3GROA 3GOQA 1W44A 2GRAA 3EW7A 4YVFA 4CU5A 2E55A 5EEHA 4L75A 1IVYA 4OK6A 3OX4A 3OE5A 3IBGA 1T2FA 2QMUA 3H84A 1V71A 1WY5A 4GI1A 1N3IA 4GU5A 4JGGA 4K1LA 4NS1A 5BV7A 2NZ8A 2CL5A 4P80A 4WCFA 5FV4A 2ZUUA 1VZ3A 1VYVA 2FW7A 3Q5GA 3UA3A 2Q5OA 3VPAA 4B7ZA 5F2NA 1PYDA 5PGMA 3QYPA 1MCZA 2JDIA 3UCFA 4WDRA 3PQ8A 4I5EA 4N01A 4DTCA 1FTWA 5CNKA 1VM6A 1GUAA 4N7MA 2QE7D 4H7KA 1JJFA 2FHSA 4AECA 5FJIA 2GK7A 2IFTA 3PFWO 4F1KA 2CD7A 2IPLA 4ZCMA 3SX4A 3W8FA 2RAFA 3GRCA 1NOIA 2QW0X 1H3NA 2FFRA 1B8UA 1XCMA 2H7XA 4RH0A 4D3FA 5HQTA 2M6KA 5HJ2A 4B4KA 3BFPA 2CHFA 1BH6A 1V8DA 3WHIA 4X64B 3CUEF 4XJTA 5GOZA 1V16B 3L8EA 3OI7A 3P20A 4HS9A 5ED4A 3VZDA 4B33A 3W9UA 3I9NA 2HMYB 2WU3A 1JLKA 4BQSA 5FOVA 1UXGA 1XYVA 4PW0A 4Q5IA 4O2AB 1KKLA 4R7ZA 3HNPA 3MZ0A 1N1EA 3DBIA 1LSOA 4Q7KA 3NTVA 3PZBA 1CQXA 1DSSG 1RM3A 4QQ8A 4XB1A 3JRNA 1F51E 3UG7A 1FFCA 2DSNA 3CX3A 3QVUA 2RHBA 4JX9A 3FPBA 3RHFA 1UPAA 1U7XA 1LK0A 3ESAA 2V4MA 3BD7A 4QYXA 3N8KA 1YIOA 3LUJA 3DDWA 3TRFA 2IJGX 2RBKA 4K9KA 4Q93A 1EDZA 5IANA 3WMEA 4JP2A 5HBGA 3R6WA 1E63A 5EQJB 3KAPA 4EI8A 1A9RA 1UWCA 5EXEA 1NLUA 3OPMA 1KDVA 5EQDA 3GIWA 5AK6A 4M87A 3BGWA 3D0QA 3VO2A 1RRCA 5IJZA 2BJVA 3V8QA 3KRTA 1HNNA 2ASVA 3P2YA 4LRTB 3WJAA 4BTEA 2FFAA 4ZMRA 3LPCA 4A10A 4BDSA 1YA4A 2J85A 4QTYA 2HCBA 3K15A 2I71A 3PQ5A 3O2JA 4O4LB 5A0TA 1T4BA 1OE0A 1I2MA 1NJ2A 1Q0PA 1G8FA 1RACA 1HTWA 3BAZA 2RAVA 3QU2A 3JPYA 2W8ZA 2AJDA 4B7XA 2IU6A 2Q6KA 2V9CA 4PLWA 3X2SA 1EK5A 4RPIA 4ETMA 4QU9A 4AWXA 4EF4A 4ND5A 5KYUA 2UUOA 3USZA 3TUJC 4C14A 2WOOA 3KCQA 4QLBA 5K5EA 2J5BA 4EFDA 3CLUD 3TO5A 3KXPA 4CV3A 4N5NA 3Q3GE 3C1TA 3FOWA 1II0A 1MNQA 4BGIA 2QRZA 5FFFA 4DMFA 4G4SO 5CA1B 4HAVA 1FBTA 1UBMS 4QSMA 1PW5A 1W76A 3JQBC 4DJTA 1X7ZA 1ZD1A 3OIGA 4LCBA 1X7GA 1QK3A 1R0KA 2GK4A 2ZAIA 4L0DA 3HDHA 4M1ZA 3ZOZA 4OLAA 2YHIB 4LDRA 4N6NA 4GI5A 3FWPA 1KH1A 3THYA 2VYCA 3ZZMA 1YVDA 4GMHA 3AM4A 1XX6A 2R6AA 3GJYA 4LBVA 1F8YA 3NPMA 1NRWA 5DT9A 2NUAB 4Z4IA 1OAKA 