1W3FA

Crystal structure of the hemolytic lectin from the mushroom laetiporus sulphureus complexed with n-acetyllactosamine in the gamma motif
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
312
structure length
312
Chain Sequence
DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFEDMSIDKIEYDLKDGRILSSTPNVLATQTLENTSSQTQEMSFNLSQTLTQTSTFAYTAGFTIAVGTAFKAGVPIFAETEFKVDISVDNQWNWGEENTFSKTYTATFSVRAGPGETVKAVSTVDSGIINVPFTAYLSSKSTGFEVTTEGIWRGVSSWDLRHTLTSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYTIC LECTIN FROM LAETIPORUS SULPHUREUS
publication title Structural Analysis of the Laetiporus Sulphureus Hemolytic Pore-Forming Lectin in Complex with Sugars
pubmed doi rcsb
molecule tags Toxin/lectin
total genus 60
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03318 ETX_MTX2 Clostridium epsilon toxin ETX/Bacillus mosquitocidal toxin MTX2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1w3fA01
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1w3fA02
1AVUA 3ZJXA 4P0LA 1Z4SA 3CA0A 3H6RB 3MALA 4F83A 8I1BA 3N7JA 4I7IA 3C0OA 2Q9XA 3OJMA 3POKA 4ZA3B 3FJ9A 3O4BA 2AAIB 1PZZA 2D23A 4ENDA 3F62B 4LO2A 5BXTA 4JRAA 4Q9GA 4LO1C 1AF9A 1RG8A 4A7KA 1E0OA 1BA7A 4G9NA 4D0TA 3FFZA 2WBCA 4HA2A 1DIWA 5F8WA 1Z52A 3UJ4A 5BQUC 2UUSA 4I4VA 1TWEA 2D43A 2NZ9A 3WINC 2FGFA 4DEPA 4I2SA 1ISXA 4Z9WB 3V0AB 4FVVA 1ISZA 31BIA 3A23A 3IM7A 3FJAA 3AZWA 4I6IA 1ILR1 1IILA 1JLYA 3H6SE 4J2XA 1IOBA 2F2FA 2VLCA 4I3NA 3ZXDA 3CQAA 1BFFA 4DENA 5GAQA 1UPSA 4ISRA 4I37A 5F8SA 3IIRA 3JUTA 3WO4A 3C9ZA 4GP0A 4X37A 4LO8B 3FJIA 3PG0A 5EG6C 1WD4A 2FFVA 3PUBA 4GOVA 3AKFA 5BVPI 2BEAA 3FJFA 3BTAA 4OUJA 1XYFA 2KI4A 2WRYA 3FJDA 1SZ6B 1IJTA 3FJBA 4JKXB 3NBDA 4QALA 1MC9A 3VSZA 3VT0A 3VWCA 5FZZA 4QBCA 3VUOA 4OWLA 1Q03A 2Z48A 1BFCA 3QYDA 3Q7WA 1T9FA 3R4SA 1K5VA 3O3QA 3V0BB 2XOAA 1KNMA 1WBAA 1R8OA 4I96A 4ZBVB 5BXSA 2ZQNA 3G4NA 1AFCA 1HWOB 3UD7A 1PWAA 3A21A 5DZUA 4I4RA 1Z0HA 3ZXGA 3HALA 2K8RA 3OGGA 2VXRA 2NTDA 1PUUB 5BOWA 5FNXA 1TIEA 3CRGA 1IRAX 2K4AB 3FUOA 4X38A 1TTUA 1M2TB 3WINA 1FWUA 3BAGA 3N7KA 4J2YA 4P6AA 3ILAA 3CA6A 1BFGA 1DZCA 2ZQOA 5EC5A 4D8HA 4GOYA 2ZR1B 1DQOA 2D7RA 2GO2A 1P63A 1L2HA 1ABRB 4XKIA 3FUQA 4YOLA 3RTJB 4J2KA 4I1EA 3FJ8A 1QQLA 4I4QA 5G00A 5BP5C 2R9KB 3BAHA 2Y9XE 3ZC8A 3UD9A 1XHBA 1AVWB 4GAIA 1G9BA 1I1BA 1JT7A 1D0HA 3N0KA 1YTOA 3RMYA 1W3AA 4A7ZA 3OBRA 1FV3A 1S0DA 1YYNA 1YXWA 4I4SA 1T4QA 2FDBM 4QBVA 5JMCA 3AH4A 1W3GA 3BA7A 3CAHA 1V6XA 9ILBA 3C0NA 4R6UB 3I29B 1IRPA 4AN7B 3Q7YA 4QKRA 2DRZA 3P53A 3HBWA 3BADA 3OGFA 1HIBA 4FGFA 3UDAA 3PMEA 1IHKA 1Q04A 2BEBA 3O49A 3UD8A 1G9AA 4I4XA 2MLLB 1FN0A 3BA4A 1DJSB 4LO0C 1CE7B 3HN1A 4IY8A 3MPPG 1TP0A 2QYIB 5F90A 2P23A 1HKNA 4I4PA 3CRHA 4LO3C 2HWMA 5F8YA 2E4MA 2Y9GA 1SR4A 4II0A 1FMMS 1RMLA 1BASA 4I4OA 21BIA 1I1EA 4Z8SB 3P6JA 2K43A 3A07A 1EPWA 1IT0A 1FWVA 4JAWA 1ONKB 1AVAC 3WA1A 2IHOA 3B9UA 1S0BA 1PUMB 2Y9FA 1HWMB 2Y9WC 2VXTI 3AZVA 1J0SA 1ISYA 4EFRA 3O4DA 4IHZA 4ZKTB 4QD2B 4H9WA 4JKQA 4JP0A 3JRRA 3Q7XA 3BAQA 2Q3NB 4I0YA 2J3PA 4QD2C 2L5XA 4L4HA 3H6RA 1RY7A 3HSMA 4EFPA 2VUAA 3OJVA 1S0LA 5D62A 3FJEA 4D0ZA 2D24A 3CU1B 4L4IA 3VT2A 4WBCA 1NZKA 2HW9A 2F8XC 2D1ZA 3BAVA 4XFUA 3G4OA 4LO2C 4I8MA 1WD3A 1EVTA 4LO1A 4X3AA 1HCEA 7I1BA 4G6JA 1FV2A 1S0EA 3CA4A 3IM6A 1YBIA 3RTIB 3HMYA 2FO1A 2ESUA 3O4CA 3BRDA 5BXRA 1HCDA 1JT5A 5BQUA 4OEEA 3I2AA 1TWMA 2P39A 3KMVA 1EV2A 1FQ9A 4G6MA 3NJ5A 4ZFWB 3FGMA 1YF8B 1Z2VA 2D7IA 2KI6B 1ISVA 3CA5A 1BFBA 3V0AA 3AKHA 5HPZA 4Q91A 2AXMA 1AXMA 3WO3A 1ITBA 3EF2A 3WO2A 3P6IA 3BX1C 3AH2A 2F2FC 1WBCA 4LO7B 3BRGC 3O4OA 3NBCA 1ISWA 3NBEA 3O44A 4GP3A 3FJKA 4DCKC 1TOOA 1PC8B 3K1XA 4P0KA 3W9TA 4X39A 3HOMA 1DQGA 4I4UA 1JQZA 3CA3A 2M49A 3NBNA 3BB2A 4P0JA 1FMZA 1DZDA 4KEJA 3T8SA 4ZFYB 3AKIA 2KLLA 3RSJA 2D42A 1DLLA 1XZZA 3RMXA 2DREA 4EEEB 4TLPA 2X2SA 3BA5A 1JLXA 2RQ9A 1GGPB 3UJ0A 2QN4A 2Z49A 4IYBA 1EYLA 4G1RA 4KEKA 2HZ9A 4H04A 1VCLA 6I1BA 4OW4A 1V6UA 5BXPA 2KKIA 2NM1A 