1W39A

Crystal structure of an artificial top component of turnip yellow mosaic virus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
180
structure length
169
Chain Sequence
QDRTVTSPLTIKQPFQSEVLFAGTKDAEASLTIANIDSVSTLTTFYRHASLESLWVTIHPTLQAPTFPTTVGVCWVPAQSPVTPAQITKTYGGQIFCIGGAIQTLSPLIVKCPLEMMQPRVKDSIQYLDSPKLLISITAQPTAPPASTCIITVSGTLSMHSPLITDTST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TURNIP YELLOW MOSAIC VIRUS EMPTY CAPSID
publication title Crystal Structure of an Empty Capsid of Turnip Yellow Mosaic Virus.
pubmed doi rcsb
molecule tags Virus
total genus 26
structure length 169
sequence length 180
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00983 Tymo_coat Tymovirus coat protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1w39A00
3ZFEC 2WWSA 2BFUS 2BFUL 1RUE2 4CEWC 1NCQC 1OOPC 1R091 1VBA1 1VRH3 1ZBA2 4GMP3 1NOVA 4JGYA 1NA1B 1BMV2 1AYM1 3J8F2 4IV3A 2HWF1 1V9U3 1X36A 5BNNC 2PLV3 5DDJ1 3VBOC 4CDWB 4RQPB 1D4M2 5ACA3 1ZBE3 1BEV2 2R061 1ASJ2 1VB2A 1MQTA 1C8M2 1RUF1 3VBFA 1QJY1 3JD73 1AL23 3JBG3 2RS32 1EAH1 2X5IA 2BUKA 1FPN3 4QPIA 2RS13 1TME2 4RR3B 2RS51 5C8CC 1R092 1VBA2 5BNPB 4NWWA 1R1A3 3VBUA 4QPGA 5DDJ2 4YVWB 3LOBA 1AR91 4N53B 1TMF1 1OOPB 1H8TC 4Y5Z0 2RR13 1EAH2 1NCRA 4JGYB 1RMU3 1Z7S2 5C4WA 4IV3B 2WFF2 3TN91 2HWE1 4RHV1 1RUI1 1AUYA 1RUJ3 4N43A 1RUC3 2HWC1 2R071 3VBFB 2WS92 1R081 1ND3A 1QJU3 1AR72 1C8NA 1VAKA 1FMD2 1AR62 1FPN2 1VBD3 2X5IB 2ZTNA 5D8AA 1FOD1 1NG0A 1VB4A 2R043 4Y4YA 1AL0G 1QJX1 4QPIB 3VBRC 1RUD3 3M8LA 1PIV1 1RVF1 1NA1A 4RS5C 4FTSA 4FTEA 3VBHA 4RFT0 5CFCA 1VBC2 2HWE2 4PDWA 1PO13 4RHV2 3VBUB 4QPGB 1RUI2 2GH8A 1OPOA 2RM21 1H8TB 4Q4V3 1PO23 2HWC2 2R072 4CDUC 1B35C 1R082 2VQ0A 4FTBA 1NY72 3ZXAC 1ZBA1 4GB33 1BMV1 1HRI3 1FOD2 1VBE1 4RR3A 1HRV2 4GH4C 1PVC3 5C4WB 1A6CA 1D4M1 1HX6A 1PIV2 1ASJ1 2XBO3 1RVF2 2DF7A 4Q4Y2 4Q4W1 4N43B 3ZFEA 4AEDC 1E57A 3VBSC 2GSYA 2RS31 1ND3B 4CEWA 1NCQA 1HXS3 1RUG2 2RM22 1OOPA 2FZ1A 1EV11 3VBRB 5D8AB 1TME1 4WM8C 1POV0 1AR83 5BNNA 3VBOA 1VBE2 3VBHB 5CFCB 5K0UC 1AYM3 4PDWB 2HWF3 2WZR2 4CEYC 1RUH2 1COV3 2HWB3 4EJRA 4Q4W2 4CDXC 1MEC3 2R063 1VRH1 1F2NA 1RUF3 1QJY3 4GMP1 1RHI3 2RMU3 2HWD2 5ABJC 1V9U1 1EV12 5C8CA 5ACA1 1Z7S1 2WFF1 3JB8A 3VDDC 1ZBE1 2BPA2 2WLPA 2RS53 3JD71 1AL21 1HQNA 3HAGA 3JBG1 4JGZC 4SBVA 1QQP3 4AEDB 1ND2C 2WS91 3ZFEB 1AR71 1FMD1 1AR61 1H8TA 1FPN1 4CEWB 1NCQB 2RS11 1AR93 5C9AC 1SMVA 1TMF3 1BBT3 1VRH2 1RB8G 1VBB3 1GFF2 5BNNB 1V9U2 1R1A1 2PLV2 3VBOB 4Q4X3 1VBC1 5A32A 5ACA2 1ZBE2 1QJZA 1POV3 1X33A 3TN93 5L7OC 4CDXB 5FMOS 3JD72 1AL22 5FMOL 1DDLA 3JBG2 4LLFA 2RR11 5AC93 2MEV3 1NY71 1PGL1 1RMU1 4YVSC 2RS12 3VBRA 5A33A 4WM7C 1HRV1 5C8CB 4RS5A 5CFDC 4JGZB 1QJX3 1K5MC 2IZWA 1R1A2 4Q4Y1 5J96B 1QJU1 3DPRC 3ZFGC 3NAPC 5JZGC 2FZ2A 4CDUA 1RUG1 1AYN3 1B35A 1RUD1 2RR12 4CDQC 1RUE3 4IV1C 4NWVA 4GH4A 1PGL2 1RMU2 1PO11 1ZBA3 5A32B 3J8F3 1RUJ2 2WZR1 1RUH1 1RUC2 2ZAHA 3ZFFA 4AEDA 1D4M3 4RQPC 3VBSA 1BEV3 4BCUA 1QJU2 1ASJ3 1C8M3 3ZFFC 5J98B 1VBD2 1HRI1 2HWD1 2R042 4WM8A 2RS33 1PVC1 2TBVA 5A33B 1RUD2 4RS5B 1TME3 5K0UA 4FSJA 3CJIA 1R093 1VBA3 1PO12 5BNOA 4CEYA 3ZFGB 3CJIC 4Q4V2 4CDXA 5BNOC 1PO22 5DDJ3 4YVWC 4CDUB 1B35B 4N53C 4CDQB 4IV1B 1AR81 5ABJA 4GB32 1HRI2 3VDDA 4GH4B 2PLV1 1EAH3 1PVC2 3S6PA 2XBO2 4JGZA 1COV1 4JGYC 1Z7S3 1ND2A 2HWB1 2WFF3 4IV3C 1MEC1 3ZFFB 3VBSB 1RHI1 5LK7B 1M06G 2RMU1 5C9AA 1HXS2 1MQTC 3VBFC 2WS93 1AR73 4WM8B 1FMD3 1AR63 2X5IC 1AR82 2ZZQA 1QQP1 4QPIC 5K0UB 3IDEA 3CJIB 1AYM2 5L7OA 2HWF2 5BNOB 4CEYB 1CJDA 1COV2 1VBC3 2HWB2 2HWE3 4RHV3 1MEC2 2R062 3VBUC 4QPGC 1BBT1 1RUI3 1RUF2 1VBB1 1QJY2 1RHI2 4YVSA 2RMU2 5ABJB 4WM7A 2HWC3 2R073 4Q4X1 1R083 3VDDB 5CFDA 5GKAC 1POV1 1K5MA 1NCRC 1FOD3 2RS52 1HRV3 1RUJ1 3DPRA 1RUC1 1QQP2 3JB4C 1ND2B 5C4WC 5AC91 1PIV3 2MEV1 3NAPA 3ZFGA 1MQTB 5JZGA 1RVF3 4Q4Y3 1VBD1 1OHFA 1PGW1 1AR92 4N43C 5C9AB 2R041 2QQPA 4CDQA 4GMP0 1TMF2 1BBT2 1ND3C 4IV1A 5FOJB 1VBB2 1RUG3 2RM23 2Y26A 5D8AC 4Q4X2 2BBVA 4CDWA 1NA1C 4RQPA 3TN92 1AYN1 1VBE3 5L7OB 4Q4V1 1PO21 3VBHC 1CD3G 5CFCC 4CDWC 2XPJA 4PDWC 5AC92 2WZR3 2MEV2 4Z92B 1RUH3 1RUE1 1F8VA 4GB31 4N53A 4Q4W3 4YVSB 1WCDJ 1PGW2 4WM7B 1IHMA 1NCRB 2HWD3 5CFDB 3J8F1 1EV13 1QJX2 1K5MB 2XBO1 1W39A 4RR3C 3FBMA 1BEV1 3DPRB 1C8M1 5BNPA 3NAPB 5JZGB 4YVWA 1HXS1 1AYN2 5BNPC
chains in the Genus database with same CATH superfamily
1GBGA 4JQRA 2DWRA 1JHJA 3ZDVA 2WWSA 1AJOA 1I3HA 5LA1A 1BLZA 2JIGA 5HPOA 5KHIA 5M0TA 3FLPA 1MZEA 1XQNA 1LULA 1WA4A 4GD4A 4N8MA 4EV0A 2XJPA 5JCTA 2FD8A 1OOPC 4Q26A 2X09A 2VMEA 2VO5A 2DVDA 4W50A 5IHRA 5LCWL 1NQJA 1NOVA 4JGYA 1UX6A 1H0BA 1AYM1 5LBFA 1X36A 4CUCA 1N1VA 4HVQA 5DDJ1 1JZ3A 5IJRA 2XH6A 3SKVA 1D4M2 3E97A 5ACA3 2UYAA 4IETA 2XDVA 1YUDA 1ZBE3 4BQ4A 4Y1XA 1RUF1 3VBFA 3WNOA 4EZ4A 3JD73 4CP9B 5F5IA 2IXJA 4LO6B 3ZYFA 3WNNA 3MI8A 5CIRA 5L19A 1D2SA 1QY4A 4AVCA 2Q1MA 1EAH1 2ZHMA 1JUIA 4IDZA 4LBLA 2BUKA 4BLJA 2B9VA 3ZSKA 2ZXQA 3HOBA 1UOFA 1QJFA 2EXHA 4H2AA 4AK3A 1W2TA 4FAHA 3IT8A 4QPIA 1TME2 4L2NA 5FZFA 1JZ4A 1QMJA 4N90A 1WW5A 1WCUA 1W99A 4OZXA 1I1EA 4UAPA 5GZEA 5J09A 1W2NA 5F5CA 5FYMA 2OKXA 2AZ5A 1GOFA 2VJXA 1UOJA 3KT1A 5JXIA 2DYCA 2B7YA 