2YJNA 2VZLA 4ALIA 3NORA 5HJEA 1HDIA 2RHLA 3ZHSA 3FOCA 3LGXA 1JDPA 3SZLA 3HFSA 5I47A 3QMMA 1CDZA 2FLVA 3UKDA 3MSCA 4DLYA 2LUOA 4O4HF 1D8TA 4MDYA 4KR6A 1KSGA 2DC1A 4DS3A 2VPWA 3A36A 5AVRA 4J0KA 3L7YA 1UP7A 4NCHA 3U13A 2CLCX 3C14C 3C8UA 5DBEX 4L95C 1EM6A 4WCVA 4TGLA 2GDJA 3O8QB 4BNHA 4D25A 1EDOA 1T9GR 1T9BA 4YO8A 5JO9A 1VZ2A 3LQKA 3EPRA 4RD2A 1QP8A 4OXXA 1UBKS 1QTNA 3LBHA 2E49A 2GJKA 2XT9A 4JLBA 4V38A 5BVGA 4F4HA 2FPSA 5DU2A 5AW3A 3AJAA 2PKXA 1TZBA 4XWYA 3AVUA 2OV8A 3NJ8A 1E1QD 3LOQA 3RLIA 4MQLA 4DXDA 4Y1FA 2WE7A 2MCFA 3W8EA 5DHSA 1LX7A 2XTMA 4NL4H 1PT8A 5DHFA 1XZMA 1SXJA 3PQCA 1KARA 5F1YA 1H5QA 3FMFA 1YAHA 3JTEA 1SG9A 3VYUB 4HQOA 2RGAA 1NVMB 2VWPA 4OMCA 2FWNA 4HH1A 4BZZA 1FDSA 3PHHA 4YJ3B 2JEOA 1XTZA 3NUZA 4GXTA 4RVCA 5F9MA 2XB9A 4BWGA 4KJXA 3TNDA 4CE6A 5JWOA 3QFSA 1HZJA 1YKGA 1Z2NX 2OHJA 1H0SA 1FJ2A 2J3MA 3EVFA 2YXPX 2J7PA 1AKTA 3HKCA 2HHJA 3QELB 2NX2A 4Q1CA 4UVGA 2BM9A 2QW8A 3DEKA 3PP8A 2YJ4A 3ZXXA 4BP3A 4N47A 1JAHA 3CF4G 4CF5A 4IJ6A 4CMIA 2UXDB 1R5OA 4PINA 1NZFA 1H85A 2GM9A 3FA2A 3ZZUA 4ZODA 1F2DA 4B4UA 2BFAA 1M1YE 4WN9B 2ZIXB 5H16A 3T9AA 4B3BA 3U0VA 4KP7A 3O1IC 5I7WA 4LQDA 5GMOA 2YC2C 5D5HA 1AKWA 2ZSJA 3GY0A 4RK0A 4M99A 5DW0A 1K6JA 1YFKA 1KZ6A 3WGLA 3QUSA 2AB0A 4OUDB 4E1AA 4XWAA 1KTVA 4OQLA 2V4UA 5CNIA 4OBWA 5DHRA 3R3VA 1WW3A 2JLBA 4JJIA 4Y6QA 1KZGB 2W70A 3D1JA 2UU9B 1UM8A 1CTQA 3V48A 3ZIAA 2EZUA 3D6AA 1VSBA 2XMDA 4C07A 3G7NA 2YZMA 4EHNA 3R9XA 3H8VA 3CSUA 3OPYA 4MR9B 3CWZA 4BJ5A 3RYCB 2IY7A 3FTQA 3M6MD 2FMFA 2WU8A 3L0SA 4POAA 5FBRB 1DAGA 1WLSA 1I4OA 4K6FA 3C87A 4JP1A 4JOCA 1K8XB 1W6RA 1A69A 2BEVB 1I51A 2P9EA 5CUQA 3RRXA 2FXVA 2QVYX 4K40A 4BVLA 5K0ZA 5DTIA 1QO7A 1ML4A 2EKBA 1Y5RA 3IQDB 4GGMX 4TKLA 4U9UA 4J29A 3JZFA 3O82A 4KO8A 4B3IA 4XYMA 1KHTA 1E9BA 4D8YA 2DT8A 2FCAA 5DEIA 4L9WA 1NSFA 1E79D 3P71T 1G2OA 3PIRA 3L4BC 4HVAA 1X1CA 2V7TA 5CH3A 3LXRA 5TMDA 3S28A 2PRZA 4MYDA 3PUZA 4CKBA 2XMZA 3M4XA 1C7IA 4I4TF 3G9UA 