4IY9A 1FGAA 3V0BA 2LIEA 3IAGC 2X2TA 4QO3A 5EHAA 4ZFUB 1G82A 4USPA 3FJCA 3A22A 3AJ5A 1JT4A 2AFGA 2DRYA 4IZEA 3TC2A 5I1BA 4JQ0A 2BFHA 1S0CA 1S0FA 4IQPA 2NP0A 3C0MA 3R4UA 4G9MA 4ZOTA 1RZOB 2MIBA 3LTQA 2FFUA 1G9CA 4CJMA 1BLAA 4I1BA 2NVHA 2VU9A 3VSFA 4IZXA 4OEFA 1OQLB 1QQKA 3S8KA 5FZUA 4EFQA 1XG6A 3N7MA 3WMUA 1R8NA 4A7YA 1W3FA 1G9DA 2VSEA 1K5UA 2AQZA 2ET2A 3V79C 5B2HA 4KBBA 2LIQA 3FJJA 3S8JA 3LLPA 5DSSB 5BP5A 4KEIA 5D63A 4QC4A 3WMVA 3BAOA 2MC2A 4EKXB 2YUGA 3AJ6A 2ERMA 1N4KA 3IM5A 1Q1UA 4EB2B 4HR6C 1QXMA 3SNVA 1II4A 1TFMB 3OBTA 4PC4A 4XFSA 4F34A 4ISQA 4IONA 3H6QA 4OEGA 4ZLBB 1NUNA 2GZBA 3VEQA 1BARA 4I4YA 1AVXB 3VT1A 5FZYA 3FJHA 3BRFA 3CRIA 1DFCA 3AKGA 2RSTA 4J2SA 3E8LC 1V6VA 1S0GA 5E24E 2KH2A 3F1RA 4GAFA 1HWNB 1A8DA 1BLDA 1JTCA 2D44A 4LO0A 2I1BA 2D20A 5D61A 4JPZA 2VSAA 4Q9PA 3D7WB 3OJ2A 1UYJA 1PREA 3ZC9A 4OWJA 2HWAA 4LO3A 3I2XA 3PHZA 1V6WA 1HWPB 2D22A 4QKSA 1CVSA 41BIA 1DFQA 4HJJA 4LO7C 2E4MC 1SR4C 5JLVA 1M16A 2NYYA 1F31A 5DUYA 3BAUA 3N7LA 4USOA 4OWKA 3CA1A 3QR5A 4KC3A 5FNWA 3ZX7A 4AN6A 2IWTB 4J23B 2RG9B 2DS0A 1MD6A 3O4AA 3AH1A 1JY0A 4ZGRB 4XFTA 1JT3A 3O5WB 5DVHA
chains in the Genus database with same CATH superfamily
1AVUA 3ZJXA 4P0LA 1Z4SA 3CA0A 3H6RB 3MALA 4F83A 8I1BA 3N7JA 4I7IA 3C0OA 2Q9XA 3OJMA 3POKA 4ZA3B 3FJ9A 3O4BA 2AAIB 1PZZA 2D23A 4ENDA 3F62B 4LO2A 5BXTA 4JRAA 4Q9GA 4LO1C 1AF9A 1RG8A 4A7KA 1E0OA 1BA7A 4G9NA 4D0TA 3FFZA 2WBCA 4HA2A 1DIWA 5F8WA 1Z52A 3UJ4A 5BQUC 2UUSA 4I4VA 1TWEA 2D43A 2NZ9A 3WINC 2FGFA 4DEPA 4I2SA 1ISXA 4Z9WB 3V0AB 4FVVA 1ISZA 31BIA 3A23A 3IM7A 3FJAA 3AZWA 4I6IA 1ILR1 1IILA 1JLYA 3H6SE 4J2XA 1IOBA 2F2FA 2VLCA 4I3NA 3ZXDA 3CQAA 1BFFA 4DENA 5GAQA 1UPSA 4ISRA 4I37A 5F8SA 3IIRA 3JUTA 3WO4A 3C9ZA 4GP0A 4X37A 4LO8B 3FJIA 3PG0A 5EG6C 1WD4A 2FFVA 3PUBA 4GOVA 3AKFA 5BVPI 2BEAA 3FJFA 3BTAA 4OUJA 1XYFA 2KI4A 2WRYA 3FJDA 1SZ6B 1IJTA 3FJBA 4JKXB 3NBDA 4QALA 1MC9A 3VSZA 3VT0A 3VWCA 5FZZA 4QBCA 3VUOA 4OWLA 1Q03A 2Z48A 1BFCA 3QYDA 3Q7WA 1T9FA 3R4SA 1K5VA 3O3QA 3V0BB 2XOAA 1KNMA 1WBAA 1R8OA 4I96A 4ZBVB 5BXSA 2ZQNA 3G4NA 1AFCA 1HWOB 3UD7A 1PWAA 3A21A 5DZUA 4I4RA 1Z0HA 3ZXGA 3HALA 2K8RA 3OGGA 2VXRA 2NTDA 1PUUB 5BOWA 5FNXA 1TIEA 3CRGA 1IRAX 2K4AB 3FUOA 4X38A 1TTUA 1M2TB 3WINA 1FWUA 3BAGA 3N7KA 4J2YA 4P6AA 3ILAA 3CA6A 1BFGA 1DZCA 2ZQOA 5EC5A 4D8HA 4GOYA 2ZR1B 4MZGB 1DQOA 2D7RA 2GO2A 1P63A 1L2HA 1ABRB 4XKIA 3FUQA 4YOLA 3RTJB 4J2KA 4I1EA 3FJ8A 1QQLA 4I4QA 5G00A 5BP5C 2R9KB 3BAHA 2Y9XE 3ZC8A 3UD9A 1XHBA 1AVWB 4GAIA 1G9BA 1I1BA 1JT7A 1D0HA 3N0KA 1YTOA 3RMYA 1W3AA 4A7ZA 3OBRA 1FV3A 1S0DA 1YYNA 1YXWA 4I4SA 1T4QA 2FDBM 4QBVA 5JMCA 3AH4A 1W3GA 3BA7A 3CAHA 1V6XA 9ILBA 3C0NA 4R6UB 3I29B 1IRPA 4AN7B 3Q7YA 4MZHA 4QKRA 2DRZA 3P53A 3HBWA 3BADA 3OGFA 1HIBA 4FGFA 3UDAA 3PMEA 1IHKA 1Q04A 2BEBA 3O49A 3UD8A 1G9AA 4I4XA 2MLLB 1FN0A 3BA4A 1DJSB 4LO0C 1CE7B 3HN1A 4IY8A 3MPPG 1TP0A 2QYIB 5F90A 2P23A 1HKNA 4I4PA 3CRHA 4LO3C 2HWMA 5F8YA 2E4MA 2Y9GA 1SR4A 4II0A 1FMMS 1RMLA 1BASA 4I4OA 21BIA 1I1EA 4Z8SB 3P6JA 2K43A 3A07A 1EPWA 1IT0A 1FWVA 4JAWA 1ONKB 1AVAC 3WA1A 2IHOA 3B9UA 1S0BA 1PUMB 2Y9FA 1HWMB 2Y9WC 2VXTI 3AZVA 1J0SA 1ISYA 4EFRA 3O4DA 4IHZA 4ZKTB 4QD2B 4H9WA 4JKQA 4JP0A 3JRRA 4UY4A 3Q7XA 3BAQA 2Q3NB 4I0YA 2J3PA 4QD2C 2L5XA 4L4HA 3H6RA 1RY7A 3HSMA 4EFPA 2VUAA 3OJVA 1S0LA 5D62A 3FJEA 4D0ZA 2D24A 3CU1B 4L4IA 3VT2A 4WBCA 1NZKA 2HW9A 2F8XC 2D1ZA 3BAVA 4XFUA 3G4OA 4LO2C 4I8MA 1WD3A 1EVTA 4LO1A 4X3AA 1HCEA 7I1BA 4G6JA 1FV2A 1S0EA 3CA4A 3IM6A 1YBIA 3RTIB 3HMYA 2FO1A 2ESUA 3O4CA 4MZFB 3BRDA 5BXRA 1HCDA 1JT5A 5BQUA 4OEEA 3I2AA 1TWMA 2P39A 3KMVA 1EV2A 1FQ9A 4G6MA 3NJ5A 4ZFWB 3FGMA 1YF8B 1Z2VA 2D7IA 2KI6B 1ISVA 3CA5A 1BFBA 3V0AA 3AKHA 5HPZA 4Q91A 2AXMA 1AXMA 3WO3A 1ITBA 3EF2A 3WO2A 3P6IA 3BX1C 3AH2A 2F2FC 1WBCA 4LO7B 3BRGC 3O4OA 3NBCA 1ISWA 3NBEA 3O44A 4GP3A 3FJKA 4DCKC 1TOOA 1PC8B 3K1XA 4P0KA 3W9TA 4X39A 3HOMA 1DQGA 4I4UA 1JQZA 3CA3A 2M49A 3NBNA 3BB2A 4P0JA 1FMZA 1DZDA 4KEJA 3T8SA 4ZFYB 3AKIA 2KLLA 3RSJA 