1R1A3 4QX1A 4YYOA 3W59A 4QPGA 5DDJ2 3LOBA 1MZFA 4N53B 1O4ZA 5DXDA 2WWJA 4A44A 2BGPA 1MZ5A 1NQDA 4B7EA 4FVVA 3WF2A 1BYHA 1WMEA 3O0WA 1W8TA 1I6XA 1XYNA 3G6JB 2WNVC 4MGSA 1BVP1 4Y5Z0 5FUIA 4OI2A 4BXSV 1VJ2A 4CCJA 2O1QA 1EAH2 3HVDA 5I93A 4BK5A 1J3RA 1S0FA 5FBZA 3U07A 1UY0A 3HT2A 1LODA 3MF6A 1Z7S2 5C4WA 2WFF2 2HWE1 2GP5A 5FY5A 3VZJA 2FDHA 2JEMA 3K46A 4WZFA 3VZLA 3B5LB 3OY8B 3RGBA 1SFYA 3WD5A 4AE2A 2RHPA 3OYWA 2R071 3TNQA 1S0IA 4Z2AA 2VCBA 1Z0HA 4PIYA 2P5BA 3AJYA 4RL7A 2WJSA 3U78A 1QJU3 1AR72 2WLQA 3C7HA 4LUKA 1QIQA 3OUHA 2X5IB 1PHMA 1FOD1 4IEQA 4S2DA 2R043 4CPBA 1JBCA 3RI8A 4DQAA 4Y4YA 1AL0G 1X7NA 4PJYA 3UGGA 4GXLA 5A6ZA 2PHXA 3M3EA 2OT7A 2Z2SB 4YW5A 2PHRA 3ZXDA 1PIV1 4A7ZA 1RVF1 3H8OA 1OUSA 2AEZA 5HCBA 1DIWA 1W8NA 3TOJA 1LU1A 2WYFA 3VBHA 5CFCA 1S2KA 4Y5SA 4CU9A 1WBFA 1VIWB 5IFPA 2HWE2 3KS7A 3GHNA 3I8TA 1Q5OA 5I8SA 3WY6A 1QNWA 2VW2A 3GNEA 2RM21 1SBFA 1H8TB 2AEYA 5DZFA 2IXLA 1WD4A 3UNPA 5LA0A 2R072 2ZMKA 1J58A 3WF3A 4CDUC 4LUMA 1B35C 4XDQA 3P3PA 3FZ3A 4S2HA 4Q1PA 2VQUA 5FO7B 2HEYF 5FYZA 3ACIA 5IVEA 1CAWA 3O1OA 2WT1A 3ZMOA 3HWJA 1UMIA 3E5QA 1FOD2 1VBE1 2EALA 1HRV2 3AVRA 3MICA 3UV9A 1AXZA 2W52A 3AFKA 2JDKA 4N9IA 2ZGNA 4JHTA 4XF4A 3ZMNA 4IL7A 4YRDA 5F32A 3WW2A 3OB8A 3WLUA 1LEDA 1PIV2 5T5PA 2AUYA 3WW3A 2XBO3 3NV1A 1RVF2 1LNSA 4Q4Y2 4UW4A 4XZUG 4Q4W1 4IE0A 3ZXFA 1AXYA 2D6LX 3AMQA 3CO2A 4XZPA 2ADDA 1ZREA 5IVJA 3VBSC 2P3YA 3KT4A 5GZGA 1YI7A 1H2NA 2CGOA 2RM22 3GJBA 3KV4A 1KQRA 1RTVA 5IK8A 5FZBA 3R0RA 4HK9A 3LDRA 3BTZA 4AXOA 2DV9A 5T5LA 2MHFA 4LEJA 2EIDA 2ARXA 1W9YA 1PZ9A 2FCUA 3OBTA 2YFUA 1AR83 2UY9A 4LXLA 5BNNA 3CLPA 1EUTA 4J6GA 1O3RA 5JWPA 1IKQA 2BEOA 3DKQA 3N7KA 2QKDA 2OXBA 1SG3A 1VBE2 1W8WA 2WT0A 4GWIA 2WNOA 2K46A 3LEGA 2W92A 4XFHA 4AHYA 1CAUA 3HNMA 3RZHA 4PDWB 3UGHA 2HWF3 3SC7X 3RMXA 2WZR2 3ZN5A 4E4DX 4CEYC 1SDWA 1UOBA 3V65A 2VGDA 2HEVF 4XDPA 2BW8A 3NJVA 2PXJA 3UT0A 4YSFA 1YLLA 3RS6A 4Q4W2 1ODNA 3FUOA 4CDXC 1ZNPA 1KEXA 2UYBA 1F2NA 2UWAA 2TEPA 3NQHA 4MHUA 4E8DA 1RHI3 4PI0A 5FDBA 2HWD2 2Y6JA 5ABJC 5EV7A 4Z07A 3M1HA 5C8CA 3V0AB 5ACA1 1E5SA 5FOBB 1ZBE1 5LRRA 4NVPA 2K9ZA 4AVSA 3H8XA 4HN1A 1CVNA 5DUUA 2VMIA 3JU9A 4HPKB 4QX0A 2PHDA 3JD71 3I3BA 1MVQA 2JG9C 2C1FA 5B4NA 4TZDA 1WMXA 2WS91 3ORJA 1S0BA 5FZ0A 1S1AA 5EPAA 3WOGA 1DF0A 1OXCA 1FMD1 1C5HA 3WP5A 1H8TA 1V6IA 2G4IA 1N3PA 2FDJA 1AR93 5C9AC 4XBQA 5GM0A 3ZSEA 1XJAA 1SMVA 2IFRA 3B93A 3WQ7A 3HPNA 1TMF3 2DVAA 2DVFA 2W91A 3WG2A 4AF9A 4AVAA 3ZLIA 4BU2A 3D82A 1ONAA 3VD7A 5DUWA 3ZDSA 4E4HA 4Y26A 4OVEA 2VQAA 1R1A1 3AP6A 5ACA2 5KHGA 4IEYA 3WHUA 1ZBE2 2WA4A 1QJZA 2LROA 4H14A 2NP0A 3WEZA 1KFXL 2XUEA 4OQ8A 4FAGA 1IKPA 1HDKA 5JMOA 1DQ2A 3JD72 3TEXA 2TUNA 2VNOA 4LIUA 3NSTA 4NHYA 4I3PA 4LLFA 1E5RA 3IMMA 4HSLA 2MEV3 3KHBA 4XMIA 5D2AA 1S0JA 4XAAA 4Z82A 4MZUA 2CDOA 1FNYA 3APBA 3POIA 2P17A 4CU7A 5A7PA 2QZ2A 5LW9A 3JQWA 5LA2A 1IS4A 3LWCA 1IOAA 2GC2A 1JTZX 1DZQA 1XNDA 3MZHA 2ZX0A 1SHWB 2NLRA 3BVCA 4BA6A 1ZZ6A 2IZWA 1EY2A 1R1A2 2GN3A 5TSWA 2ZEWA 3TNPB 5A3MA 5FZ8A 1QJU1 2BNOA 2HH9A 4IE4A 2FCVA 2OZJA 4XFGA 4JZRA 5FZKA 5HXMA 3FHAA 4XF9A 3ABZA 3HT1A 5JZGC 3RZMA 4PQQA 5E6HA 2J1AA 4YM1A 3N9PA 1FV2A 3LA7A 2WNVB 4GIQA 2VZVA 1DGWA 2V4AA 3FJSA 2QE3A 2VNRA 3ZXEA 2GH2A 4CDQC 2W46A 5HBAA 2VUDA 4IV1C 4NWVA 3RWKX 2AENA 2VOWA 5A3LA 2GNTA 4ZXKA 4QXKA 3S0MA 3PDQA 1ZBA3 3ACFA 4TYSA 3UKVA 5FZHA 1FNZA 1JOBA 1KJRA 1D0HA 3QBQA 4D7SA 1QXRA 3J8F3 1PX3A 2OZ6A 4IGOA 1RUH1 1YQ2A 2ZAHA 3B7MA 3DN7A 2RJKA 5JXJA 1NT0A 1ZRRA 1QJU2 4P9YA 3WG1A 1SLBA 3ENRA 5J98B 2DCYA 5FJKA 4AVTA 3PMSA 4FPHA 2P6CA 4X6QB 2YPJA 4LIVA 4YFWA 1LR5A 1GQGA 2R042 3H50A 4WM8A 1UO9A 4AQTA 3I3MA 1W2UA 2RS33 2LM3A 3M3QA 4MO3M 5FZ3A 3AZVA 5GLTA 3EHKA 1PK6C 5FWJA 4XF3A 1RC6A 4UWDA 2GC3A 2WZ8A 3GGLA 4XAEA 1V6OA 4DEQA 1MVEA 2FDIA 1W6OA 5K0UA 1Q8VA 4MH0E 3WW1A 3DF0A 4AVBA 1DQ1A 3JZVA 1XSRA 4COUA 5IK4A 5KR7A 3LA3A 5BNOA 5K8SA 2SBAA 4IEXA 3AZZA 4XUTA 5EYYA 5GJ6A 2J1TA 3ALQA 3CJIC 3ILRA 3OGJA 5H9QA 5BPXA 3ZXKA 5AVPA 3BPZA 1UAIA 4CU8A 4CDUB 1B35B 3VUOA 5HCAA 1WW7A 2D40A 3HR9A 1P8JA 3K4AA 2BERA 4IE7A 1W3XA 3A4UA 1AR81 5DQ0A 4XFCA 4AI0A 4LK6A 2FDGA 5DMYA 3L2YA 4XETA 1UY2A 4F83A 1HB2A 5FO9B 1LHWA 1XOYA 1QH7A 4XMAA 3RYKA 2DU0A 3TB0A 3VDDA 4CCNA 4ZU7A 4KU7A 3TYJA 4WVMB 4PBPA 5K7PA 2XBO2 1ZVFA 1US3A 3POYA 5IVBA 4JGYC 4J25A 1LOAA 1ND2A 1O6UA 2JB4A 4WVVA 3ZFFB 4NIAA 4QGMA 3VBSB 2B45X 3POBA 3BOWA 4LKEA 1NE6A 5EFUA 1RHI1 3HMYA 4I01A 5LK7B 2EXJA 5C3RA 4RD7A 2XB6C 4A6OA 1WA6X 3VBFC 2Z69A 4KQ7A 1XXNA 5H9PA 1JZ8A 3NMBA 2WQ4A 3BCWA 2GC1A 1QNYA 4LA3A 3WF1A 1UMZA 4AG4A 1AR82 1H4GA 4LMFA 1LGCA 4MXWA 2WA3A 2ZZQA 3KV9A 1GWMA 4I09A 4QPIC 1IZ3A 2E6VA 4UFMA 3WNXA 1UU5A 4LLOA 2P3IA 2XJRA 2C24A 5L7OA 2HWF2 4LOSA 2Y60A 5G05L 4CEYB 1LOBA 2ADEA 5FLHA 5FXVA 1VBC3 4DXZA 2EXKA 1X9TA 2YROA 4RHV3 5CG8A 3O1UA 1UQXA 4QPGC 3D5OA 1MS5A 4Q0PA 3W20A 1DGRN 1RHI2 1J1LA 4QT6A 4BJ0A 1OFNA 2PQSA 4JVAA 3PVOA 4QMAA 5A70A 4GWJA 5ABJB 1RL3A 4AGRA 1R083 1DQ0A 3NKGA 5CFDA 2FMDA 4MSVA 4ORFA 4BYYA 2RDQA 3IMNA 4EWDA 2ZGPA 3I4IA 4P9LA 5FK8A 3DXTA 3I3QA 3T08A 3ILNA 2VNGA 5FPUA 3DPRA 4JDMA 1RUC1 2H0BA 2ZJCA 1BVVA 5C4WC 1JZ2A 3THCA 2MEV1 1JZ5A 2PAMA 4MGTA 1YIPA 4IEUA 4LBMA 1VBD1 