1YSCA 3M83A 4BO4A 1ESNA 3DZBA 1N5RA 1XEXB 3T1TA 4I99A 3LPAA 2C61A 5BO5A 1IJKA 5EHGA 2WSIA 3UC5A 3ER8A 4PCUA 3PDIA 1B8PA 1VJDA 2YXEA 3BRWA 3QH4A 3UAZA 3GFGA 3F6CA 3V6LA 1PWXA 2VAMA 4R2IA 4TT8A 4CEIA 2MSKA 4CW7A 4X7PA 1YBAA 1LWNA 2CHVA 1P6UA 2JGNA 1KKMA 2RH4A 1PS0A 3I34X 1QK5A 2OO7A 3U4IA 4NMWA 4EKDA 3AFHA 3DCNA 2A1TR 3THXA 3SBEA 2ZZKA 1FFSA 3WGNA 3IMKA 1QG2A 1DUSA 1EINA 4W63A 4RD1A 2LKCA 4H77A 2ONJA 4EMBA 1W94A 4RK4A 3UJ8A 2V74B 2XH8A 2B2CA 1WETA 2OV4A 3PWKA 2BFCA 3C5VA 4RPGA 3PFBA 5F1PA 2K7FA 2NTVA 1FYDA 3IMFA 3K0FB 1OLXB 4ZU6X 1PJTA 2I55A 2NU8A 3TW0A 4AYWA 1RVV1 1XLTC 2IK8A 3EQ2A 3EIHA 4J8PA 2YKGA 5CYPA 2D6FA 3NXSA 4Q1FA 2UDPA 1HQKA 5E7IA 1NC3A 2XHZA 4NKRA 3O8OB 3OLCX 4CZ2A 3SBOA 1JHQA 2AKYA 3X1WA 3D5QA 3PIDA 1FU7A 5CMLA 3DBOB 3X43A 3EPHA 1AGYA 4R2KA 3EJ6A 3TIXB 4BQNA 4XDYA 2NV2B 3NTXA 3ANMA 5BWOA 5BW4A 4A9AA 3GLHA 4HUJA 1QIIA 3DMGA 2C1ZA 2WAOA 2AOXA 4W8OA 1JQ5A 2ZJAA 4EJFA 3PPXA 3M49A 4FD3A 3TW6A 5JSZA 3LFUA 1U3CA 4ZOAA 4WFQA 1NMEA 4R1OA 4C6TA 3GT7A 3AHCA 3B89A 4QXMA 3QF7A 4RU1A 4XR9A 4AO8A 4YXWD 2CNBA 2JBAB 4MARA 4S35A 4WZAB 3TOZA 4EMTA 1ILEA 1M5UA 5E8RA 4C76A 1U8TA 4HDKB 3RS2A 2GEKA 3UAYA 1QP7A 2ZSFA 3BWXA 4TV8F 1OA0A 1NFFA 2O8FA 1U0TA 5KNDH 3K20A 1M2VA 3CTPA 2R1TB 3ORQA 5CFOA 3VAYA 4EHBA 1TEZA 3B52X 5G1OA 3DQZA 4HYYA 5FQNA 2Z8XA 5AHOA 4P0QB 2Q7XA 3FNEA 3KPJA 4V3CA 3FVRA 1SPXA 3TTUA 2YOHA 5AVUA 4RUKA 1SUCA 4GYJA 1BFDA 5AK3A 4YUVA 3KT3A 2H2GA 2MSEB 3NDIA 2WLTA 3ICOA 5IAGA 5D86A 2WUDA 1FVFA 2C5AA 4J76A 3O92A 2UAGA 4X93A 1EBFA 2NTJA 3AF1A 4EQ6B 4GW3A 1I2AA 4D8VA 5K4AA 2JAHA 1JSZA 3RB8A 4BNGA 1KH3A 4H0NA 1VJ5A 5EJ9A 1U7ZA 4F2WA 4QUDA 4D6PA 2NMVA 1NNUA 2R8RA 3JD0A 5FYDA 1XHLA 5HKLA 1KNXA 3B3FA 2NVBA 2HU7A 3ANTA 3SS9X 4DQUA 2F3PA 1DARA 4EMSA 1X1AA 5B58T 3Q0TA 5TE9A 1UIMA 3BF7A 1KFEB 3PVCA 5A1JA 4KVGA 3GYBA 5GJBA 1RYNA 5B6JA 1MA0A 2QRNA 2PSFA 3BHMA 2A3RA 1TF7A 1JEYA 3LCVB 4E13A 1L4MA 4MV4A 3SVLA 1QF9A 4M22A 3CLHA 