2D42A 1DLLA 1XZZA 3RMXA 2DREA 4EEEB 4TLPA 2X2SA 3BA5A 1JLXA 2RQ9A 1GGPB 3UJ0A 2QN4A 2Z49A 4IYBA 1EYLA 4G1RA 4KEKA 2HZ9A 4H04A 1VCLA 6I1BA 4OW4A 1V6UA 5BXPA 2KKIA 2NM1A 4IY9A 1FGAA 3V0BA 2LIEA 3IAGC 2X2TA 4QO3A 5EHAA 4ZFUB 1G82A 4USPA 3FJCA 3A22A 3AJ5A 1JT4A 2AFGA 2DRYA 4IZEA 3TC2A 5I1BA 4JQ0A 2BFHA 1S0CA 1S0FA 4IQPA 2NP0A 3C0MA 3R4UA 4G9MA 4ZOTA 1RZOB 2MIBA 3LTQA 2FFUA 1G9CA 4CJMA 1BLAA 4I1BA 2NVHA 2VU9A 3VSFA 4IZXA 4OEFA 1OQLB 1QQKA 3S8KA 5FZUA 4EFQA 1XG6A 3N7MA 3WMUA 1R8NA 4A7YA 1W3FA 1G9DA 2VSEA 1K5UA 2AQZA 2ET2A 3V79C 5B2HA 4KBBA 2LIQA 3FJJA 3S8JA 3LLPA 5DSSB 5BP5A 4KEIA 5D63A 4QC4A 3WMVA 3BAOA 2MC2A 4EKXB 2YUGA 3AJ6A 2ERMA 1N4KA 3IM5A 1Q1UA 4EB2B 4HR6C 1QXMA 3SNVA 1II4A 1TFMB 3OBTA 4PC4A 4XFSA 4F34A 4ISQA 4IONA 3H6QA 4OEGA 4ZLBB 1NUNA 2GZBA 3VEQA 1BARA 4I4YA 1AVXB 3VT1A 5FZYA 3FJHA 3BRFA 3CRIA 1DFCA 3AKGA 2RSTA 4J2SA 3E8LC 1V6VA 1S0GA 5E24E 2KH2A 3F1RA 4GAFA 1HWNB 1A8DA 1BLDA 1JTCA 2D44A 4LO0A 2I1BA 2D20A 4H75A 2NS2A 5D61A 4JPZA 2VSAA 4Q9PA 3D7WB 3OJ2A 1UYJA 1PREA 3ZC9A 4OWJA 2HWAA 4LO3A 3I2XA 3PHZA 1V6WA 1HWPB 2D22A 4QKSA 1CVSA 41BIA 1DFQA 4HJJA 4LO7C 2E4MC 1SR4C 5JLVA 1M16A 2NYYA 1F31A 5DUYA 3BAUA 3N7LA 4USOA 4OWKA 3CA1A 3QR5A 4KC3A 5FNWA 3ZX7A 4AN6A 2IWTB 4J23B 2RG9B 2DS0A 1MD6A 3O4AA 3AH1A 1JY0A 4ZGRB 4XFTA 1JT3A 3O5WB 5DVHA
chains in the Genus database with same CATH topology
1AVUA 3ZJXA 4P0LA 1Z4SA 3CA0A 3H6RB 3MALA 4F83A 8I1BA 3N7JA 4I7IA 3C0OA 2Q9XA 3OJMA 3POKA 4ZA3B 3FJ9A 3O4BA 2AAIB 1PZZA 2D23A 4ENDA 3F62B 4LO2A 5BXTA 4JRAA 4Q9GA 4LO1C 1AF9A 1RG8A 4A7KA 1E0OA 1BA7A 4G9NA 4D0TA 3FFZA 2WBCA 4HA2A 1DIWA 5F8WA 1Z52A 3UJ4A 5BQUC 2UUSA 4I4VA 1TWEA 2D43A 2NZ9A 3WINC 2FGFA 4DEPA 4I2SA 1ISXA 4Z9WB 3V0AB 4FVVA 1ISZA 31BIA 3A23A 3IM7A 3FJAA 3AZWA 4I6IA 1ILR1 1IILA 1JLYA 3H6SE 4J2XA 1IOBA 2F2FA 2VLCA 4I3NA 3ZXDA 3CQAA 1BFFA 4DENA 5GAQA 1UPSA 4ISRA 4I37A 5F8SA 3IIRA 3JUTA 3WO4A 3C9ZA 4GP0A 4X37A 4LO8B 3FJIA 3PG0A 5EG6C 1WD4A 2FFVA 3PUBA 4GOVA 3AKFA 5BVPI 2BEAA 3FJFA 3BTAA 4OUJA 1XYFA 2KI4A 2WRYA 3FJDA 1SZ6B 1IJTA 3FJBA 4JKXB 3NBDA 4QALA 1MC9A 3VSZA 3VT0A 3VWCA 5FZZA 4QBCA 3VUOA 4OWLA 1Q03A 2Z48A 1BFCA 3QYDA 3Q7WA 1T9FA 3R4SA 1K5VA 3O3QA 3V0BB 2XOAA 1KNMA 1WBAA 1R8OA 4I96A 4ZBVB 5BXSA 2ZQNA 3G4NA 1AFCA 1HWOB 3UD7A 1PWAA 3A21A 5DZUA 4I4RA 1Z0HA 3ZXGA 3HALA 2K8RA 3OGGA 2VXRA 2NTDA 1PUUB 5BOWA 5FNXA 1TIEA 3CRGA 1IRAX 2K4AB 3FUOA 4X38A 1TTUA 1M2TB 3WINA 1FWUA 3BAGA 3N7KA 4J2YA 4P6AA 3ILAA 3CA6A 1BFGA 1DZCA 2ZQOA 5EC5A 4D8HA 4GOYA 2ZR1B 4MZGB 1DQOA 2D7RA 2GO2A 1P63A 1L2HA 1ABRB 4XKIA 3FUQA 4YOLA 3RTJB 4J2KA 4I1EA 3FJ8A 1QQLA 4I4QA 5G00A 5BP5C 2R9KB 3BAHA 2Y9XE 3ZC8A 3UD9A 1XHBA 1AVWB 4GAIA 1G9BA 1I1BA 1JT7A 1D0HA 3N0KA 1YTOA 3RMYA 1W3AA 4A7ZA 3OBRA 1FV3A 1S0DA 1YYNA 1YXWA 4I4SA 1T4QA 2FDBM 4QBVA 5JMCA 3AH4A 1W3GA 3BA7A 3CAHA 1V6XA 9ILBA 3C0NA 4R6UB 3I29B 1IRPA 4AN7B 3Q7YA 4MZHA 4QKRA 2DRZA 3P53A 3HBWA 3BADA 3OGFA 1HIBA 4FGFA 3UDAA 3PMEA 1IHKA 1Q04A 2BEBA 3O49A 3UD8A 1G9AA 4I4XA 2MLLB 1FN0A 3BA4A 1DJSB 4LO0C 1CE7B 3HN1A 4IY8A 3MPPG 1TP0A 2QYIB 5F90A 2P23A 1HKNA 4I4PA 3CRHA 4LO3C 2HWMA 5F8YA 2E4MA 2Y9GA 1SR4A 4II0A 1FMMS 1RMLA 1BASA 4I4OA 21BIA 1I1EA 4Z8SB 3P6JA 2K43A 3A07A 1EPWA 1IT0A 1FWVA 4JAWA 1ONKB 1AVAC 3WA1A 2IHOA 3B9UA 1S0BA 1PUMB 2Y9FA 1HWMB 2Y9WC 2VXTI 3AZVA 1J0SA 1ISYA 4EFRA 3O4DA 4IHZA 4ZKTB 4QD2B 4H9WA 4JKQA 4JP0A 3JRRA 4UY4A 3Q7XA 3BAQA 2Q3NB 4I0YA 2J3PA 4QD2C 2L5XA 4L4HA 3H6RA 1RY7A 3HSMA 4EFPA 2VUAA 3OJVA 1S0LA 5D62A 3FJEA 4D0ZA 2D24A 3CU1B 4L4IA 3VT2A 4WBCA 1NZKA 2HW9A 2F8XC 2D1ZA 3BAVA 4XFUA 3G4OA 4LO2C 4I8MA 1WD3A 1EVTA 4LO1A 4X3AA 1HCEA 7I1BA 4G6JA 1FV2A 1S0EA 3CA4A 3IM6A 1YBIA 3RTIB 3HMYA 2FO1A 2ESUA 3O4CA 4MZFB 3BRDA 5BXRA 1HCDA 1JT5A 5BQUA 4OEEA 3I2AA 1TWMA 2P39A 3KMVA 1EV2A 1FQ9A 4G6MA 3NJ5A 4ZFWB 3FGMA 1YF8B 1Z2VA 2D7IA 2KI6B 1ISVA 3CA5A 1BFBA 3V0AA 3AKHA 5HPZA 4Q91A 2AXMA 1AXMA 3WO3A 1ITBA 3EF2A 3WO2A 3P6IA 3BX1C 3AH2A 2F2FC 1WBCA 4LO7B 3BRGC 