2ERFA 3ZSLA 5C9AB 1AR92 2W1QA 1Q8QA 1DGRA 2ZGLA 3AMMA 4LTAA 2QQPA 1FI2A 4QD2A 4QQ2A 1NZCA 5FMCA 1TMF2 5FOJB 1XNBA 4IEZA 4OUSA 4V2VA 4Y1VA 1RUG3 3RZKA 1YRZA 2JG8A 3K48A 2WFPA 4Y33A 2YZ4A 1EUUA 4FFGA 4CCDA 3PLQA 2LW8A 2J1UA 1XE0A 5LY2A 1D0GA 2D6MA 4XABA 5D21A 3LSEA 2GMPA 1U5ZA 2J1RA 2CSGA 4LKFA 4CDWA 3LQCA 1JYXA 3ZVXA 4Q4V1 1QHDA 4X8NA 3VBHC 4LQRA 3NV4A 3CNAA 5CFCC 2H6CA 4H7LA 2ZGTA 4BXFA 1FV3A 1UF2C 2MEV2 4Z92B 3AYEA 2WR9A 1F8VA 2KR2A 4P9WA 4GULA 2IFWA 2Y34A 4G4FA 5I8TA 1YJLA 4LBOA 1WCDJ 4XJWA 2R6QA 5FCCA 3GZEA 4A3ZA 5IFTA 3KQRA 1L3JA 1O3QA 2CWMA 2BWCA 2Q5TA 1A78A 1AX1A 2F4PA 2J1EA 3GF6A 1G86A 3U37A 3J8F1 4PF5A 2JD4A 2W1WA 3LPGA 4MUVA 1GQHA 4BIFA 1W39A 3WQ0A 2OPKA 3W21A 2YHJA 3PHMA 3MHZA 1JZ6A 2O8QA 3J26N 5DN2A 5BNPA 1WD3A 3M3OA 4D7TA 1A34A 3D6EA 3OBAA 5JZGB 4YVWA 5EJ3A 1W3VA 1ENRA 2VZPA 3SH5A 4LHNA 1BCXA 3MFCA 3URFA 2HBUA 4IESA 3T0BA 3MUY1 4DINB 1D7PM 2BFUS 3KD4A 2BFUL 4Q27A 4QHZA 1UZ0A 1NLSA 2XVGA 4SLIA 1EPWA 2PFWA 4FT8A 4JKLA 1E5IA 2JE7A 5F7UA 1H9WA 4Y5TA 1ZBA2 3AMNA 2HKXA 4A2UA 2YB7A 5IWFA 3OGRA 1W6NA 5L36A 1W8ZA 3PUHA 3J8F2 4IV3A 4OMDA 5BNNC 1H1IA 1RGSA 4CUAA 1S0DA 2BQPA 1AF9A 2G19A 4H3WA 2XJVA 4AVVA 3C3VA 1DGLA 4R4XA 1VALA 4GJZA 5FZCA 1UX7A 1QJY1 2AH2A 1MACA 1SPPA 5KXBA 2GN7A 5LATA 1NKGA 4LITA 1AL23 5FZOA 1WUVA 3I2OA 4ARXA 3RYRA 4YW7A 4BMBA 3WDTA 3GDBA 4TSVA 2RS32 3F2ZA 4P5YA 1PK6B 1W04A 5C7GA 1V6KA 5DAPA 4AQ6A 1ZRDA 1E5HA 3C7FA 1LU2A 3O1TA 2RS13 2VNVA 4URAA 4B1MA 1K42A 4XQDA 2RS51 3B02A 1O4YA 3NV2A 5C8CC 5A6XA 4MXVA 3K75B 2QQMA 4FOQA 3KZ4C 1WLDA 4X6RB 3F95A 4H55A 1UYPA 1CAVB 2GAUA 2LUWA 4EN6B 1J59A 3NJZA 2Q4SA 2YC4A 4Y22B 1RITA 3M70A 3MIHA 1G9DA 4ZZ5A 4NOTA 4NHXA 4KG0A 1H8TC 3PIGA 2L9LA 1ENSA 2DTWA 2J42A 1UCXA 5FZIA 4O65A 4Z8BA 2VXRA 4NIDA 1IGOA 5BV6A 2VZTA 4ES9A 1BK0A 4JGYB 3WF4A 1RJ8A 1RMU3 4IEOA 5LK5A 3TN91 2ZBJA 4DY5A 2VOKA 4RHV1 3FHIB 1KFUL 4QHBA 4YZ4A 5BY5A 1AUYA 4FOYA 1BZWA 1GP5A 1LCLA 4XJ8A 4MYEA 1SACA 3LOIA 4N43A 4AQ2A 3VBFB 1H1MA 3OPTA 2P4EA 1YWKA 1R081 3NJYA 5JI7A 1ND3A 2YMZA 1MR5A 3N7LA 1C8NA 1BJQA 2AC1A 1W8HA 2VMDA 1FPN2 1LHNA 3H3ZA 1IS3A 2GZWA 2F17A 5D8AA 3ELNA 1NG0A 2D3RA 4FCAA 1VB4A 1DYOA 5FQ0B 2AREA 3AVSA 2CAUA 3IBMA 4FXGB 4QPIB 1JW6A 5F6LB 4EYUA 2CNAA 1RUD3 4CCKA 2BTVC 4OLLA 4PBOA 3KF5A 1EPZA 1PNFA 2A71A 2D98A 2YG0A 1WW4A 1O7FA 4UI9L 1MS3A 5BNQA 4NIIA 3BUCA 2D3PA 1VBC2 2YC0A 1ZZBA 1HQLA 3N7JA 4K3UA 1GNYA 4RHV2 1LRHA 2QQVA 4QPGB 4YW4A 3NWKA 2BJSA 1OPOA 3RZZA 3SNMA 1YFXA 1SBEA 5I0SA 4AHWA 1PO23 1XU1A 2BNMA 4HXCA 4KNCA 4RGAA 5CAZA 3KSCA 5KHJA 5B4XA 1R082 1UZVA 1GANA 2VQ0A 4YGCA 5KWRA 3WT3A 1NY72 4OFGA 1JYNA 1C1LA 3UGFA 1SLLA 1Y4WA 4OUMA 4GB33 4J1WA 2OX0A 5H9SA 5I0RA 2AGSA 3A23A 4XUPA 3KM5A 3RZJA 1HB3A 2VTXA 5GLZA 2OW4A 1BK1A 5C4WB 1A6CA 1D4M1 1HX6A 3CEWA 2I2SA 2W3JA 4J1XA 3PU3A 4FFIA 3MV11 4NIGA 3ZFEA 5A1AA 1J84A 4QX3A 1IQDC 5AFEA 4HFSA 3WX5A 4Y22A 2PHUA 4OHXA 2GSYA 5FUNA 5FP8A 5GLVA 4CRQA 1HXS3 2YU1A 1RUG2 3T4HB 1TNRA 4NR1A 2VCMA 1H2MA 1UKGA 2EIGA 2C26A 1TME1 3GZTB 3GM8A 1OC1A 3ITQA 1UL9A 2W47A 2QNKA 4WM8C 4XJ9A 1POV0 1UOGA 2EIEA 4NHMA 1HV1A 2PHTA 2Q1FA 4WBBA 1QWRA 3K77A 1KITA 3VBOA 1CPMA 3TBDA 3H42B 1OF3A 3ETPA 3VBHB 1IG3A 5CFCB 2QCSB 1M4WA 5K0UC 3KCXA 1UZYA 3IWZA 1LOCA 1GLHA 5J3UA 1YC61 5FUPA 5T5JA 1COV3 4WZCA 1J3PA 4QKDA 2DCKA 1ZA4A 2W1UA 4BH9A 3U14A 4F8AA 1LOFA 1BHGA 2R063 3N9LA 2XKPA 1CAXA 1CWPA 3WP4A 1HV0A 1CAWB 2E33A 3O1RA 1X82A 4QPYA 5FQ0A 4XC9A 1DZRA 5HV0A 3X29B 1Z7S1 2WFF1 3VDDC 2VZUA 4UXAA 2WLPA 1YFYA 1GMMA 5T52A 4CU6A 4N7IA 5FZMA 4IEWA 2ZHKA 3T2QA 1ZZ9A 4BLIA 2MNGA 1AL21 3HAGA 4L92A 3WP6A 2B39A 4AEDB 5AFBA 1U5XA 3BU0A 1ND2C 4LO7A 3AC0A 5FPLA 3WZ1A 3S57A 3WG4A 1AR71 5LB6A 1OLRA 5DUXA 3K51A 3LE0A 2AR6A 1OA2A 2I45A 2RS11 1W90A 2RDRA 5FO8B 3VZOA 4P9XA 2A6VA 4E2GA 4LO5B 3DYMA 3K3NA 3NL1A 1ULPA 2YBPA 4L99A 1GFF2 3LDKA 3RSJA 2YUEA 1GNHA 2ZEZA 1JI6A 5BNNB 1QU0A 3AKRA 4Q4X3 1AXKA 2EICA 5A32A 4AAPA 1WGPA 2Y0OA 1HB1A 4FFFA 3WVJA 1OKOA 2QDNA 1POV3 1CAUB 4TXWA 1DP0A 4E2SA 5L7OC 2Y8KA 4Y1ZA 2PHFA 1AL22 5FMOS 5FP7A 5FMOL 2CHHA 3DKWA 4PLOA 3D0SA 4RYDA 4ZY9A 1ULGA 1LOEA 1WLTA 4MG2A 4EROA 1VPHA 1WLWA 4CCMA 3ES4A 5F9TA 4L8QA 4FBFA 1LHUA 3SQOA 4GA9A 1RMU1 4Q1RA 3T0DA 2RS12 3HNBM 5A33A 3E5UA 5CYYA 1HRV1 1UD1A 4FQ4A 2IXKA 5FZAA 5E88A 5C8CB 3AKPA 3FL7A 2IVIB 1OMIA 2HYXA 3MYXA 4QB2A 4RS5A 2C4XA 1OA4A 5CFDC 5FPBA 3SHRA 5F3EA 4JGZB 5EIYB 1QJX3 3BTYA 4UFIA 5EJZB 3POJA 4D6QA 1V0AA 1GSLA 1PNGA 4Q4Y1 2R0HA 4K8FA 4GKYA 5FP9A 3UESA 2W9XA 2FDFA 3DPRC 2QQLA 2HJIA 2P3KA 4ZXEA 4UF0B 2DUPA 3VD5A 5JR7B 2V73A 3Q8BA 2ZX2A 4A41A 3R4UA 4E2QA 2VVEA 4RSUA 2E63A 4UBHA 1UYYA 2YDEA 1WWYA 3EB7A 1RUD1 1ENQA 4OQ9A 3NW4A 4OULA 1RUE3 1ZZCA 4DS0A 3J7HA 3BIEA 2FBEA 1RMU2 2JG8C 4YNIA 5E89A 5FZ1A 2VBDA 4I0WB 2WZPP 2PHWA 4CA9A 4BOWA 3ES1A 4CXXA 2WZR1 4E4ZA 5A7SA 2DUOA 1H2LA 1G9FA 4AEDA 2XWJB 3CF6E 4UW6A 4AFMA 3I49A 1BEV3 5HI0A 2BGCA 2JDNA 1ASJ3 4UOJA 1C8M3 3ZFFC 1N1YA 1W8OA 3WCSA 5JUVA 3MW2A 4G3YC 5FYIA 1XNTA 2HWD1 1PGSA 4NE9A 1W8UA 3RPQA 2UWCA 1G7YA 2WINB 3SEEA 3OBRA 4YM2A 1RUD2 5FPVA 4PT6A 3ZIWA 3ZN4A 3DYPA 2WO3A 3DV8A 4B4PA 2D6PA 4A45A 5A1LA 3VKOA 5CEHA 1ALYA 2GC0A 2QQUA 2QZ3A 5JIAA 