3Q12A 5DX8A 1VKOA 4C0BA 4R8MA 3RU7A 1KDYA 1AH2A 2GBPA 1K6IA 2QUBA 3LUDA 3MTJA 5T41A 1YFLA 2PMDA 3VDXA 3QOWA 5FPQA 2J5QA 2WY2D 3SP1A 4F84A 5IJ0B 4W1PA 3JQ7B 1FNBA 1SCKA 1RD4A 1VE3A 1ZK0A 2E9SA 5K3EA 2FUKA 3ZCTA 4CDMA 3FGNA 4LXTA 2IDKA 5AKLA 2NO9A 2CMHA 1TTHA 4ZZ0A 3HRHA 4PYMA 5KOJA 4Q3OA 3AM5A 3T3MB 5LQCA 4PRLA 2JJ2A 1SO8A 4JLKA 2XV1A 4YMWA 1FXSA 1YU9A 5E0OA 4ECEA 2D0IA 2GOYA 4UMFA 1SOMA 3KKEA 4KQ6A 5THQA 3ZWNA 5JS2A 1UDAA 4DCNA 2LCFA 2QN7A 1B8VA 2WU1A 1KEPA 5B4UA 4KQFA 3ZGNA 1NQAO 2CHGA 4MKXA 3TJMA 4I3FA 3OBBA 2XQGA 5FO0A 2G6BA 3FRJA 2C9CA 4YIKA 5JDIA 3U39A 1VPLA 2BFDB 2DWCA 2ZI9A 3Q7TA 4GRDA 4LG1A 4ZO9A 3L0PA 1PLJA 1JHUA 2PIAA 5CVTA 1A9XA 5DIZA 1QU2A 2QR2A 1CIPA 2QT0A 4WNYA 4F6RA 1TKCA 2V7QA 3FSRA 2JH3A 4M7PA 4JY7A 1S2NA 2UZ1A 1WEKA 5ALLA 1GITA 2ZYUX 3FROA 4KE6A 3TTXA 4D44A 3GUYA 3GUVA 1PR4A 3MGBA 4KHPB 3KV3O 4HNUA 5IAOA 2VA9A 3DBRA 1XA0A 1LDEA 4I50F 4LYEA 4G0MA 4KIGA 3ZOKA 1KO1A 5P21A 4UBOA 2H4JA 1DQZA 4TKVA 5KTSA 1CWUA 2C78A 3B2NA 5EIBD 3K5PA 5ALOA 4WOBA 4BRSA 4JUFA 1X80A 4DRYA 4EG4A 4YI5A 5JSYA 5BSFA 2ZRHA 1JI0A 3U7GA 4UBLA 1Z6YA 2BEWB 4YV2A 3OX1A 3SZUA 4U8GA 1E7QA 1LU9A 1P17A 1QIFA 3KWMA 1AN0A 4DR3B 3QIVA 4E5VA 1ZNWA 3RFTA 1RXEA 2I2WA 1J2TA 4J0EA 1QFZA 2OXRA 4BU1A 1J39A 4HTAA 2D2FA 4W1QA 1NJ6A 1P0IA 1O96A 1C4KA 4L4YA 4MRPA 4Y7DA 1X42A 5ALKA 2MMGA 2DPYA 1N75A 4MS1B 4C7OA 4H7JA 1Z4LA 2NZWA 3CISA 1EWQA 5JZOA 1UQUA 2NAFA 4QUGA 5E6SA 1QVVA 4JOBA 3FB1A 1U2GC 5CIWA 3U4AA 1NMQA 2IYZA 1E1CB 4RF3A 4Q4CA 1Z0DA 4B6GA 4JAVC 5BSMA 3BXOA 4E2WA 5ALYA 1H6BA 2Z8ZA 3A37A 3PV0A 5L6MB 3IBCA 3HJHA 1FEZA 3UAGA 3V2UA 5IN4A 2J0SA 4DMUB 3HP4A 2JLQA 5FUXA 1PO7A 5FWDA 3T15A 1TJNA 3WGTA 2FZKA 1SHJA 4KAAA 1QR6A 1YCFA 3I9V1 2R6FA 3H2HA 3H9BA 1LBIA 4FOTA 1Q12A 3N59A 4RA9A 1PJ2A 3SDBA 2BE9A 3TSCA 1E2PA 3U4QA 2QF7A 1XVTA 5C5CA 3TCXB 2I80A 1LB1B 1P8JA 5A62A 3PTAA 4W8GA 1PAUA 3EIEA 4HNQA 3EMVA 1XD8A 2BEJA 4OGLA 3ICEA 5DLDA 3IHKA 3ITKA 2EP8A 