3O4OA 3NBCA 1ISWA 3NBEA 3O44A 4GP3A 3FJKA 4DCKC 1TOOA 1PC8B 3K1XA 4P0KA 3W9TA 4X39A 3HOMA 1DQGA 4I4UA 1JQZA 3CA3A 2M49A 3NBNA 3BB2A 4P0JA 1FMZA 1DZDA 4KEJA 3T8SA 4ZFYB 3AKIA 2KLLA 3RSJA 2D42A 1DLLA 1XZZA 3RMXA 2DREA 4EEEB 4TLPA 2X2SA 3BA5A 1JLXA 2RQ9A 1GGPB 3UJ0A 2QN4A 2Z49A 4IYBA 1EYLA 4G1RA 4KEKA 2HZ9A 4H04A 1VCLA 6I1BA 4OW4A 1V6UA 5BXPA 2KKIA 2NM1A 4IY9A 1FGAA 3V0BA 2LIEA 3IAGC 2X2TA 4QO3A 5EHAA 4ZFUB 1G82A 4USPA 3FJCA 3A22A 3AJ5A 1JT4A 2AFGA 2DRYA 4IZEA 3TC2A 5I1BA 4JQ0A 2BFHA 1S0CA 1S0FA 4IQPA 2NP0A 3C0MA 3R4UA 4G9MA 4ZOTA 1RZOB 2MIBA 3LTQA 2FFUA 1G9CA 4CJMA 1BLAA 4I1BA 2NVHA 2VU9A 3VSFA 4IZXA 4OEFA 1OQLB 1QQKA 3S8KA 5FZUA 4EFQA 1XG6A 3N7MA 3WMUA 1R8NA 4A7YA 1W3FA 1G9DA 2VSEA 1K5UA 2AQZA 2ET2A 3V79C 5B2HA 4KBBA 2LIQA 3FJJA 3S8JA 3LLPA 5DSSB 5BP5A 4KEIA 5D63A 4QC4A 3WMVA 3BAOA 2MC2A 4EKXB 2YUGA 3AJ6A 2ERMA 1N4KA 3IM5A 1Q1UA 4EB2B 4HR6C 1QXMA 3SNVA 1II4A 1TFMB 3OBTA 4PC4A 4XFSA 4F34A 4ISQA 4IONA 3H6QA 4OEGA 4ZLBB 1NUNA 2GZBA 3VEQA 1BARA 4I4YA 1AVXB 3VT1A 5FZYA 3FJHA 3BRFA 3CRIA 1DFCA 3AKGA 2RSTA 4J2SA 3E8LC 1V6VA 1S0GA 5E24E 2KH2A 3F1RA 4GAFA 1HWNB 1A8DA 1BLDA 1JTCA 2D44A 4LO0A 2I1BA 2D20A 4H75A 2NS2A 5D61A 4JPZA 2VSAA 4Q9PA 3D7WB 3OJ2A 1UYJA 1PREA 3ZC9A 4OWJA 2HWAA 4LO3A 3I2XA 3PHZA 1V6WA 1HWPB 2D22A 4QKSA 1CVSA 41BIA 1DFQA 4HJJA 4LO7C 2E4MC 1SR4C 5JLVA 1M16A 2NYYA 1F31A 5DUYA 3BAUA 3N7LA 4USOA 4OWKA 3CA1A 3QR5A 4KC3A 5FNWA 3ZX7A 4AN6A 2IWTB 4J23B 2RG9B 2DS0A 1MD6A 3O4AA 3AH1A 1JY0A 4ZGRB 4XFTA 1JT3A 3O5WB 5DVHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVU A;  3ZJX A;  4P0L A;  1Z4S A;  3CA0 A;  3H6R B;  3MAL A;  4F83 A;  8I1B A;  3N7J A;  4I7I A;  3C0O A;  2Q9X A;  3OJM A;  3POK A;  4ZA3 B;  3FJ9 A;  3O4B A;  2AAI B;  1PZZ A;  2D23 A;  4END A;  3F62 B;  4LO2 A;  5BXT A;  4JRA A;  4Q9G A;  4LO1 C;  1AF9 A;  1RG8 A;  4A7K A;  1E0O A;  1BA7 A;  4G9N A;  4D0T A;  3FFZ A;  2WBC A;  4HA2 A;  1DIW A;  5F8W A;  1Z52 A;  3UJ4 A;  5BQU C;  2UUS A;  4I4V A;  1TWE A;  2D43 A;  2NZ9 A;  3WIN C;  2FGF A;  4DEP A;  4I2S A;  1ISX A;  4Z9W B;  3V0A B;  4FVV A;  1ISZ A;  31BI A;  3A23 A;  3IM7 A;  3FJA A;  3AZW A;  4I6I A;  1ILR 1;  1IIL A;  1JLY A;  3H6S E;  4J2X A;  1IOB A;  2F2F A;  2VLC A;  4I3N A;  3ZXD A;  3CQA A;  1BFF A;  4DEN A;  5GAQ A;  1UPS A;  4ISR A;  4I37 A;  5F8S A;  3IIR A;  3JUT A;  3WO4 A;  3C9Z A;  4GP0 A;  4X37 A;  4LO8 B;  3FJI A;  3PG0 A;  5EG6 C;  1WD4 A;  2FFV A;  3PUB A;  4GOV A;  3AKF A;  5BVP I;  2BEA A;  3FJF A;  3BTA A;  4OUJ A;  1XYF A;  2KI4 A;  2WRY A;  3FJD A;  1SZ6 B;  1IJT A;  3FJB A;  4JKX B;  3NBD A;  4QAL A;  1MC9 A;  3VSZ A;  3VT0 A;  3VWC A;  5FZZ A;  4QBC A;  3VUO A;  4OWL A;  1Q03 A;  2Z48 A;  1BFC A;  3QYD A;  3Q7W A;  1T9F A;  3R4S A;  1K5V A;  3O3Q A;  3V0B B;  2XOA A;  1KNM A;  1WBA A;  1R8O A;  4I96 A;  4ZBV B;  5BXS A;  2ZQN A;  3G4N A;  1AFC A;  1HWO B;  3UD7 A;  1PWA A;  3A21 A;  5DZU A;  4I4R A;  1Z0H A;  3ZXG A;  3HAL A;  2K8R A;  3OGG A;  2VXR A;  2NTD A;  1PUU B;  5BOW A;  5FNX A;  1TIE A;  3CRG A;  1IRA X;  2K4A B;  3FUO A;  4X38 A;  1TTU A;  1M2T B;  3WIN A;  1FWU A;  3BAG A;  3N7K A;  4J2Y A;  4P6A A;  3ILA A;  3CA6 A;  1BFG A;  1DZC A;  2ZQO A;  5EC5 A;  4D8H A;  4GOY A;  2ZR1 B;  1DQO A;  2D7R A;  2GO2 A;  1P63 A;  1L2H A;  1ABR B;  4XKI A;  3FUQ A;  4YOL A;  3RTJ B;  4J2K A;  4I1E A;  3FJ8 A;  1QQL A;  4I4Q A;  5G00 A;  5BP5 C;  2R9K B;  3BAH A;  2Y9X E;  3ZC8 A;  3UD9 A;  1XHB A;  1AVW B;  4GAI A;  1G9B A;  1I1B A;  1JT7 A;  1D0H A;  3N0K A;  1YTO A;  3RMY A;  1W3A A;  4A7Z A;  3OBR A;  1FV3 A;  1S0D A;  1YYN A;  1YXW A;  4I4S A;  1T4Q A;  2FDB M;  4QBV A;  5JMC A;  3AH4 A;  1W3G A;  3BA7 A;  3CAH A;  1V6X A;  9ILB A;  3C0N A;  4R6U B;  3I29 B;  1IRP A;  4AN7 B;  3Q7Y A;  4QKR A;  2DRZ A;  3P53 A;  3HBW A;  3BAD A;  3OGF A;  1HIB A;  4FGF A;  3UDA A;  3PME A;  1IHK A;  1Q04 A;  2BEB A;  3O49 A;  3UD8 A;  1G9A