1VBA3 1DLLA 3ZFGB 1CQ9A 2WDBA 2WYSA 4FI9A 1K5JA 1CJPA 3OBZA 3R4SA 4BQWA 5LEJA 5I8YA 1FYUA 2DVBA 1PO22 4F7ZA 2CY6A 1NUKA 1N3OA 4O61A 4YVWC 2I07B 5LY1A 4OCTA 1CPNA 5KC6A 1KGYA 2R32A 5CKQA 1VMHA 1FXZA 4PCRA 2VULA 1X50A 4JDOA 4GB32 4YG0A 3KHCA 3PL0A 2D3SA 1JZ7A 1WMFA 1GQPA 5JPMB 3H3UA 2OIIA 3Q8EA 3PVNA 3S6PA 4HZFA 4LBJA 4YW3A 5HCFA 3MLKA 5T3NA 3ZSJA 5FZ7A 4KL1A 4JGZA 4B29A 1COV1 1TNFA 2VU9A 2VZQA 1ZZ8A 2WSVA 4KMQA 5CADA 4IV3C 4LO4B 3POEA 3WUCA 1GUIA 2ZABA 4A3XA 4ZS2A 1IS5A 5FZDA 1F4AA 4BM8A 2P3JA 2RJLA 4E27A 5JOWA 2YXSA 4UF0A 3HD8B 5DZEA 1HXS2 4Q0VA 3N9NA 1LECA 1LAJA 5JSPA 3O1SA 3VDCA 1VMFA 4GKXA 2FDKA 4BWOA 4JTNA 3MGUA 4WM8B 1JYWA 3C7GA 5FREA 5IT6A 1AR63 4HBNA 4TTGA 3AXDA 3MW3A 3MLLA 4N7UA 3Q8AA 5EZWA 5A1FA 1QGLA 5FY4A 4BISA 4PI2A 1GYKA 1RXFA 1ST8A 3SH4A 1YJKA 3KLSA 4L11A 3SXWA 3QOPA 1KXGA 1V6NA 1W6OB 4QQPA 3PMEA 1OH3A 5DG1A 5K0UB 2VW0A 1DFQA 5FY8A 4YARA 5A6YA 5BNOB 4FPLA 4ZKTB 5GALA 2A1XA 1COV2 3NO8A 4CPBD 1QOSA 2PELA 5C33A 1CR7A 5I0TA 2R062 3HN3A 1RUI3 1DQ4A 3K2OA 1XU2A 4YVSA 3FWEA 4WM7A 4YG3A 2CYFA 2OYZA 2PAEA 4XPVA 4Q4X1 2YFZA 4UFKA 1QXPA 3VDDB 4XFIA 4R9AA 5KXDA 3H7YA 2ETEA 2E7TA 2YC2A 3Q8CA 2D6OX 1POV1 2V09A 4NROA 5E16A 5EHDA 3T1LA 4NPRA 2PYTA 4COWA 4BK4A 1Y7BA 4PF1A 1ND2B 3CKHA 4LK7A 4PQ9A 4XJAA 2OQ6A 4AYUA 2CDPA 4KGQA 3ZFGA 3NAPA 1MQTB 2ZGOA 2JE9A 2YV8A 3EJKA 5IVFA 1GP4A 2E53A 2A6YA 2BRTA 1UWWA 1PGW1 2CGNA 4N43C 2R041 1CIYA 3ILFA 1QJEA 4GMP0 3LKJA 3VL9A 3POWA 1ND3C 1WBLA 2WAAA 3EQEA 4BQ2A 1Q43A 4QDSA 3VKMA 3T2OA 4O9EA 5D8AC 4MXWB 3N35A 2UWBA 1CZSA 5FPXA 1I9RA 2YY1A 4Q4X2 2ARBA 3DCQA 4FFHA 3LFIA 4A42A 4HLTA 2LS6A 2ORZA 1KS4A 2CV6A 4RQPA 5L7OB 4M0NA 1DLCA 5CBLA 2D5HA 5FKCA 3ZIXA 4ISQA 3AP9A 1LKNA 1GV9A 1RUE1 2CTVA 2LTNA 4QU2A 2H6BA 4TN7A 4BHPA 3W5NA 2NMNA 1PGW2 4UFJA 1YQ6A 2OVUA 4UT5A 5JMCA 4M3CF 4K21A 1NCRB 5IAVA 3AL5A 3W9AA 3CIHA 3ZXJA 5CFDB 1K3IA 1SFPA 1IPKA 1EV13 1QJX2 2XBO1 3QACA 5FYTA 1JU4A 5JLVA 3FLTA 4Q29A 1BEV1 4COZA 2RDSA 3DPRB 3ZM8A 1C8M1 3OPWA 3POSA 5DUVA 3VL8A 2EAKA 4MGKE 4Q0QA 3OGSA 4AL9A 4DRRA 1SLIA 2VBBA 3HBZA 3WQ1A 2FQPA 2OPWA 2Y38A 2C6SA 2HEWF 3KWVA 3ZFEC 2VG9A 4FP2A 5DAWA 5C3PA 1RUE2 1W2OA 1O59A 1QXJA 1CESA 2JG8B 5IYYA 1VBA1 1VRH3 1PMJX 3OPZA 4RN5A 2WN3A 4GMP3 3D0JA 1QEXA 1BMV2 3H0OA 2CAVA 5FWEA 2D6NA 1REEA 4LKSA 2HWF1 4JCKA 5G04L 3BTXA 2PLV3 4YPJA 1JN2P 3VBOC 4CDWB 1NZIA 4NMIA 1BEV2 3MPPG 5K4LA 2D44A 1ASJ2 4JRLA 1MQTA 5CG9A 1C8M2 2Y0IA 1T6BX 4MGIE 3MIEA 3CL1A 4ZONA 3JBG3 5I91A 2ZMNA 1VR3A 1B09A 1NXMA 1Q8PA 2JWPA 2NPIA 4KWUA 4D8MA 1LOFC 2MPFA 4B4QA 4QXCA 4XFBA 3RDIA 1VP6A 1G9CA 1FPN3 4RFRB 3TRSB 1CIWA 4RR3B 4YZ3A 3PTYA 4P14A 2QQNA 4LULA 1W6PA 1VBA2 2QDRA 4RGGA 3LF7A 4A7YA 3FE5A 4E9KA 1GOHA 3WF0A 3ZYIB 1LB2A 3AMPA 5BNPB 4NWWA 4LBNA 3L9JT 3U1XA 1SCSA 4YVWB 3T3YA 3VBUA 2KA3A 5FYCA 1AR91 2BNNA 4YGBA 4OHWA 2VE1A 4W6XA 4W8JA 3B69A 3UJOA 4K6BA 2WC2A 1TMF1 3GBFA 5A7WA 2ZKNA 4NPLA 3I2DA 2AYHA 4KGGA 4QDRA 3RVHA 1JUHA 3VLBB 3VN4A 3ZPYA 3ZYBA 4Q0UA 3NNLA 2RR13 2F4LA 2X10A 4JKKA 1GZWA 3AYCA 4QX8A 5FY1A 2C0ZA 1S2BA 3TEZA 1NCRA 2XJQA 2QFEA 5L9BA 5LBCA 1SEFA 4YW1A 5LRSA 1YO8A 1W6NB 2Q30A 2TNFA 1OQDA 1WCSA 5T50A 2VZOA 4AR2A 4IV3B 4YM3A 1ULCA 3NNGA 1AX0A 4EZHA 1LGBA 4AEMA 1RUI1 3SCHA 3P5BA 1UIJA 2JIJA 2PHLA 3L2HA 2WN2A 4M0HA 2JDAA 4XQ4A 3BIWE 4QAWA 1RUJ3 1MS4A 5JSOA 1PM4A 1YFWA 4YZ2A 2GU9A 3EMRA 1SPPB 4IE6A 2KM2A 4C1WA 5FZOB 2XLFA 2YYOA 3N7MA 3DYOA 5IAXA 1SBDA 2YPDA 2VUCA 1DGWX 4M3CA 3EO6A 1AR62 2VL4A 4F3JA 3LD8A 1DYPA 1C1FA 3B00A 3O5SA 2ET1A 1UZWA 5IUQA 3AYDA 2E7QA 4FPJA 4M4RA 4C90A 3UKNA 3RG0A 4Q2FA 2CWSA 1Q8OA 2Y33A 2UY8A 5F37A 1YIFA 4RS5C 4QM9A 2VZSA 1L7LA 1XSQA 3P1IA 1C28A 3WQBA 1S2EA 2QQKA 3O0VA 1V6MA 5C5TA 5IVVA 5DZGA 3K3OA 1PO13 3FUQA 5IK5A 4AW7A 1RUI2 1DBNA 3POGA 2VZ3A 1FATA 4DOUA 5EWSA 1A3KA 3D4KA 4I30A 2VECA 2Q0AA 4JAAA 4XEZA 1IQAA 1I5ZA 4XUQA 3IAPA 5GLWA 4HN0A 4LBKA 2OS2A 2VMGA 3KGZA 3LGRA 5C71A 3O14A 4FTBA 3IDBB 5LWBA 1W05A 1ZBA1 1URXA 4DXTA 3WNMA 4RR3A 2W39A 4QX5A 1OT5A 1QKQA 1O3SA 4EWEA 2ZACA 1C5IA 3OEAA 3C7EA 4Y1YA 1ZZ7A 2B9UA 2PMWB 2ZGUA 5CVRA 5CZKA 4XIOA 1OBNA 5CKNA 1KDMA 5FIXA 3LPFA 2V4VA 3LSDA 4N43B 2VCAA 4Q5OA 1W06A 5DPNA 4AFDA 5FYSA 2E9QA 4JX0A 4NRPA 5KHKA 2UU8A 3H9AA 4XILA 4AEDC 1XYPA 1CZTA 3I2KA 2RS31 1ND3B 2IXCA 4CEWA 1NCQA 1EV11 4C91A 3VBRB 1JYVA 1RIRA 5D8AB 2NQYA 1V00A 4LBQA 4YW2A 3AMHA 1OFSA 4B3NA 5C5UA 3EXUA 5FP4A 2BZDA 3CHXA 2JJ6A 3RNSA 2R1DA 4PLNA 2D6KA 3KMHA 5DAQA 2Y6HA 2ZEXA 1AYM3 2Y6LA 3WP3A 5HXVA 3VZKA 2XL9A 5JR2A 3SCGA 4LO8A 4Q8LA 3WNKA 3WDYA 4C0HA 3RRDA 3FHQA 2VPVA 3IIAA 2DCJA 1MEC3 2Z79A 1PM7A 1TG7A 3SH3A 1VRH1 1RUF3 2H0VA 3H7JA 2WO7A 3MPBA 4GMP1 4I3GA 2D7FA 1X8EA 1XNKA 4DUXA 5FZGA 4MGQA 2ZGSA 1EV12 3UKTA 2BWAA 3ON7A 3JB8A 3KQ4B 1V70A 3AP4A 2ARCA 3VDBA 2BPA2 3DECA 2JG9A 1JYCA 4EWAA 4XUNA 5SV8A 3J9SA 3FBYA 1AZDA 1REFA 3AP7A 3JBG1 4JGZC 5D1IA 3J7NA 3A0NA 3ACGA 3IN9A 3ZFEB 3ZXGA 4V1PA 1ZRCA 4YFZA 3NNFA 2XKOA 2EA7A 3M2MA 4JKMA 4HL0A 1F5FA 3SEPA 2QTWB 1FPN1 1IG0A 1X8MA 3N9QA 3FFZA 5GZDA 4AI1A 4QPWA 1JS9A 3VHRA 4S2GA 3BB6A 3ZYJB 1OLMA 4AEKA 4AI3A 2WUHA 1VRH2 5IVYA 1VBB3 4XQWA 4LA2A 3K4ZA 2VTXJ 1YNAA 2P2KA 4QB1A 4C8DA 2PLV2 1SLAA 