1QP0A 5EGSA 1MAUA 5HBRA 4I19A 3DEIA 4ZTUB 1IE3A 4OJTA 5AJZA 2F7SA 1GPH1 5I3ZA 5CEEA 1NVVQ 2JA2A 3CNBA 3GC6A 5MFZA 1CJVC 1L8AA 3LYLA 5FNVF 1GTG1 3HB0A 4Z1MA 4MICA 3VSCA 3N8GA 4EDHA 2ZT8A 5A4FS 3WMWA 3ZHYA 4E03A 2CKDA 2R1VA 3BZUA 3OAAD 4PXSA 4RD4A 2CYCA 1SKBA 3HKBB 3L8ZA 4FT4A 1IWBB 3IO3A 2EBHX 3R9IA 4O08A 1TLFA 4AG3A 4RETA 4GOXA 1QGYA 3L9XA 2CMDA 4X00A 3DVAB 4IQGA 3CO5A 4IUBS 4EH1A 1MIHA 3F7NA 2EBWA 2GVDC 3C4VA 1GKYA 3RANA 1IVNA 3FY4A 3BSSA 4ZOQI 4WH0A 3DLBA 2DUJA 4RSRA 3UWDA 2H4WA 2G25A 4YK7A 1BTOA 1CZKA 4UE3S 3BWDD 4TWRA 4I9FA 1EZ4A 3GEEA 3LLUA 1U2ZA 1I3CA 4DHEA 1RRPA 3C43A 2EYQA 3GJ6A 1A71A 2GEJA 4XCXA 4BTLA 3E0XA 4DWOA 4B34A 4US2R 2OFFA 3FR7A 2XGSA 3T5MA 2H0RA 5AXDA 3K6JA 4EFKA 5BUZA 3B6KA 3ZDFA 5AVOA 1DCKA 2HNBA 1YR9A 2HPVA 3O4HA 2V3WA 2VPZA 4DLNA 2LWIA 2SKDA 5C7LO 3H2SA 3KLBA 3SICE 3KVVA 1T8PA 4M3NA 2AOWA 4MRNA 4YJ2A 2XDQA 2ZATA 4YJKA 3SF0A 4HLDA 5DXJA 4DSZA 4FHCA 3RWBA 2DY1A 2CE7A 3O6VA 1EA5A 3AUSA 1JLLB 3NBAA 4N3GA 2YQ5A 2FUG6 2I2CA 4FILA 4V03A 1OSNA 2LD4A 3DTVB 3ZHXA 1CZRA 1G5QA 1N6NA 3P0FA 3QNWA 4KR0A 2A1UB 5A6VA 1QAMA 3F8WA 4ETWA 5TF0A 1EU1A 1BE1A 4HC4A 3UANA 2W58A 3H5WA 2QLLA 2C5FA 2PL9A 4PC2A 2PKWA 4BCCA 5FLKA 4EG5A 5JNSA 3FE2A 2PL1A 3R7LA 4PGHA 1SXIA 3BXHA 1JTVA 3VUEA 4NZZA 2FUCA 4UBKA 2RCNA 1PWEA 3I2IA 4DBZA 1IXZA 4W1SA 1TGVA 2CHEA 2FEOA 4QDKA 1CF9A 4HAWA 7MHTA 4ZC1A 3L06A 4F3NA 4P0TA 2HQOA 3MILA 5C1DA 2WZQA 2ZTUA 3C3KA 3MWJA 3JASA 2OMEA 3OHMA 5EEGA 5JSQA 4PHFA 3K8ZA 5FTJA 2J9XB 2GI4A 3OJCA 1AY0A 2A0YA 2GARA 2H4ZA 4NCKA 1EGHA 2ADOA 4ZRNA 2MJLA 1R8YA 1RW4A 4FCTA 5FPTA 4ALJA 2FPGB 4R98A 3WNBA 3WLKX 5IUJC 3M3HA 2YVLA 5FTLA 4GZMA 4A0FA 2ICAA 1SPBS 2Q0QA 2B7BA 4V0NA 4YS6A 2NUTA 3ICQB 4G0VA 5CB4B 4QBGB 3KKZA 4P82A 5JMOA 1LRKA 3NPAA 2C7QA 3IA7A 3RFCA 1FSSA 1IONA 2G9NA 5EN4A 5JS6A 3O4IA 2B0JA 3OC0A 2FP3A 2CLMB 3I1IA 1R0BA 1UIRA 2VPPA 3AK4A 3IIKA 4NZMA 4RVSA 4FJ0A 3AI2A 2GA9A 4J4TA 4C0XA 4A0RA 1EG2A 4EJSA 5K2OA 