A;  4I4X A;  2MLL B;  1FN0 A;  3BA4 A;  1DJS B;  4LO0 C;  1CE7 B;  3HN1 A;  4IY8 A;  3MPP G;  1TP0 A;  2QYI B;  5F90 A;  2P23 A;  1HKN A;  4I4P A;  3CRH A;  4LO3 C;  2HWM A;  5F8Y A;  2E4M A;  2Y9G A;  1SR4 A;  4II0 A;  1FMM S;  1RML A;  1BAS A;  4I4O A;  21BI A;  1I1E A;  4Z8S B;  3P6J A;  2K43 A;  3A07 A;  1EPW A;  1IT0 A;  1FWV A;  4JAW A;  1ONK B;  1AVA C;  3WA1 A;  2IHO A;  3B9U A;  1S0B A;  1PUM B;  2Y9F A;  1HWM B;  2Y9W C;  2VXT I;  3AZV A;  1J0S A;  1ISY A;  4EFR A;  3O4D A;  4IHZ A;  4ZKT B;  4QD2 B;  4H9W A;  4JKQ A;  4JP0 A;  3JRR A;  3Q7X A;  3BAQ A;  2Q3N B;  4I0Y A;  2J3P A;  4QD2 C;  2L5X A;  4L4H A;  3H6R A;  1RY7 A;  3HSM A;  4EFP A;  2VUA A;  3OJV A;  1S0L A;  5D62 A;  3FJE A;  4D0Z A;  2D24 A;  3CU1 B;  4L4I A;  3VT2 A;  4WBC A;  1NZK A;  2HW9 A;  2F8X C;  2D1Z A;  3BAV A;  4XFU A;  3G4O A;  4LO2 C;  4I8M A;  1WD3 A;  1EVT A;  4LO1 A;  4X3A A;  1HCE A;  7I1B A;  4G6J A;  1FV2 A;  1S0E A;  3CA4 A;  3IM6 A;  1YBI A;  3RTI B;  3HMY A;  2FO1 A;  2ESU A;  3O4C A;  3BRD A;  5BXR A;  1HCD A;  1JT5 A;  5BQU A;  4OEE A;  3I2A A;  1TWM A;  2P39 A;  3KMV A;  1EV2 A;  1FQ9 A;  4G6M A;  3NJ5 A;  4ZFW B;  3FGM A;  1YF8 B;  1Z2V A;  2D7I A;  2KI6 B;  1ISV A;  3CA5 A;  1BFB A;  3V0A A;  3AKH A;  5HPZ A;  4Q91 A;  2AXM A;  1AXM A;  3WO3 A;  1ITB A;  3EF2 A;  3WO2 A;  3P6I A;  3BX1 C;  3AH2 A;  2F2F C;  1WBC A;  4LO7 B;  3BRG C;  3O4O A;  3NBC A;  1ISW A;  3NBE A;  3O44 A;  4GP3 A;  3FJK A;  4DCK C;  1TOO A;  1PC8 B;  3K1X A;  4P0K A;  3W9T A;  4X39 A;  3HOM A;  1DQG A;  4I4U A;  1JQZ A;  3CA3 A;  2M49 A;  3NBN A;  3BB2 A;  4P0J A;  1FMZ A;  1DZD A;  4KEJ A;  3T8S A;  4ZFY B;  3AKI A;  2KLL A;  3RSJ A;  2D42 A;  1DLL A;  1XZZ A;  3RMX A;  2DRE A;  4EEE B;  4TLP A;  2X2S A;  3BA5 A;  1JLX A;  2RQ9 A;  1GGP B;  3UJ0 A;  2QN4 A;  2Z49 A;  4IYB A;  1EYL A;  4G1R A;  4KEK A;  2HZ9 A;  4H04 A;  1VCL A;  6I1B A;  4OW4 A;  1V6U A;  5BXP A;  2KKI A;  2NM1 A;  4IY9 A;  1FGA A;  3V0B A;  2LIE A;  3IAG C;  2X2T A;  4QO3 A;  5EHA A;  4ZFU B;  1G82 A;  4USP A;  3FJC A;  3A22 A;  3AJ5 A;  1JT4 A;  2AFG A;  2DRY A;  4IZE A;  3TC2 A;  5I1B A;  4JQ0 A;  2BFH A;  1S0C A;  1S0F A;  4IQP A;  2NP0 A;  3C0M A;  3R4U A;  4G9M A;  4ZOT A;  1RZO B;  2MIB A;  3LTQ A;  2FFU A;  1G9C A;  4CJM A;  1BLA A;  4I1B A;  2NVH A;  2VU9 A;  3VSF A;  4IZX A;  4OEF A;  1OQL B;  1QQK A;  3S8K A;  5FZU A;  4EFQ A;  1XG6 A;  3N7M A;  3WMU A;  1R8N A;  4A7Y A;  1W3F A;  1G9D A;  2VSE A;  1K5U A;  2AQZ A;  2ET2 A;  3V79 C;  5B2H A;  4KBB A;  2LIQ A;  3FJJ A;  3S8J A;  3LLP A;  5DSS B;  5BP5 A;  4KEI A;  5D63 A;  4QC4 A;  3WMV A;  3BAO A;  2MC2 A;  4EKX B;  2YUG A;  3AJ6 A;  2ERM A;  1N4K A;  3IM5 A;  1Q1U A;  4EB2 B;  4HR6 C;  1QXM A;  3SNV A;  1II4 A;  1TFM B;  3OBT A;  4PC4 A;  4XFS A;  4F34 A;  4ISQ A;  4ION A;  3H6Q A;  4OEG A;  4ZLB B;  1NUN A;  2GZB A;  3VEQ A;  1BAR A;  4I4Y A;  1AVX B;  3VT1 A;  5FZY A;  3FJH A;  3BRF A;  3CRI A;  1DFC A;  3AKG A;  2RST A;  4J2S A;  3E8L C;  1V6V A;  1S0G A;  5E24 E;  2KH2 A;  3F1R A;  4GAF A;  1HWN B;  1A8D A;  1BLD A;  1JTC A;  2D44 A;  4LO0 A;  2I1B A;  2D20 A;  5D61 A;  4JPZ A;  2VSA A;  4Q9P A;  3D7W B;  3OJ2 A;  1UYJ A;  1PRE A;  3ZC9 A;  4OWJ A;  2HWA A;  4LO3 A;  3I2X A;  3PHZ A;  1V6W A;  1HWP B;  2D22 A;  4QKS A;  1CVS A;  41BI A;  1DFQ A;  4HJJ A;  4LO7 C;  2E4M C;  1SR4 C;  5JLV A;  1M16 A;  2NYY A;  1F31 A;  5DUY A;  3BAU A;  3N7L A;  4USO A;  4OWK A;  3CA1 A;  3QR5 A;  4KC3 A;  5FNW A;  3ZX7 A;  4AN6 A;  2IWT B;  4J23 B;  2RG9 B;  2DS0 A;  1MD6 A;  3O4A A;  3AH1 A;  1JY0 A;  4ZGR B;  4XFT A;  1JT3 A;  3O5W B;  5DVH A; 
#chains in the Genus database with same CATH topology