2G9GA 5AVAA 1W03A 1BQPA 2Y6KA 3VBOB 4UBGA 1VBC1 4LKDA 4DZGA 4CVUA 3OCPA 5ISLA 3PU8A 2ARAA 2XHKA 4JDNA 3QH7A 2D43A 4URTA 1X33A 4ZPIA 1YQ8A 2DU1A 4KG8A 4R9DA 1Q56A 2V5YA 1STMA 1DDLA 3JBG2 3O7OA 2RR11 1BXHA 5AC93 4QQHA 1LESA 2ENRA 5CU1A 3WG3A 5JOXA 3HBKA 4CP1A 1RUNA 1NY71 5DAXA 1CAXB 2WZEA 4RA0A 3T09A 5DAVA 4YVSC 3VBRA 4EN0A 3VHPA 1SLCA 1MPXA 3CJXA 4WM7C 4FPYA 3TWIA 4EN9B 5F3IA 3OGVA 5FK7A 2ZEYA 1NE4A 3M3IA 2BVVA 3I97A 3KT7A 2OA2A 3BODA 3I2HA 2I74A 5JDBA 2W5FA 3AXEA 4FPOB 5F5AA 2WNUB 4OI0A 1YQ5A 4BQ5A 2XLGA 2ATFA 5FPZA 2XXZA 3CBNA 3ZN6A 4KWKA 1W0OA 4QX2A 1K12A 2IC1A 2VZ1A 2YU2A 4XE9A 3NAPC 3ZFGC 2FZ2A 4S2FA 1RUG1 3I2FA 1AYN3 3U10A 5IATA 5JOZA 5A7OA 1V6LA 3PJYA 2RR12 3IM0A 3MIBA 3RYPA 4HG6B 5CA6A 2W1SA 1K45A 4GH4A 2IUWA 3I3EA 4K20A 4XXAA 1G9AA 2JDUA 5ANQA 3OUIA 1PO11 2EIBA 2QUOA 1RUOA 2Z5WA 4V2WA 4KWJA 1H8VA 5A32B 3SMHA 4LOTA 1RUJ2 3ACHA 2E31A 4LE3A 3THTA 5LZ6A 2X05A 1VAVA 5CISA 2JE8A 3PJQA 4RQPC 4BE3A 2WO2A 4ATFA 2A3YA 3VKNA 3BPSA 1D2QA 3I59A 3RWNA 2A3WA 3H1MA 1US2A 4A7KA 5J7MA 1GNZA 4WVWA 2XUMA 3N3HA 3VKFC 4FOWA 1C3HA 2WQZC 3EYPA 3U75A 4JTOA 1MZ6A 4ASMB 4CUBA 1KD7A 3MEPA 2DBIA 4ONUA 2TBVA 1S4CA 1O4TA 5A33B 3THPA 4L0PA 5FY9A 3VD3A 4RS5B 4NRMA 1W2AX 1ZM1A 3B3QE 2ORXA 1JMUB 1H6XA 1ZRFA 5FR3A 3CJIA 3ME2A 1R093 2IWGB 4CCOA 1JOJA 1PO12 2ZA9A 3UK9A 3HNYM 4M01A 1OI6A 3HQUA 4KH9A 3V0BA 1UY4A 2VH9A 2ZKLA 3ZO0B 2WBKA 4K8RB 4I0AA 5BNOC 2RG4A 1PVXA 5B2GB 3MBWA 3A7QA 5I0DA 5F5QA 1DG6A 1HQWA 1W9FA 3LFMA 2JD9A 2R1BA 3BGAA 3QCWA 4IE5A 4QXBA 3T30A 5LASA 2JKBA 2JX9A 3MV01 4H7MA 1KDKA 1OSGA 1W8FA 4YGEA 4BZ4A 3VHNA 5F8PA 3WDVA 4AWDA 1O3TA 3AZYA 1YQCA 4K1YA 4AAXA 1W6QB 3TEWA 1R1ZA 4K1ZA 4MGYE 1VE0A 4E4SA 3K4DA 1YI9A 1UY3A 4DB5A 3AZWA 3I2IA 5FYBA 3PUQA 4XF0A 2ZX1A 2V5DA 2HYKA 4JV4A 1Y9GA 2WNUA 3I2JA 3KGLA 1MEC1 1TZOA 2BVBA 3LAGA 3LB9A 1HLCA 4N9HA 4XURA 1CX1A 2X53S 1DQ6A 4PLMA 3BOPA 1MQTC 4ZS3A 2WS93 4D94A 1ACCA 3KF3A 4G9SB 2QBXA 5A3PA 4QM8A 1FMD3 2A75A 2ID4A 1ODMA 3IPVA 3LIHA 4CUGA 5CKMA 3H1YA 4P5HA 1WW6A 3LEMA 4XCAA 2DFBA 2LRPA 2XHNA 4W6YA 4Q8KA 1G6NA 4IQPA 4P9IA 1Z78A 1PZ7A 4NN0A 4HONA 4E8CA 2GNBA 5E1RA 1ENXA 5EXOA 4FPCA 5FAXA 1F5JA 1AYM2 1A8MA 4XJUA 2VCCA 2VD7A 1MS1A 1DU3D 5FZEA 1CJDA 1SQ4A 2BYVE 5A7NA 3FC0A 3FN9A 4D6RA 2ZX3A 4DFSA 1GKBA 1GU3A 4KBZA 1MEC2 3ZKUA 3VBUC 1RUF2 1VBB1 1U0AA 4XFAA 1WKYA 3IIIA 1OH4A 1W9WA 3HQXA 1KRIA 1TVGA 4ZZ8A 3J7LA 2HWC3 2XJTA 2XWBB 4P9JA 4YG6A 3ZYPA 4CXWA 2OQ7A 3MO4A 1GICA 1REDA 4HSJA 3MW4A 1G8WA 4OI1A 1L7QA 1H1AA 3IKWA 2WKKA 2P37A 4UFHA 5FZ9A 4QWNA 4Z2WA 1K5MA 1IPJA 1NCRC 2O14A 3V56A 1ZX5A 5DABA 1QOOA 2D97A 5AC91 3E1F1 1HKDA 2QVSB 2EVXA 1NXD1 1UMHA 4JC1A 1NAEA 3HN1A 3D8CA 3PURA 1WMDA 4OHYA 3FX3A 1L7RA 4HVRA 3R6SA 4COYA 1W0NA 4OMCA 4XTMA 2VVDA 2Z4FA 4BPZA 3GBWA 1VBB2 1OVPA 2Q8CA 4FP3A 3TAYA 2RJ2A 3GALA 2Y26A 1OPMA 2JB8A 1UPSA 5FV3A 4IW3A 1W6QA 4GJYA 4HOOA 1ZYBA 4GZ9A 4PIXA 3NV3A 3OJBA 5FMDA 2BOIA 3ACLA 3PUAA 1AYN1 3G7DA 1PO21 1O5UA 2BBAA 1UU6A 2W68A 1CD3G 4OHZA 4BB3A 1VLNA 3GZAA 4HVOA 4CDWC 3U4XA 5AC92 3HIFA 4CTEA 1RUH3 4CP9A 5FLIA 1DQ5A 3LIGA 1OD5A 3ZSMA 5C3OA 4GB31 4XFFA 4YVSB 4WM7B 1D4VB 4CE8A 4O7XA 1IHMA 4UYBA 5C70A 1PX4A 1XRUA 3LEKA 2XL7A 4M3CE 4BQ1A 3Q9OA 2A70A 3E6BA 4CSWA 2JDMA 2O8OA 4NO4A 4RR3C 3KVAA 1YEWA 5FJHA 2YBSA 3H3LA 4DXRA 2VW1A 1CN1A 2B46X 3WNPA 2QQOA 2JENA 2K2SA 4INDA 5JPNB 2Z42A 3NAPB 2ZMLA 3VGIA 4AI8A 2PN5A 1HXS1 3A22A 1AYN2 4N53A 4XW3A 5BNPC 1IPSA 3VKLA 3B94A 4AOCA 2J1VA 3C8XA 2VC9A 3GZUC 3DGTA 3OGGA 2GMMA 5EQUA 3A21A 4JRAA 5KHHA 3FFQA 1XE7A 5F3CA 1S55A 3MIFA 5FXXA 1NCQC 4COVA 4UW3A 4CEWC 4HANA 2A5ZA 2D93A 3GCXA 3NKTA 4OHVA 1N1SA 1R091 3I7DA 5LBBA 1F9KA 2RDNA 5FMBA 3BTAA 2D5FA 1GZ9A 4ZU4A 5LA9A 1NA1B 2WRAA 2E51A 3AKSA 4YW6A 1V9U3 2RV9A 1LHVA 2NN8A 3R05A 3U0ZA 3OG2A 3PIJA 3I3DA 1YCIA 4RQPB 4AZZA 3WINE 4Z1VA 3OY8A 5FYVA 1UYZA 4AI2A 5KXEA 2R061 1VB2A 1JU3A 3S30A 4R52A 4JQTA 5ERLA 5FZ6A 2XLAA 5FZLA 1OA3A 2DURA 2DVGA 5EJ1B 2Y6FA 4LHKA 2QQWA 1OUXA 2X5IA 3B9CA 1OURA 4MOAA 2Y64A 2QQIA 3NNJA 3P3NA 3RQ0A 2BGOA 3T2PA 2WSUA 4Y1UA 2W94A 3ETQA 5J48A 5FXWA 2ZGMA 4FPFA 4Q0SA 1MS8A 3H8UA 4R9CA 2RE9A 1R092 3FMGA 4IUGA 4QKFA 4TLFA 2Q8OA 2QJVA 2W87A 3N4MA 4HKLA 3BU7A 3ZOIA 4LHSA 1W6MB 3GXUA 4QHOA 5BXXA 1Y9MA 3T4VA 4EN8B 4DUVA 4Y3OA 1V6JA 2GDFA 2GNDA 2HBTA 3BN6A 4B4RA 3T2TA 4NAOA 1SCRA 5APAA 3IDCB 5LBEA 2PA7A 2P6HA 3E5XA 5IK7A 3OD4A 5K9YA 1UZZA 1TEIA 5F39A 1OOPB 3D3AA 4DPNA 4YLZA 4PIZA 2YGMA 2Y6GA 2VMFA 2WNEA 3SITA 4MHRA 4K9SA 5JAXA 4I02A 5J1XA 3DL3A 1GOGA 3WDXA 3UETA 1O8SA 3B01A 4Y20B 2WQ8A 2XQRA 4GQ7A 1MS9A 5EP9A 2BU9A 1RUC3 2HWC1 3PVEA 5T5OA 5A3UA 1HB4A 2WS92 3BKZA 1OD3A 2BV4A 3WCRA 5A3WA 1VAKA 1JYIA 3ECQA 1FMD2 1VRBA 3C2UA 5GZFA 1VBD3 2ZTNA 3BALA 3I2GA 5E8AA 2P34A 4CXYA 2AACA 1O91A 1Y3TA 2VOXA 3OTFA 5F2SA 4NRQA 2FCTA 3AJZA 2C9AA 1JH5A 1XB9A 1QJX1 1UIKA 2DCZA 2V72A 3O1PA 2KD7A 3ATGA 3CU7A 3VBRC 5HCHA 4YM0A 1GZCA 2ZGQA 3M8LA 4XOGA 1QF3A 3ST7A 3VV1A 1OLME 1JOPA 4DUWA 1W6PB 1NA1A 2UURA 1ZRIA 4FTSA 4MGZE 1SZBA 4FTEA 1OQ1A 4RFT0 1LENA 3AYAA 4PDWA 3TEYA 3WHTA 5I0UA 3ZX7A 3VBUB 3IDAA 3M7AA 2GH8A 2ZHLA 2JDYA 2N7GA 4XACA 1UY1A 3AX4A 4Q4V3 4W4ZA 2JKXA 3CDZB 5BYNA 