3T52A 1TD9A 3M0EA 2N3ZA 3EC2A 4AMGA 1ANKA 1CY0A 2AUNA 1GN9A 1QAQA 2C92A 2JANA 3O93A 3RS0A 3RVQA 1C7FA 3GIDA 3H5LA 4RGYA 1OFHA 3RIYA 5ESXA 5CXXA 3MF4A 1IJEA 4BNZA 3C3XA 2ZUTA 3EMDA 3GRFA 1S5PA 1EBUA 1LZLA 4ND2A 2V5UA 4UFOA 2QRVA 3CRNA 2AHRA 4EX7A 3ZXIA 3MT8A 1GL9B 4TVBA 2J48A 1HLPA 1O9BA 3K09C 3LX8A 1LBTA 3QWBA 4FFSA 3X2EA 4U6SA 3ZH9B 1PZMA 1ZMBA 2RKOA 4LYGA 4UHJA 5FI1B 2JI4A 3WRWA 3SYNA 2Y1EA 5EKSA 4A73A 2X2FA 3KDPA 2XSZD 4YQZA 3NALA 1AURA 1QCDA 4JXXA 3ESDA 1ZD4A 2KE5A 1PJQA 1AUQA 1M1ZA 1L7MA 2X8JB 4XVUA 4Q4JA 1JZQA 3IKLA 4A6PA 4AY2A 1W6UA 4WZBB 2GDZA 2O0KA 1PJCA 1GQOA 1L4UA 4IV0A 2AFHA 3AI7A 3CNHA 2LGJA 3F96A 4BPRA 3KYCA 4GRIA 1JSRA 2PZLA 1CUXA 4TYMA 2OM2A 3NWJA 4TWAA 4XYLA 4KX3A 4OAPA 3QK7A 4LZNA 4O2BB 1DLIA 1H94A 4UD6A 3GVCA 4IS2A 5LYJA 5DEOA 2CZGA 2CMKA 2W2TA 2X76A 4YONB 4MK4A 2PUJA 3GEPA 5TT1A 4CG0A 3UJHA 3K6KA 4AL4A 4F38A 2DGDA 4MGZR 4HLCA 1ADFA 1RKXA 3RSSA 621PA 2PMEA 3ZDQA 1SVUA 2C5GA 4M1SA 4BAZA 2QUHA 2OD9A 4AI6A 1E5DA 1Q14A 1TT7A 3EN0A 1HLFA 3L46A 5G40A 1FW6A 1ZIXA 2IU3A 4BNXA 6PFKA 4XSHA 2EKDA 2AR0A 2HSZA 1LF0A 2PKYX 3DAHA 1R6TA 4BVJA 5A3JA 5I51A 2IZ7A 3H2BA 4IOKA 3BWVA 4EGCB 2GLUA 2WF8A 3WYGA 1XCBA 2P6NA 3LUGA 1R0RE 4AP5A 4KNVA 1ZISA 1MXHA 1T2DA 4GI3A 3GUCA 4H15A 1QGOA 2YMMA 3A28A 3SHFA 2PGAA 3RVPA 2JHGA 3B6MA 4LV8B 2XUPA 3N70A 4G65A 4G8DA 4QX6A 5E1OA 5ADVA 2AQKA 1DOAA 5JZVA 3RUPA 2OPBA 1Y37A 1NF3A 5EKTA 3UGQA 2J5XA 4BFUA 1YZYA 4L6AA 1YQGA 2RC6A 3OPVA 3CX4A 3FMPB 2AMJA 3RTEA 4Z54A 2I6QA 4U9IS 5J5VA 1RQ2A 3A9VA 1SOAA 2WLSA 3TR0A 4OHKA 2HA4A 1HLDA 1VFNA 1HA3A 4M7WA 2NU9B 3DR5A 3BVPA 3JQRA 4AP6A 1EIZA 2ZKIA 4RVGA 4I5IA 3Q3IA 1K5HA 3EGOA 1CJKC 3U4CA 3QEMA 1ODIA 4FM9A 4PQFA 4L9SA 1SAYA 4OJMX 1RHUA 3GFQA 1OYOA 1Z0AA 3ABZA 3JRWA 2DETA 1BMQA 1VI5A 1NX9A 2PZBA 2OLKA 3NETA 3NU1A 1JSXA 1K08A 4P92A 4WXHA 5F77A 2REXB 3CMCO 4J7UA 4JYCA 4KKVA 3WIBA 1U2SA 1E3EA 4R7TA 1G60A 4BB9A 3F5FA 2OYCA 2BUAA 4FW8A 2JGFA 1YHNA 