 1AVU A;  3ZJX A;  4P0L A;  1Z4S A;  3CA0 A;  3H6R B;  3MAL A;  4F83 A;  8I1B A;  3N7J A;  4I7I A;  3C0O A;  2Q9X A;  3OJM A;  3POK A;  4ZA3 B;  3FJ9 A;  3O4B A;  2AAI B;  1PZZ A;  2D23 A;  4END A;  3F62 B;  4LO2 A;  5BXT A;  4JRA A;  4Q9G A;  4LO1 C;  1AF9 A;  1RG8 A;  4A7K A;  1E0O A;  1BA7 A;  4G9N A;  4D0T A;  3FFZ A;  2WBC A;  4HA2 A;  1DIW A;  5F8W A;  1Z52 A;  3UJ4 A;  5BQU C;  2UUS A;  4I4V A;  1TWE A;  2D43 A;  2NZ9 A;  3WIN C;  2FGF A;  4DEP A;  4I2S A;  1ISX A;  4Z9W B;  3V0A B;  4FVV A;  1ISZ A;  31BI A;  3A23 A;  3IM7 A;  3FJA A;  3AZW A;  4I6I A;  1ILR 1;  1IIL A;  1JLY A;  3H6S E;  4J2X A;  1IOB A;  2F2F A;  2VLC A;  4I3N A;  3ZXD A;  3CQA A;  1BFF A;  4DEN A;  5GAQ A;  1UPS A;  4ISR A;  4I37 A;  5F8S A;  3IIR A;  3JUT A;  3WO4 A;  3C9Z A;  4GP0 A;  4X37 A;  4LO8 B;  3FJI A;  3PG0 A;  5EG6 C;  1WD4 A;  2FFV A;  3PUB A;  4GOV A;  3AKF A;  5BVP I;  2BEA A;  3FJF A;  3BTA A;  4OUJ A;  1XYF A;  2KI4 A;  2WRY A;  3FJD A;  1SZ6 B;  1IJT A;  3FJB A;  4JKX B;  3NBD A;  4QAL A;  1MC9 A;  3VSZ A;  3VT0 A;  3VWC A;  5FZZ A;  4QBC A;  3VUO A;  4OWL A;  1Q03 A;  2Z48 A;  1BFC A;  3QYD A;  3Q7W A;  1T9F A;  3R4S A;  1K5V A;  3O3Q A;  3V0B B;  2XOA A;  1KNM A;  1WBA A;  1R8O A;  4I96 A;  4ZBV B;  5BXS A;  2ZQN A;  3G4N A;  1AFC A;  1HWO B;  3UD7 A;  1PWA A;  3A21 A;  5DZU A;  4I4R A;  1Z0H A;  3ZXG A;  3HAL A;  2K8R A;  3OGG A;  2VXR A;  2NTD A;  1PUU B;  5BOW A;  5FNX A;  1TIE A;  3CRG A;  1IRA X;  2K4A B;  3FUO A;  4X38 A;  1TTU A;  1M2T B;  3WIN A;  1FWU A;  3BAG A;  3N7K A;  4J2Y A;  4P6A A;  3ILA A;  3CA6 A;  1BFG A;  1DZC A;  2ZQO A;  5EC5 A;  4D8H A;  4GOY A;  2ZR1 B;  4MZG B;  1DQO A;  2D7R A;  2GO2 A;  1P63 A;  1L2H A;  1ABR B;  4XKI A;  3FUQ A;  4YOL A;  3RTJ B;  4J2K A;  4I1E A;  3FJ8 A;  1QQL A;  4I4Q A;  5G00 A;  5BP5 C;  2R9K B;  3BAH A;  2Y9X E;  3ZC8 A;  3UD9 A;  1XHB A;  1AVW B;  4GAI A;  1G9B A;  1I1B A;  1JT7 A;  1D0H A;  3N0K A;  1YTO A;  3RMY A;  1W3A A;  4A7Z A;  3OBR A;  1FV3 A;  1S0D A;  1YYN A;  1YXW A;  4I4S A;  1T4Q A;  2FDB M;  4QBV A;  5JMC A;  3AH4 A;  1W3G A;  3BA7 A;  3CAH A;  1V6X A;  9ILB A;  3C0N A;  4R6U B;  3I29 B;  1IRP A;  4AN7 B;  3Q7Y A;  4MZH A;  4QKR A;  2DRZ A;  3P53 A;  3HBW A;  3BAD A;  3OGF A;  1HIB A;  4FGF A;  3UDA A;  3PME A;  1IHK A;  1Q04 A;  2BEB A;  3O49 A;  3UD8 A;  1G9A A;  4I4X A;  2MLL B;  1FN0 A;  3BA4 A;  1DJS B;  4LO0 C;  1CE7 B;  3HN1 A;  4IY8 A;  3MPP G;  1TP0 A;  2QYI B;  5F90 A;  2P23 A;  1HKN A;  4I4P A;  3CRH A;  4LO3 C;  2HWM A;  5F8Y A;  2E4M A;  2Y9G A;  1SR4 A;  4II0 A;  1FMM S;  1RML A;  1BAS A;  4I4O A;  21BI A;  1I1E A;  4Z8S B;  3P6J A;  2K43 A;  3A07 A;  1EPW A;  1IT0 A;  1FWV A;  4JAW A;  1ONK B;  1AVA C;  3WA1 A;  2IHO A;  3B9U A;  1S0B A;  1PUM B;  2Y9F A;  1HWM B;  2Y9W C;  2VXT I;  3AZV A;  1J0S A;  1ISY A;  4EFR A;  3O4D A;  4IHZ A;  4ZKT B;  4QD2 B;  4H9W A;  4JKQ A;  4JP0 A;  3JRR A;  4UY4 A;  3Q7X A;  3BAQ A;  2Q3N B;  4I0Y A;  2J3P A;  4QD2 C;  2L5X A;  4L4H A;  3H6R A;  1RY7 A;  3HSM A;  4EFP A;  2VUA A;  3OJV A;  1S0L A;  5D62 A;  3FJE A;  4D0Z A;  2D24 A;  3CU1 B;  4L4I A;  3VT2 A;  4WBC A;  1NZK A;  2HW9 A;  2F8X C;  2D1Z A;  3BAV A;  4XFU A;  3G4O A;  4LO2 C;  4I8M A;  1WD3 A;  1EVT A;  4LO1 A;  4X3A A;  1HCE A;  7I1B A;  4G6J A;  1FV2 A;  1S0E A;  3CA4 A;  3IM6 A;  1YBI A;  3RTI B;  3HMY A;  2FO1 A;  2ESU A;  3O4C A;  4MZF B;  3BRD A;  5BXR A;  1HCD A;  1JT5 A;  5BQU A;  4OEE A;  3I2A A;  1TWM A;  2P39 A;  3KMV A;  1EV2 A;  1FQ9 A;  4G6M A;  3NJ5 A;  4ZFW B;  3FGM A;  1YF8 B;  1Z2V A;  2D7I A;  2KI6 B;  1ISV A;  3CA5 A;  1BFB A;  3V0A A;  3AKH A;  5HPZ A;  4Q91 A;  2AXM A;  1AXM A;  3WO3 A;  1ITB A;  3EF2 A;  3WO2 A;  3P6I A;  3BX1 C;  3AH2 A;  2F2F C;  1WBC A;  4LO7 B;  3BRG C;  3O4O A;  3NBC A;  1ISW A;  3NBE A;  3O44 A;  4GP3 A;  3FJK A;  4DCK C;  1TOO A;  1PC8 B;  3K1X A;  4P0K A;  3W9T A;  4X39 A;  3HOM A;  1DQG A;  4I4U A;  1JQZ A;  3CA3 A;  2M49 A;  3NBN A;  3BB2 A;  4P0J A;  1FMZ A;  1DZD A;  4KEJ A;  3T8S A;  4ZFY B;  3AKI A;  2KLL A;  3RSJ A;  2D42 