5A7WB 2VBPA 2HWC2 5FKBA 2JDZA 4YWAA 3PUSA 3WDUA 1XE8A 4XBNA 4XIKA 2B4KA 3ZXAC 4DNYA 3S7EA 1GZWB 4TLGA 5C6CA 2J1SA 3V0AA 1BMV1 1EYBA 1HRI3 3O12A 1CX4A 1F35A 4GH4C 2ILMA 4WVZA 4AFCA 4B1LA 1PVC3 4A6SA 4LPLA 4IEVA 3WXPA 4HPKA 2EF6A 1QOTA 1W6MA 5A3TA 1ASJ1 2DUQA 2RVAA 2VQTA 3IZOA 3MIDA 4GAZA 4XVHA 4EN7B 2BP6A 2DF7A 1H2KA 2JXAA 1AX2A 3IB3A 3WW4A 4IEPA 4XHBA 1YXWA 1E57A 1OKQA 1U5YA 3ROUA 3POFA 1POQA 3HJRA 4M3CB 2G1MA 1OOPA 1XC6A 2FZ1A 2XQXA 3WDWA 3OEBA 3GCWA 3DXUA 4TWTA 3J4UH 4ARYA 3PTRB 2IVJA 2VM9A 3VD9A 3S7IA 2JDPA 1A8DA 1CZVA 3NVCA 3N9MA 2G9FA 3JCIA 4LR4A 1RINA 4NAMA 3BI3A 4ZHNA 2FMYA 3CZUA 1H30A 1WCKA 2J22A 2ZGRA 4Y20A 5FBJA 1QH6A 4HKOA 4P02B 1RUH2 3WNLA 2A7AA 2HWB3 2P1BA 4Y24A 4EJRA 5GZCA 3SCFA 3VZNA 5J37A 5EYXA 1QJY3 3CZJA 3NNMA 4KI5M 4D3WA 5A7QA 2RMU3 1V9U1 4ES8A 2VVFA 3PUIA 4LE4A 1LHOA 3E6CC 1XNAA 4XBLA 1JXNA 1Y9QA 2B8MA 2IXHA 5JXGA 4M4PA 5L9VA 3VD4A 4L97A 3AFGA 3OOXA 1H4HA 1KJLA 4XUOA 3ZYGA 4OUEA 4AHZA 3GHMA 5FRAA 4KBBA 3ZR6A 4P08A 1SDDB 2RS53 1UNBA 2EXIA 2A6WA 5FYHA 1HQNA 3WUDA 4KWLA 4DEVA 4CZSA 4SBVA 1QQP3 2VXJA 3AKTA 2XG3A 2YBKA 4X8PA 3ZR5A 2WNUC 3UYJA 4D6SA 2EAAA 5FPAA 3RZLA 2J7MA 2JDHA 1AR61 1YYNA 4MV2A 5A80A 4CCLA 2WNVA 1NCQB 3E6DA 4CEWB 3HQRA 3U11A 1XBFA 1YFUA 2WO1A 3VZMA 3H1WA 3INAA 1N47A 3KV5A 5L73A 3ZXLA 3M3CA 1SFNA 2XJSA 5F2WA 1BBT3 4YZ5A 5IVCA 4LBQB 1RB8G 5H9RA 3O0XA 4HKWA 2GMEA 3GYDA 4IGPA 3USSA 3B9IA 4DO0A 2QQJA 1H6YA 4BQ3A 2JECA 2O0OA 1AVBA 1V9U2 3WR0A 2PQQA 4DIQA 4ASKA 2YGLA 1APNA 3ZKYA 2CU5A 2DTYA 4QKBA 4U2AA 4QKNA 4AGGA 4KU8A 3UL2A 2OUHA 3VDAA 2ZPXA 5KC5A 4QQLA 2ZCWA 2PAKA 3TN93 4CDXB 3ZYRA 2B5HA 1FX5A 2ES3A 4R8HA 3OUJA 1PMIA 4I2OA 3HEIA 4NHLA 1U12A 2X8KA 3WV6A 4BMEA 3MDPA 3R4DB 3M4FA 1PGL1 2W0XA 4MX3A 1VAMA 2NZ9A 3W5MA 5FFOC 5FXZA 4QGNA 3S5QA 2DFCA 4FQZA 3RFRA 2A6ZA 4CP2A 1J83A 4RGKA 2ZOEB 3GJAA 2JG9B 1UN1A 2LALA 1GWLA 1K5MC 3AP5A 1C57A 3PNAA 5J96B 2XONA 3AKQA 2Q8EA 3EBRA 3PVBB 4C0BA 3NRUA 1PMHX 2F6BA 1GWKA 2VY0A 4CDUA 1B35A 2NM1A 4C1XA 3AK0A 3SKJE 2WL1A 1UXXX 4ZU5A 1XNCA 2NMOA 3V64A 1HW5A 1OVSA 1S0GA 4QX7A 3O1VA 4AFBA 4AI9A 4I0BA 5ANNA 1LJ7A 2VTFA 1PGL2 2WT2A 3QLQA 1QDOA 2CGPA 5CB7A 1Y43B 2WAOA 4WVMA 1GZTA 1DYKA 1HN0A 1FAYA 4CYDA 3U4SA 4WV8A 5A3OA 2PTMA 2XOMA 5CNAA 4AFAA 3AM2A 5KBFA 4L9BA 2W95A 4FO9A 2R0FA 1RUC2 3OSDA 2E26A 3ZFFA 4O9GA 3SISA 1D4M3 2SLIA 1JODA 2ZGKA 2VAUA 3A0KA 3VBSA 3ZPOA 4BCUA 1N1TA 3S5AA 2B42B 1WCQA 3CMGA 1ULEA 2R7EB 4PHZA 4AHXA 4EQVA 4NIHA 2ZS6B 1GR3A 5IW0A 1I5PA 1VBD2 4XCBA 2FHRA 1F4HA 1NLRA 1HRI1 4FPGA 4U36A 3OD0A 4R4ZA 1PVC1 1RJ7A 4P9GA 4XHXA 4MVTA 4K40A 2A3XA 1N3QA 4IXLA 4XF1A 4JHZA 3J7MA 1TME3 5A6QA 4XDOA 1T2XA 4QQOA 4FSJA 2XVKA 3MLJA 3KVBA 1UPIA 2VOVA 4XTPA 5T54A 2BOJA 4CEYA 3BYWA 1AHSA 1OQEA 4CCCA 3ZN6B 4DRVA 3JXSA 4Q4V2 2XVLA 4CDXA 3O1MA 5DDJ3 3LEIA 3LCPA 1XYOA 3RI9A 3AB0A 4N53C 5F6KA 2R30A 2VMHA 4CDQB 4UW5A 4LT5A 3Q8FA 4IV1B 5ABJA 4B7KA 1W9TA 3I54A 1IS6A 4ISRA 4D0QA 1HRI2 3MIGA 4GH4B 4XJZA 4DXSA 1ZA7A 1WLCA 2PLV1 5HV4A 1CGPA 1EAH3 1PVC2 4OYUA 4YZ1A 2DBNA 2VUJA 3NJXA 3MF9A 4GWNA 1NX9A 5FTTC 5JIUA 1FT9A 4FPKA 3USUB 2DDUA 5JVVA 1LTEA 1Z7S3 2HWB1 2WFF3 5FYUA 4HK8A 4K7JA 3FLRA 3GBGA 2BDRA 4W65A 2WABA 4NHKA 4NPMA 5BUVA 5FLJA 3P6BA 4NJ4A 2GALA 4ITCA 2ZX4A 1VMJA 4BQYA 1H9PA 2RMU1 3I59B 5C9AA 1M06G 2KXLA 1HJFA 5J36A 5LEKA 1AR73 2VOTA 4META 5SV5A 1OF4A 3JQXA 5DG2A 5KXCA 2X5IC 3LA2A 1LGNA 4AEJA 1C4RA 1F31A 1X9PA 3T0AA 1UYXA 5C3SA 1QQP1 4QGLA 1UXZA 1PZ8A 4CP0A 3IDEA 2WIIB 3CJIB 4A4AA 5C8WA 2OUJA 2E7AA 5FYYA 4HT1T 2VZRA 3C7OA 3RJ2X 2XJUA 2R49A 5L9RA 4ASLA 4IERA 3V0BB 2CL2A 3WSOA 2XMLA 5JOYA 2HWB2 4QDQA 3AL6A 4Y4RA 1DCSA 2HWE3 4IGQA 4GALA 3LZZA 5F3GA 3KCYA 1BBT1 1UU4A 5C3QA 1NLQA 1RXGA 1QJY2 4XXPA 4R9BA 1T6GC 4HMZA 2RMU2 3RJRA 2R073 3MFAA 2G9ZA 5FZ4A 3JUUA 4B8EA 2VR4A 2XR4A 1Q3EA 1YHFA 4QU1A 5GKAC 4D7YA 4ET7A 2JICA 1DHKB 2R16A 1XPWA 3MUZ1 1F15A 1FOD3 3LDBA 2RS52 1HRV3 1RUJ1 4FXKB 4P00B 2GNMA 5FY7A 1QQP2 3JB4C 4AGVA 3UJQA 1Q8SA 1UKRA 1TE1B 1PIV3 1ULOA 5JZGA 1RVF3 1NYWA 3OF1A 4FOVA 4QB6A 3N36A 4Q4Y3 4EE2A 1OHFA 4D69A 4YGDA 3VHOA 1HJGA 2A73B 1GP6A 3W58A 4CDQA 4LHLA 1ULFA 1BBT2 1W9SA 1J3QA 4IV1A 3DEMA 2ZAAA 2ZHNA 3H8RA 1RYYA 3RZGA 2RM23 2W08A 2XGXA 3IPVB 4FPEA 2DCTA 1JYTA 1W0PA 1WZXA 2C5DA 1CONA 4CCEA 1UW8A 5FP3A 3KCCA 4QXHA 2IXIA 5A3NA 3DUIA 3KB5A 2ET7A 2VMCA 4DY3A 5JI9A 3ASIA 4BQXA 2NYYA 1AJKA 2BBVA 3USUA 3ZYHA 1NA1C 3TN92 1VBE3 4OI4A 4BDVB 5JSRA 1QDCA 4LNVA 3CQOA 4LBQD 2XPJA 2C9KA 4PDWC 1DZTA 1EP0A 1SLTA 2WZR3 4LJHA 1TQ5A 2HLEA 4LORA 1HIXA 4W6WA 4XYXA 2Q8DA 4BIOA 1LEMA 1R64A 1S0CA 4NUBA 3N9OA 1U5IA 4Q4W3 1W28A 4M00A 5GLUA 1ULDA 1J1TA 1PK6A 3VB9A 4AQSA 2E32A 1KS5A 3IAQA 4OZOA 5F1RA 2X29A 1MS0A 2HWD3 1JHNA 3KV6A 4DMIA 3RMYA 2VUAA 5T55A 2GP3A 1O8PA 4MADA 1K5MB 4UFLA 2A6XA 3SLIA 4ATEA 3THDA 4HETA 1S0EA 1BKZA 3FBMA 2WWUA 3T1MA 1G9BA 2K0GA 1O5LA 2ZZJA 2W2IA 3QH6A 1CAVA 1HN1A 1OLQA 3OYWB 4MLOA 1LOGA 3QD6A 5FY0A 2Q1ZB 4GWMA 3AZXA 5JXHA
chains in the Genus database with same CATH topology