3NTQA 4QUJA 5E9WA 1YZNA 5EZSA 2JVKA 4MQ4A 5FOXA 4Z7OB 4WXYB 1BVYF 1RLIA 4HDMB 3O94A 2IEBA 3MUOA 1OI2A 4IUCS 3GQVA 4YY3B 4YUXA 1ORTA 2WKSA 1ZXBA 2FUEA 2GZAA 3L04A 4PBSA 1QGUA 3DM9B 4BBAA 1EVLA 3NAMA 3NWPA 2FY8A 4JT2A 2OO5A 4U7TB 2OV2A 3HHEA 2FNAA 1SHTX 3E3OA 2Z5GA 2QL7A 3G6WA 4Y67A 3SHQA 5INTA 3R77A 3LS2A 2ZB7A 2HREA 2J9RA 2N75A 2OXEA 4I1RA 4J7AA 4AYTA 1D2GA 5IARA 4RKYA 1FFYA 4RPKA 821PA 5M2QA 3TX2A 3OZ7A 2CC2A 2WG2A 1CE8B 3STYA 1IDOA 3RK1A 1IPHA 3AZOA 1YB4A 1EXMA 4ZO6A 3ABQB 5JMPA 4YT5A 1DEKA 4X62B 3ANXA 1UMCB 1WCV1 2OBYA 3DXYA 5KNCA 1RPTA 3KJGA 1F2UA 1Y7IA 2OV1A 4DIKA 4L1KA 1T91A 2WJJA 3NHWA 5I9IA 2CDNA 2I78A 3GRYA 1KBOA 5DLPA 2ZM5A 2BFBA 4Q9AA 3B6IA 4UVIA 4AKEA 1LFDB 4YJDA 2P0YA 1VIDA 1WTCA 4RDHA 1XQ6A 4Z6KA 1US8B 3KQYA 5BV2P 4URZR 3GLIE 3GBVA 1VOTA 2AXNA 4BKRA 1B74A 3GLRA 4LOLA 3QUQA 4U7JA 2EL7A 5REQB 5EJ5A 1RYHA 5IT4A 1PSDA 1TUIA 4FHFA 1AXGA 1G8HA 2Z1NA 1E61A 2HRBA 221PA 3A14A 1NA5A 4TL7A 1DQPA 2QVXX 1SU4A 4QPDA 4AURA 2JLUA 2R00C 3LQFA 1XTJA 3NG1A 1MVLA 1CUEA 2BMWA 2NXCA 1BNCA 2VCEA 2PMWB 4Y2XA 2PDAA 2JLCA 1P2FA 3OCZA 5CX1B 3RVSA 2ZIFA 4HB2A 3ZVLA 4YV1A 5EIOA 2X14A 3HCAA 3MOGA 2H1LA 2YY5A 2EVWX 3BFVA 3RVDA 1HSOA 3VM6A 4NMLA 1AF7A 2EYUA 3PENA 2FRDA 2ENWA 5ELLA 2UXCB 3QPWA 3FNRA 2YW2A 1SK8A 1HZZC 5FIUA 3BGDA 1KY3A 4UAGA 4EUNA 1FVXA 2H48A 5JJBA 3GLFB 3GNSA 2ZTHA 3LXXA 4IWNA 8OHMA 1BEUB 3KEOA 1ECPA 4IG4A 2EZTA 1DC8A 2B21A 4ISBA 2C8KA 3HH8A 3MT9A 1XDSA 4JBGA 4JFRA 4R2HA 1UZLA 3EXEB 3I64A 3ZDDA 3OQ1A 4GSYA 3FMIA 4UM8B 4CM8B 2I7DA 2JFHA 1OZAA 1AHNA 5IAJA 5IP5A 2P9QA 4DANA 1E9FA 5LA6A 4C30A 4J7CA 3CONA 3HVJA 3GHYA 5BRAA 3MTBA 1CVLA 4K05A 5IC5A 3ZLUA 1THGA 3OSUA 4AKHA 2JBWA 4MW5A 4BX2A 4D1YA 1FK8A 4Y6SA 1ZH8A 3QUTA 4KFTA 1GRNA 3V2HA 5E7JA 3OD5A 3MWEA 4D7AA 3EZXA 4DZTA 3AL0C 3EUWA 4HRYA 3ZHQA 2CXXA 2IXTA 2R1UA 3ASUA 3R23A 1U3FA 5G1PA 3G13A 1S6YA 5AW2A 4LI0A 5A71A 3SHOA 3VO9A 5JLAA 1IJBA 2WFMA 3DO6A 2QU8A 2XKJE 3NZEA 