A;  1DLL A;  1XZZ A;  3RMX A;  2DRE A;  4EEE B;  4TLP A;  2X2S A;  3BA5 A;  1JLX A;  2RQ9 A;  1GGP B;  3UJ0 A;  2QN4 A;  2Z49 A;  4IYB A;  1EYL A;  4G1R A;  4KEK A;  2HZ9 A;  4H04 A;  1VCL A;  6I1B A;  4OW4 A;  1V6U A;  5BXP A;  2KKI A;  2NM1 A;  4IY9 A;  1FGA A;  3V0B A;  2LIE A;  3IAG C;  2X2T A;  4QO3 A;  5EHA A;  4ZFU B;  1G82 A;  4USP A;  3FJC A;  3A22 A;  3AJ5 A;  1JT4 A;  2AFG A;  2DRY A;  4IZE A;  3TC2 A;  5I1B A;  4JQ0 A;  2BFH A;  1S0C A;  1S0F A;  4IQP A;  2NP0 A;  3C0M A;  3R4U A;  4G9M A;  4ZOT A;  1RZO B;  2MIB A;  3LTQ A;  2FFU A;  1G9C A;  4CJM A;  1BLA A;  4I1B A;  2NVH A;  2VU9 A;  3VSF A;  4IZX A;  4OEF A;  1OQL B;  1QQK A;  3S8K A;  5FZU A;  4EFQ A;  1XG6 A;  3N7M A;  3WMU A;  1R8N A;  4A7Y A;  1W3F A;  1G9D A;  2VSE A;  1K5U A;  2AQZ A;  2ET2 A;  3V79 C;  5B2H A;  4KBB A;  2LIQ A;  3FJJ A;  3S8J A;  3LLP A;  5DSS B;  5BP5 A;  4KEI A;  5D63 A;  4QC4 A;  3WMV A;  3BAO A;  2MC2 A;  4EKX B;  2YUG A;  3AJ6 A;  2ERM A;  1N4K A;  3IM5 A;  1Q1U A;  4EB2 B;  4HR6 C;  1QXM A;  3SNV A;  1II4 A;  1TFM B;  3OBT A;  4PC4 A;  4XFS A;  4F34 A;  4ISQ A;  4ION A;  3H6Q A;  4OEG A;  4ZLB B;  1NUN A;  2GZB A;  3VEQ A;  1BAR A;  4I4Y A;  1AVX B;  3VT1 A;  5FZY A;  3FJH A;  3BRF A;  3CRI A;  1DFC A;  3AKG A;  2RST A;  4J2S A;  3E8L C;  1V6V A;  1S0G A;  5E24 E;  2KH2 A;  3F1R A;  4GAF A;  1HWN B;  1A8D A;  1BLD A;  1JTC A;  2D44 A;  4LO0 A;  2I1B A;  2D20 A;  4H75 A;  2NS2 A;  5D61 A;  4JPZ A;  2VSA A;  4Q9P A;  3D7W B;  3OJ2 A;  1UYJ A;  1PRE A;  3ZC9 A;  4OWJ A;  2HWA A;  4LO3 A;  3I2X A;  3PHZ A;  1V6W A;  1HWP B;  2D22 A;  4QKS A;  1CVS A;  41BI A;  1DFQ A;  4HJJ A;  4LO7 C;  2E4M C;  1SR4 C;  5JLV A;  1M16 A;  2NYY A;  1F31 A;  5DUY A;  3BAU A;  3N7L A;  4USO A;  4OWK A;  3CA1 A;  3QR5 A;  4KC3 A;  5FNW A;  3ZX7 A;  4AN6 A;  2IWT B;  4J23 B;  2RG9 B;  2DS0 A;  1MD6 A;  3O4A A;  3AH1 A;  1JY0 A;  4ZGR B;  4XFT A;  1JT3 A;  3O5W B;  5DVH A; 
#chains in the Genus database with same CATH homology
 1AVU A;  3ZJX A;  4P0L A;  1Z4S A;  3CA0 A;  3H6R B;  3MAL A;  4F83 A;  8I1B A;  3N7J A;  4I7I A;  3C0O A;  2Q9X A;  3OJM A;  3POK A;  4ZA3 B;  3FJ9 A;  3O4B A;  2AAI B;  1PZZ A;  2D23 A;  4END A;  3F62 B;  4LO2 A;  5BXT A;  4JRA A;  4Q9G A;  4LO1 C;  1AF9 A;  1RG8 A;  4A7K A;  1E0O A;  1BA7 A;  4G9N A;  4D0T A;  3FFZ A;  2WBC A;  4HA2 A;  1DIW A;  5F8W A;  1Z52 A;  3UJ4 A;  5BQU C;  2UUS A;  4I4V A;  1TWE A;  2D43 A;  2NZ9 A;  3WIN C;  2FGF A;  4DEP A;  4I2S A;  1ISX A;  4Z9W B;  3V0A B;  4FVV A;  1ISZ A;  31BI A;  3A23 A;  3IM7 A;  3FJA A;  3AZW A;  4I6I A;  1ILR 1;  1IIL A;  1JLY A;  3H6S E;  4J2X A;  1IOB A;  2F2F A;  2VLC A;  4I3N A;  3ZXD A;  3CQA A;  1BFF A;  4DEN A;  5GAQ A;  1UPS A;  4ISR A;  4I37 A;  5F8S A;  3IIR A;  3JUT A;  3WO4 A;  3C9Z A;  4GP0 A;  4X37 A;  4LO8 B;  3FJI A;  3PG0 A;  5EG6 C;  1WD4 A;  2FFV A;  3PUB A;  4GOV A;  3AKF A;  5BVP I;  2BEA A;  3FJF A;  3BTA A;  4OUJ A;  1XYF A;  2KI4 A;  2WRY A;  3FJD A;  1SZ6 B;  1IJT A;  3FJB A;  4JKX B;  3NBD A;  4QAL A;  1MC9 A;  3VSZ A;  3VT0 A;  3VWC A;  5FZZ A;  4QBC A;  3VUO A;  4OWL A;  1Q03 A;  2Z48 A;  1BFC A;  3QYD A;  3Q7W A;  1T9F A;  3R4S A;  1K5V A;  3O3Q A;  3V0B B;  2XOA A;  1KNM A;  1WBA A;  1R8O A;  4I96 A;  4ZBV B;  5BXS A;  2ZQN A;  3G4N A;  1AFC A;  1HWO B;  3UD7 A;  1PWA A;  3A21 A;  5DZU A;  4I4R A;  1Z0H A;  3ZXG A;  3HAL A;  2K8R A;  3OGG A;  2VXR A;  2NTD A;  1PUU B;  5BOW A;  5FNX A;  1TIE A;  3CRG A;  1IRA X;  2K4A B;  3FUO A;  4X38 A;  1TTU A;  1M2T B;  3WIN A;  1FWU A;  3BAG A;  3N7K A;  4J2Y A;  4P6A A;  3ILA A;  3CA6 A;  1BFG A;  1DZC A;  2ZQO A;  5EC5 A;  4D8H A;  4GOY A;  2ZR1 B;  4MZG B;  1DQO A;  2D7R A;  2GO2 A;  1P63 A;  1L2H A;  1ABR B;  4XKI A;  3FUQ A;  4YOL A;  3RTJ B;  4J2K A;  4I1E A;  3FJ8 A;  1QQL A;  4I4Q A;  5G00 A;  5BP5 C;  2R9K B;  3BAH A;  2Y9X E;  3ZC8 A;  3UD9 