1GBGA 4JQRA 2DWRA 2WWSA 1AJOA 1I3HA 5KHIA 3FLPA 1MZEA 1XQNA 1LULA 1WA4A 4EV0A 2XJPA 5JCTA 1OOPC 4Q26A 2DVDA 1NQJA 1NOVA 4JGYA 1UX6A 1H0BA 1AYM1 1X36A 1N1VA 4HVQA 5DDJ1 2XH6A 5ACA3 1D4M2 3E97A 2UYAA 4IETA 1YUDA 1ZBE3 4Y1XA 1RUF1 3VBFA 3JD73 2IXJA 4LO6B 5L19A 3MI8A 5CIRA 1D2SA 1QY4A 4AVCA 2Q1MA 1EAH1 2ZHMA 1JUIA 4LBLA 2BUKA 4BLJA 3ZSKA 2EXHA 4AK3A 4FAHA 3IT8A 4QPIA 1TME2 4L2NA 1QMJA 4N90A 1WW5A 4OZXA 1I1EA 5J09A 5GZEA 2AZ5A 3KT1A 2DYCA 2B7YA 1R1A3 4YYOA 3W59A 4QPGA 5DDJ2 3LOBA 1MZFA 4N53B 1O4ZA 5DXDA 1MZ5A 1NQDA 4B7EA 4FVVA 1BYHA 1WMEA 3O0WA 1I6XA 1XYNA 3G6JB 2WNVC 1BVP1 4Y5Z0 4OI2A 1VJ2A 2O1QA 1EAH2 5I93A 1J3RA 1S0FA 5FBZA 3U07A 3HT2A 1LODA 3MF6A 1Z7S2 5C4WA 2WFF2 2HWE1 3VZJA 2JEMA 3VZLA 4WZFA 3B5LB 3OY8B 1SFYA 3WD5A 4AE2A 2RHPA 3OYWA 2R071 3TNQA 1S0IA 4PIYA 1Z0HA 3AJYA 4RL7A 2WJSA 1QJU3 1AR72 2WLQA 4LUKA 2X5IB 1PHMA 1FOD1 4IEQA 4S2DA 2R043 4DQAA 1JBCA 3RI8A 4Y4YA 1AL0G 1X7NA 4PJYA 4GXLA 2PHXA 3M3EA 2Z2SB 4YW5A 2PHRA 3ZXDA 1PIV1 4A7ZA 1RVF1 5HCBA 1DIWA 3TOJA 3VBHA 1LU1A 5CFCA 1S2KA 1WBFA 1VIWB 2HWE2 3KS7A 3GHNA 3I8TA 1Q5OA 5I8SA 3WY6A 1QNWA 2VW2A 3GNEA 2RM21 1SBFA 1H8TB 5DZFA 2IXLA 1WD4A 2R072 2ZMKA 1J58A 4CDUC 4LUMA 1B35C 4XDQA 3P3PA 3FZ3A 4S2HA 4Q1PA 5FO7B 5JI7A 2HEYF 1CAWA 2WT1A 3ZMOA 3HWJA 3E5QA 1FOD2 1VBE1 2EALA 1HRV2 3MICA 3UV9A 3ZMNA 1AXZA 2W52A 3AFKA 4N9IA 4XF4A 2ZGNA 4OI0A 4IL7A 4YRDA 3WW2A 3WLUA 1LEDA 1PIV2 5T5PA 2AUYA 3WW3A 2XBO3 3NV1A 1RVF2 4Q4Y2 4UW4A 4Q4W1 3ZXFA 1AXYA 2D6LX 3AMQA 3CO2A 4XZPA 1ZREA 3VBSC 3KT4A 5GZGA 1YI7A 1H2NA 2CGOA 2RM22 5IK8A 1KQRA 1RTVA 3R0RA 4HK9A 4AXOA 2DV9A 5T5LA 2MHFA 4LEJA 2ARXA 1PZ9A 3OBTA 1AR83 2UY9A 5BNNA 3CLPA 4J6GA 1O3RA 5JWPA 1IKQA 2BEOA 3N7KA 2QKDA 1VBE2 2WT0A 4XFHA 4AHYA 1CAUA 4PDWB 2HWF3 3RMXA 2WZR2 3ZN5A 4E4DX 4CEYC 1SDWA 3V65A 2VGDA 2HEVF 2BW8A 4YSFA 1YLLA 3RS6A 4Q4W2 3FUOA 4CDXC 1ZNPA 2UYBA 1F2NA 2UWAA 2TEPA 1RHI3 5FDBA 2HWD2 5ABJC 5EV7A 4Z07A 3M1HA 5C8CA 3V0AB 5ACA1 5FOBB 1ZBE1 5LRRA 4NVPA 2K9ZA 4AVSA 4HN1A 1CVNA 5DUUA 2VMIA 3JU9A 4HPKB 2PHDA 3JD71 1MVQA 2JG9C 2C1FA 4TZDA 2WS91 1S0BA 1S1AA 3WOGA 1DF0A 1FMD1 1C5HA 3WP5A 1H8TA 1V6IA 2G4IA 1N3PA 1AR93 5C9AC 4XBQA 5GM0A 3ZSEA 1SMVA 2IFRA 3B93A 3WQ7A 1TMF3 2DVAA 2DVFA 3WG2A 4AF9A 4AVAA 3D82A 1ONAA 3ZDSA 5DUWA 4Y26A 4OVEA 2VQAA 1R1A1 3AP6A 5ACA2 5KHGA 4IEYA 3WHUA 1ZBE2 2WA4A 1QJZA 4H14A 2NP0A 1KFXL 4FAGA 1IKPA 1HDKA 1DQ2A 3JD72 2TUNA 2VNOA 3NSTA 4I3PA 4LLFA 4HSLA 2MEV3 4XMIA 1S0JA 4Z82A 4MZUA 3APBA 1FNYA 2P17A 2QZ2A 3JQWA 1IS4A 3LWCA 1IOAA 2GC2A 1JTZX 1DZQA 1XNDA 3MZHA 2ZX0A 2NLRA 4BA6A 1ZZ6A 2IZWA 1EY2A 1R1A2 2GN3A 5TSWA 3TNPB 5A3MA 1QJU1 2BNOA 4XFGA 2OZJA 4XF9A 3HT1A 5JZGC 4YM1A 1FV2A 3LA7A 2WNVB 4GIQA 1DGWA 3FJSA 2QE3A 2VNRA 3ZXEA 2GH2A 4CDQC 5HBAA 4IV1C 4NWVA 2AENA 2VOWA 5A3LA 2GNTA 4ZXKA 4QXKA 3S0MA 1ZBA3 4TYSA 3UKVA 1FNZA 1KJRA 1D0HA 3QBQA 4D7SA 1QXRA 3J8F3 2OZ6A 1RUH1 3DN7A 2ZAHA 3B7MA 2RJKA 1ZRRA 1QJU2 4P9YA 3WG1A 1SLBA 3ENRA 5J98B 2DCYA 4AVTA 3PMSA 4FPHA 4X6QB 2YPJA 4YFWA 1LR5A 1GQGA 2R042 3H50A 4WM8A 4AQTA 1W2UA 2RS33 2LM3A 3M3QA 3AZVA 5GLTA 3EHKA 1PK6C 4XF3A 1RC6A 2GC3A 1V6OA 1MVEA 1W6OA 5K0UA 1Q8VA 4MH0E 3WW1A 3DF0A 4AVBA 1DQ1A 3JZVA 5IK4A 4COUA 3LA3A 5BNOA 5K8SA 2SBAA 4IEXA 3AZZA 5EYYA 5GJ6A 3ALQA 3CJIC 3ILRA 3OGJA 5H9QA 5BPXA 3ZXKA 5AVPA 3BPZA 1UAIA 4CDUB 1B35B 3VUOA 5HCAA 1WW7A 2D40A 3HR9A 3A4UA 1AR81 4XFCA 4AI0A 3L2YA 4XETA 4F83A 5FO9B 1LHWA 3RYKA 1QH7A 4XMAA 3VDDA 2DU0A 3TB0A 4ZU7A 4KU7A 3TYJA 4WVMB 4PBPA 5K7PA 2XBO2 1ZVFA 3POYA 4JGYC 1LOAA 1ND2A 4WVVA 3ZFFB 4QGMA 3VBSB 2B45X 3BOWA 1NE6A 5EFUA 1RHI1 3HMYA 4I01A 5LK7B 2EXJA 4RD7A 2XB6C 3VBFC 2Z69A 4KQ7A 1XXNA 5H9PA 2WQ4A 3BCWA 2GC1A 1QNYA 4LA3A 1UMZA 4AG4A 1AR82 1H4GA 1LGCA 4MXWA 2WA3A 2ZZQA 4I09A 4QPIC 1IZ3A 2E6VA 3WNXA 1UU5A 4LLOA 2P3IA 2XJRA 5L7OA 2HWF2 4CEYB 1LOBA 5FLHA 1VBC3 4DXZA 2EXKA 2YROA 4RHV3 5CG8A 4QPGC 3D5OA 1MS5A 4Q0PA 1DGRN 1RHI2 1J1LA 4QT6A 1OFNA 4JVAA 4QMAA 3PVOA 5ABJB 1RL3A 4AGRA 1R083 1DQ0A 3NKGA 5CFDA 2FMDA 4MSVA 4ORFA 4BYYA 3IMNA 4EWDA 2ZGPA 3I4IA 4P9LA 3ILNA 2VNGA 3DPRA 4JDMA 1RUC1 2H0BA 2ZJCA 1BVVA 5C4WC 2MEV1 2PAMA 1YIPA 4IEUA 4LBMA 1VBD1 2ERFA 3ZSLA 5C9AB 1AR92 1Q8QA 1DGRA 2ZGLA 3AMMA 4LTAA 2QQPA 1FI2A 4QD2A 4QQ2A 1NZCA 1TMF2 5FOJB 1XNBA 4IEZA 4OUSA 4Y1VA 1RUG3 1YRZA 2JG8A 3K48A 2WFPA 2YZ4A 3PLQA 1D0GA 2D6MA 3LSEA 2GMPA 1U5ZA 4CDWA 3ZVXA 4Q4V1 1QHDA 4X8NA 3VBHC 3NV4A 3CNAA 5CFCC 2H6CA 4H7LA 2ZGTA 1FV3A 1UF2C 2MEV2 4Z92B 3AYEA 1F8VA 4P9WA 4GULA 2IFWA 4G4FA 5I8TA 1YJLA 4LBOA 1WCDJ 4XJWA 2R6QA 5FCCA 3KQRA 1L3JA 1O3QA 2CWMA 2BWCA 2Q5TA 1A78A 1AX1A 2F4PA 3GF6A 1G86A 3J8F1 4PF5A 2JD4A 4MUVA 1GQHA 4BIFA 1W39A 3WQ0A 2OPKA 2YHJA 3PHMA 2O8QA 3J26N 5BNPA 1WD3A 3M3OA 4D7TA 3D6EA 5JZGB 4YVWA 5EJ3A 1ENRA 3SH5A 4LHNA 1BCXA 3MFCA 3URFA 4IESA 4DINB 2BFUS 3KD4A 2BFUL 4Q27A 1NLSA 2XVGA 4SLIA 1EPWA 2PFWA 4FT8A 2JE7A 1H9WA 1ZBA2 3AMNA 2HKXA 4A2UA 1W6NA 5L36A 3J8F2 4IV3A 5BNNC 1H1IA 1RGSA 1S0DA 2BQPA 1AF9A 4H3WA 2XJVA 4AVVA 3C3VA 1DGLA 4R4XA 1VALA 1QJY1 2AH2A 1MACA 5KXBA 2GN7A 1AL23 1WUVA 4BMBA 3RYRA 3WDTA 4TSVA 2RS32 1PK6B 1V6KA 4AQ6A 1ZRDA 1LU2A 2RS13 4XQDA 2RS51 3B02A 1O4YA 3NV2A 5C8CC 4MXVA 4FOQA 3KZ4C 1WLDA 4X6RB 4H55A 1CAVB 2GAUA 2LUWA 4EN6B 1J59A 3NJZA 2Q4SA 4Y22B 1RITA 3M70A 3MIHA 1G9DA 4NOTA 4KG0A 1H8TC 1ENSA 2DTWA 1UCXA 4Z8BA 2VXRA 1IGOA 