4MRMA 2R62A 3HBAA 5C5EA 4A6DA 5K6AC 3BGIA 2CYBA 4E2XA 3LYUA 3QMVA 2WWIA 1G63A 1X3LA 3P9NA 5NULA 2R2AA 3WA6A 2WIFA 4F2PA 1G3MA 1EHYA 3MGAA 1GRRA 2GBGA 3QX9A 2RGYA 4LSWA 1AK1A 3ETJA 4JXKA 3TLAA 4MO2A 1IBLB 3MYYA 4IDAA 2IYPA 3HCRA 1X2EA 5TQ2A 1T0UA 5C35A 3VV2A 3KTFA 3R9KA 3WSVA 3MHPA 3NR2A 2CGEA 1Z4JA 4M0DA 4OEHA 3MJFA 1JBQA 3IAM1 1APBA 3QU7A 4A8JC 3F1KA 3U80A 3PD0A 4I6EA 4DLXA 4G8BA 4HV4A 2A7QA 4RS4A 1PTJA 1B0PA 1XZPA 2QUKA 1P4RA 2A92A 1DU4A 4JJKA 3GFVA 4ND8A 4PZZA 3RE1A 3N28A 3R5KA 1RRGA 1Q92A 2ZYAA 5CVJA 4E4YA 1ORDA 2BBTA 3K35A 2VYVD 5A05A 3CUWA 2EARA 4ZYTA 2X9QA 3BBLA 4B09A 4FHDA 2QSJA 3DUFA 3P4XA 3K9BA 4CN9A 5IWCA 2C9BA 1KR2A 2W22A 3WFZA 3ABSB 4Q34A 1GQFA 3NGLA 5F7OA 3D7LA 2GKSA 4ABYA 4D3XA 3EQ9A 5LLDA 4O2AF 3UPUA 3UFBA 5A6SA 5FYQA 4N0DA 1VCNA 4XX0A 2AJLI 4UE2A 5DNEA 5FWXA 4DLBA 1KQFA 1TYCA 2IOYA 3DAPA 1ABFA 1HDGO 1IEQA 2Z2XA 2DUMA 2I6TA 2PS0A 4KRXA 4MV7A 1DP4A 1E5VA 3FW1A 5TVGA 1X92A 5H80A 3TPCA 3BZWA 1GCUA 3OFJA 3BMNB 1N77A 3H05A 2O06A 4FE3A 3IP6A 3EB9A 1YR7A 5AVJA 1AUOA 3I58A 3FJYA 5FNZA 3UVEA 3FFWA 1IK6A 2C97A 1GRQA 1PI3A 3AYZB 1V9CA 4ASUA 5CXUA 3Q5DA 5SZHB 2WF6A 1SBTA 1IEWA 3TECE 4JOSA 4LXUA 2WPNA 2ZE7A 1OH5A 1KI2A 1GNVA 3N0XA 5JY1A 2H18A 5L3SA 1EJ6A 5EZ6B 5BYAA 1YUNA 4HMQA 3AY7A 4Q21A 1FS4A 2VCYA 4I6JA 5DIFA 4XH9B 3GO4A 1YQDA 2CNLA 4YAFA 4KPUB 1MQSA 4O4LF 1H1LB 1B8OA 4AZ3B 3G1TA 3WGZA 1TJYA 3HBMA 1OI3A 3KEQA 1JIUA 2XTZA 4N41A 4Y1RB 4OYHA 1XZCA 3COYA 3KEFA 1L3CA 2PT5A 3AVQA 5FWYB 4DG5A 4DYDA 3T3NA 3OCWA 1E7MA 3ORSA 3PDWA 3MM4A 1NURA 1CY1A 2DQZA 1JHYA 3QV1A 3VPSA 4MGKR 2ZCJA 1BCRB 4X9XA 4EBFA 4IIFA 1NVUQ 3TR6A 3DG9A 5CVEA 5CA1F 5JJIA 2Z6AA 3QTLA 3KSZO 3RUDA 2ZCVA 2BPOA 2IIPA 3G49A 4K6HA 3WWCA 2B61A 1C3OB 2HNAA 2P8SA 2QM3A 3HWWA 5TRTA 4BO1A 3RIGA 2HWUA 1MC5A 4L15A 2DSTA 3GR6A 3N2YA 5E4TA 4TLDA 2DQ4A 2OOSA 1EX7A 3B48A 2DVMA 4MVYA 4Q9JA 2I1QA 3V1KA 2D3WA 1RFGE 2F8SA 3JD3A 1WXWA 4DIOA 4K46A 2Z58A 1J8QA 2PGNA