5BV6A 4ES9A 4JGYB 1RJ8A 1RMU3 4IEOA 5LK5A 3TN91 2ZBJA 4DY5A 2VOKA 4RHV1 3FHIB 1KFUL 4QHBA 4YZ4A 5BY5A 1AUYA 4FOYA 1BZWA 1LCLA 4XJ8A 4MYEA 1SACA 3LOIA 4N43A 4AQ2A 3VBFB 1H1MA 1YWKA 1R081 1ND3A 2YMZA 1MR5A 3N7LA 1C8NA 1BJQA 3H3ZA 1FPN2 1LHNA 1IS3A 2GZWA 5D8AA 3ELNA 1NG0A 2D3RA 4FCAA 1VB4A 5FQ0B 2AREA 2CAUA 3IBMA 4FXGB 4QPIB 1JW6A 5F6LB 2CNAA 1RUD3 2BTVC 4OLLA 4PBOA 1EPZA 1PNFA 2A71A 2D98A 1WW4A 1O7FA 1MS3A 5BNQA 2D3PA 1VBC2 2YC0A 1ZZBA 1HQLA 3N7JA 4K3UA 4RHV2 1LRHA 4QPGB 4YW4A 3NWKA 1OPOA 3RZZA 3SNMA 1YFXA 1SBEA 5I0SA 4AHWA 1PO23 1XU1A 2BNMA 4KNCA 4RGAA 5CAZA 3KSCA 5KHJA 1R082 1GANA 2VQ0A 4YGCA 5KWRA 3WT3A 1NY72 4OFGA 1C1LA 1SLLA 4OUMA 4GB33 4J1WA 5I0RA 5H9SA 2AGSA 3KM5A 5GLZA 2OW4A 1BK1A 5C4WB 1A6CA 1D4M1 1HX6A 3CEWA 2I2SA 4J1XA 3ZFEA 5AFEA 4HFSA 3WX5A 4Y22A 2PHUA 4OHXA 2GSYA 5GLVA 4CRQA 1HXS3 1RUG2 1TNRA 4NR1A 1H2MA 1UKGA 2EIGA 3GZTB 1TME1 1UL9A 4WM8C 2QNKA 4XJ9A 1POV0 4NHMA 4WBBA 1HV1A 2PHTA 1QWRA 1KITA 3VBOA 1CPMA 3TBDA 3VBHB 5CFCB 2QCSB 1M4WA 5K0UC 3KCXA 1UZYA 3IWZA 1LOCA 1GLHA 5J3UA 5T5JA 1COV3 4WZCA 1J3PA 2DCKA 1ZA4A 4BH9A 4F8AA 1LOFA 2R063 2XKPA 1CAXA 3WP4A 1HV0A 1CAWB 1X82A 4QPYA 5FQ0A 1DZRA 3X29B 1Z7S1 2WFF1 3VDDC 4UXAA 2WLPA 1YFYA 5T52A 4N7IA 4IEWA 2ZHKA 1ZZ9A 4BLIA 2MNGA 1AL21 3HAGA 4L92A 3WP6A 2B39A 4AEDB 5AFBA 1U5XA 1ND2C 4LO7A 3WZ1A 3WG4A 1AR71 1OLRA 5DUXA 3K51A 2AR6A 1OA2A 2I45A 2RS11 5FO8B 3VZOA 4P9XA 2A6VA 4E2GA 4LO5B 3NL1A 4L99A 1GFF2 3RSJA 2YUEA 1GNHA 5BNNB 1QU0A 3AKRA 4Q4X3 1AXKA 5A32A 1WGPA 2Y0OA 3WVJA 2QDNA 1POV3 1CAUB 4E2SA 5L7OC 4Y1ZA 5FMOS 2PHFA 1AL22 4EN0A 5FMOL 3DKWA 4PLOA 3D0SA 1ULGA 1LOEA 1WLTA 4EROA 1WLWA 3ES4A 5F9TA 4L8QA 4FBFA 1LHUA 4GA9A 1RMU1 4Q1RA 2RS12 5A33A 3E5UA 1HRV1 1UD1A 4FQ4A 2IXKA 5E88A 5C8CB 3AKPA 1OMIA 3MYXA 4RS5A 1OA4A 5CFDC 3SHRA 4JGZB 1QJX3 1GSLA 1PNGA 4Q4Y1 2R0HA 4K8FA 4GKYA 3DPRC 2HJIA 2P3KA 2DUPA 5JR7B 2V73A 2ZX2A 3R4UA 4E2QA 2VVEA 4RSUA 2E63A 4UBHA 2YDEA 1RUD1 1ENQA 3NW4A 4OULA 1RUE3 1ZZCA 4DS0A 2FBEA 1RMU2 2JG8C 4YNIA 5E89A 4I0WB 2WZPP 2PHWA 4BOWA 3ES1A 2WZR1 4E4ZA 2DUOA 1H2LA 1G9FA 4AEDA 2XWJB 3CF6E 4UW6A 4AFMA 1BEV3 5HI0A 2BGCA 1ASJ3 1C8M3 3ZFFC 1N1YA 3WCSA 3MW2A 4G3YC 2HWD1 1PGSA 3RPQA 2UWCA 1G7YA 2WINB 3OBRA 4YM2A 1RUD2 3ZIWA 3ZN4A 4B4PA 3DV8A 2D6PA 3VKOA 1ALYA 2GC0A 2QZ3A 5JIAA 1VBA3 1DLLA 3ZFGB 1CQ9A 3R4SA 1CJPA 5LEJA 5I8YA 1FYUA 2DVBA 1PO22 4F7ZA 2CY6A 1N3OA 4YVWC 2I07B 5KC6A 1CPNA 2R32A 1FXZA 4PCRA 2VULA 1X50A 4JDOA 4GB32 4YG0A 2D3SA 1WMFA 5JPMB 3H3UA 2OIIA 3S6PA 3PVNA 4HZFA 4LBJA 4YW3A 5HCFA 3MLKA 5T3NA 3ZSJA 4KL1A 4JGZA 4B29A 1COV1 1TNFA 2VU9A 2WSVA 1ZZ8A 5CADA 4IV3C 4LO4B 3WUCA 2ZABA 4A3XA 1IS5A 4BM8A 2P3JA 2RJLA 4E27A 5JOWA 2YXSA 3HD8B 5DZEA 1HXS2 4Q0VA 1LECA 5JSPA 4GKXA 4BWOA 4JTNA 3MGUA 4WM8B 5FREA 5IT6A 1AR63 4HBNA 3AXDA 3MW3A 3MLLA 4N7UA 5EZWA 1QGLA 1GYKA 3SH4A 1YJKA 3KLSA 4L11A 3SXWA 3QOPA 1KXGA 1V6NA 1W6OB 4QQPA 3PMEA 5DG1A 5K0UB 2VW0A 1DFQA 4YARA 5BNOB 4FPLA 4ZKTB 5GALA 1COV2 3NO8A 1QOSA 2PELA 5C33A 1CR7A 5I0TA 2R062 1RUI3 1DQ4A 1XU2A 4YVSA 3FWEA 4WM7A 4YG3A 2CYFA 2OYZA 2PAEA 4XPVA 4Q4X1 1QXPA 3VDDB 4XFIA 4R9AA 5KXDA 3H7YA 2ETEA 2E7TA 2D6OX 1POV1 2V09A 5E16A 3T1LA 4NPRA 2PYTA 4COWA 1Y7BA 1ND2B 4PQ9A 4XJAA 4AYUA 4KGQA 3ZFGA 3NAPA 1MQTB 2ZGOA 2JE9A 2YV8A 3EJKA 2E53A 2A6YA 1PGW1 2CGNA 4N43C 2R041 3ILFA 4GMP0 3LKJA 3VL9A 3POWA 1ND3C 1WBLA 3EQEA 1Q43A 3VKMA 4O9EA 5D8AC 4MXWB 3N35A 2UWBA 5FPXA 1I9RA 2YY1A 4Q4X2 2ARBA 4HLTA 1KS4A 2CV6A 4RQPA 5L7OB 4M0NA 5CBLA 2D5HA 3ZIXA 4ISQA 3AP9A 1LKNA 1GV9A 1RUE1 2CTVA 2LTNA 4QU2A 2H6BA 4BHPA 2NMNA 1PGW2 2OVUA 5JMCA 4M3CF 4K21A 1NCRB 3W9AA 3ZXJA 5CFDB 2XBO1 1IPKA 1EV13 1QJX2 3QACA 5JLVA 3FLTA 4Q29A 1BEV1 4COZA 3DPRB 1C8M1 3POSA 5DUVA 3VL8A 2EAKA 4MGKE 4Q0QA 4DRRA 1SLIA 3HBZA 3WQ1A 2FQPA 2Y38A 2HEWF 3ZFEC 2VG9A 4FP2A 1RUE2 1QXJA 1CESA 2JG8B 1VBA1 1VRH3 3OPZA 4GMP3 3D0JA 1BMV2 3H0OA 2CAVA 2D6NA 1REEA 2HWF1 4JCKA 2PLV3 1JN2P 3VBOC 4CDWB 1BEV2 3MPPG 2D44A 1ASJ2 4JRLA 1MQTA 5CG9A 1C8M2 2Y0IA 4MGIE 3MIEA 3CL1A 3JBG3 5I91A 2ZMNA 1VR3A 1B09A 1NXMA 1Q8PA 2NPIA 1LOFC 2MPFA 4B4QA 4XFBA 3RDIA 1VP6A 1G9CA 1FPN3 3TRSB 1CIWA 4RR3B 4YZ3A 3PTYA 4P14A 4LULA 1W6PA 1VBA2 2QDRA 4RGGA 4A7YA 4E9KA 3FE5A 3ZYIB 1LB2A 3AMPA 5BNPB 4NWWA 4LBNA 3L9JT 1SCSA 4YVWB 3VBUA 2KA3A 1AR91 2BNNA 4YGBA 4OHWA 4W6XA 3B69A 3UJOA 4K6BA 2WC2A 1TMF1 3GBFA 2ZKNA 3I2DA 2AYHA 4KGGA 1JUHA 3VLBB 3VN4A 3ZPYA 4Q0UA 2RR13 1GZWA 3AYCA 2C0ZA 1S2BA 1NCRA 2XJQA 2QFEA 1SEFA 4YW1A 5LRSA 1YO8A 1W6NB 2Q30A 2TNFA 1OQDA 1WCSA 5T50A 4IV3B 4YM3A 1ULCA 1AX0A 1LGBA 4AEMA 1RUI1 3SCHA 1UIJA 2PHLA 3L2HA 4M0HA 5JSOA 4XQ4A 3BIWE 1RUJ3 1MS4A 1YFWA 4YZ2A 2GU9A 2KM2A 4C1WA 2XLFA 2YYOA 3N7MA 1SBDA 1DGWX 4M3CA 3EO6A 1AR62 4F3JA 1DYPA 1C1FA 3B00A 3O5SA 2ET1A 5IUQA 3AYDA 2E7QA 4FPJA 4C90A 3UKNA 3RG0A 4Q2FA 2CWSA 1Q8OA 2UY8A 1YIFA 4RS5C 4QM9A 1C28A 3O0VA 1V6MA 5DZGA 1PO13 3FUQA 5IK5A 4AW7A 1RUI2 1DBNA 4DOUA 1FATA 5EWSA 1A3KA 3D4KA 4I30A 2VECA 2Q0AA 4JAAA 4XEZA 1IQAA 1I5ZA 5GLWA 4HN0A 4LBKA 2VMGA 3KGZA 3LGRA 4FTBA 3O14A 3IDBB 1ZBA1 1URXA 4RR3A 2W39A 4QX5A 1O3SA 1QKQA 4EWEA 2ZACA 1C5IA 4Y1YA 1ZZ7A 2B9UA 2ZGUA 5CVRA 4XIOA 1KDMA 3LSDA 4N43B 4AFDA