A;  1XHB A;  1AVW B;  4GAI A;  1G9B A;  1I1B A;  1JT7 A;  1D0H A;  3N0K A;  1YTO A;  3RMY A;  1W3A A;  4A7Z A;  3OBR A;  1FV3 A;  1S0D A;  1YYN A;  1YXW A;  4I4S A;  1T4Q A;  2FDB M;  4QBV A;  5JMC A;  3AH4 A;  1W3G A;  3BA7 A;  3CAH A;  1V6X A;  9ILB A;  3C0N A;  4R6U B;  3I29 B;  1IRP A;  4AN7 B;  3Q7Y A;  4MZH A;  4QKR A;  2DRZ A;  3P53 A;  3HBW A;  3BAD A;  3OGF A;  1HIB A;  4FGF A;  3UDA A;  3PME A;  1IHK A;  1Q04 A;  2BEB A;  3O49 A;  3UD8 A;  1G9A A;  4I4X A;  2MLL B;  1FN0 A;  3BA4 A;  1DJS B;  4LO0 C;  1CE7 B;  3HN1 A;  4IY8 A;  3MPP G;  1TP0 A;  2QYI B;  5F90 A;  2P23 A;  1HKN A;  4I4P A;  3CRH A;  4LO3 C;  2HWM A;  5F8Y A;  2E4M A;  2Y9G A;  1SR4 A;  4II0 A;  1FMM S;  1RML A;  1BAS A;  4I4O A;  21BI A;  1I1E A;  4Z8S B;  3P6J A;  2K43 A;  3A07 A;  1EPW A;  1IT0 A;  1FWV A;  4JAW A;  1ONK B;  1AVA C;  3WA1 A;  2IHO A;  3B9U A;  1S0B A;  1PUM B;  2Y9F A;  1HWM B;  2Y9W C;  2VXT I;  3AZV A;  1J0S A;  1ISY A;  4EFR A;  3O4D A;  4IHZ A;  4ZKT B;  4QD2 B;  4H9W A;  4JKQ A;  4JP0 A;  3JRR A;  4UY4 A;  3Q7X A;  3BAQ A;  2Q3N B;  4I0Y A;  2J3P A;  4QD2 C;  2L5X A;  4L4H A;  3H6R A;  1RY7 A;  3HSM A;  4EFP A;  2VUA A;  3OJV A;  1S0L A;  5D62 A;  3FJE A;  4D0Z A;  2D24 A;  3CU1 B;  4L4I A;  3VT2 A;  4WBC A;  1NZK A;  2HW9 A;  2F8X C;  2D1Z A;  3BAV A;  4XFU A;  3G4O A;  4LO2 C;  4I8M A;  1WD3 A;  1EVT A;  4LO1 A;  4X3A A;  1HCE A;  7I1B A;  4G6J A;  1FV2 A;  1S0E A;  3CA4 A;  3IM6 A;  1YBI A;  3RTI B;  3HMY A;  2FO1 A;  2ESU A;  3O4C A;  4MZF B;  3BRD A;  5BXR A;  1HCD A;  1JT5 A;  5BQU A;  4OEE A;  3I2A A;  1TWM A;  2P39 A;  3KMV A;  1EV2 A;  1FQ9 A;  4G6M A;  3NJ5 A;  4ZFW B;  3FGM A;  1YF8 B;  1Z2V A;  2D7I A;  2KI6 B;  1ISV A;  3CA5 A;  1BFB A;  3V0A A;  3AKH A;  5HPZ A;  4Q91 A;  2AXM A;  1AXM A;  3WO3 A;  1ITB A;  3EF2 A;  3WO2 A;  3P6I A;  3BX1 C;  3AH2 A;  2F2F C;  1WBC A;  4LO7 B;  3BRG C;  3O4O A;  3NBC A;  1ISW A;  3NBE A;  3O44 A;  4GP3 A;  3FJK A;  4DCK C;  1TOO A;  1PC8 B;  3K1X A;  4P0K A;  3W9T A;  4X39 A;  3HOM A;  1DQG A;  4I4U A;  1JQZ A;  3CA3 A;  2M49 A;  3NBN A;  3BB2 A;  4P0J A;  1FMZ A;  1DZD A;  4KEJ A;  3T8S A;  4ZFY B;  3AKI A;  2KLL A;  3RSJ A;  2D42 A;  1DLL A;  1XZZ A;  3RMX A;  2DRE A;  4EEE B;  4TLP A;  2X2S A;  3BA5 A;  1JLX A;  2RQ9 A;  1GGP B;  3UJ0 A;  2QN4 A;  2Z49 A;  4IYB A;  1EYL A;  4G1R A;  4KEK A;  2HZ9 A;  4H04 A;  1VCL A;  6I1B A;  4OW4 A;  1V6U A;  5BXP A;  2KKI A;  2NM1 A;  4IY9 A;  1FGA A;  3V0B A;  2LIE A;  3IAG C;  2X2T A;  4QO3 A;  5EHA A;  4ZFU B;  1G82 A;  4USP A;  3FJC A;  3A22 A;  3AJ5 A;  1JT4 A;  2AFG A;  2DRY A;  4IZE A;  3TC2 A;  5I1B A;  4JQ0 A;  2BFH A;  1S0C A;  1S0F A;  4IQP A;  2NP0 A;  3C0M A;  3R4U A;  4G9M A;  4ZOT A;  1RZO B;  2MIB A;  3LTQ A;  2FFU A;  1G9C A;  4CJM A;  1BLA A;  4I1B A;  2NVH A;  2VU9 A;  3VSF A;  4IZX A;  4OEF A;  1OQL B;  1QQK A;  3S8K A;  5FZU A;  4EFQ A;  1XG6 A;  3N7M A;  3WMU A;  1R8N A;  4A7Y A;  1W3F A;  1G9D A;  2VSE A;  1K5U A;  2AQZ A;  2ET2 A;  3V79 C;  5B2H A;  4KBB A;  2LIQ A;  3FJJ A;  3S8J A;  3LLP A;  5DSS B;  5BP5 A;  4KEI A;  5D63 A;  4QC4 A;  3WMV A;  3BAO A;  2MC2 A;  4EKX B;  2YUG A;  3AJ6 A;  2ERM A;  1N4K A;  3IM5 A;  1Q1U A;  4EB2 B;  4HR6 C;  1QXM A;  3SNV A;  1II4 A;  1TFM B;  3OBT A;  4PC4 A;  4XFS A;  4F34 A;  4ISQ A;  4ION A;  3H6Q A;  4OEG A;  4ZLB B;  1NUN A;  2GZB A;  3VEQ A;  1BAR A;  4I4Y A;  1AVX B;  3VT1 A;  5FZY A;  3FJH A;  3BRF A;  3CRI A;  1DFC A;  3AKG A;  2RST A;  4J2S A;  3E8L C;  1V6V A;  1S0G A;  5E24 E;  2KH2 A;  3F1R A;  4GAF A;  1HWN B;  1A8D A;  1BLD A;  1JTC A;  2D44 A;  4LO0 A;  2I1B A;  2D20 A;  4H75 A;  2NS2 A;  5D61 A;  4JPZ A;  2VSA A;  4Q9P A;  3D7W B;  3OJ2 A;  1UYJ A;  1PRE A;  3ZC9 A;  4OWJ A;  2HWA A;  4LO3 A;  3I2X A;  3PHZ A;  1V6W A;  1HWP B;  2D22 A;  4QKS A;  1CVS A;  41BI A;  1DFQ A;  4HJJ A;  4LO7 C;  2E4M C;  1SR4 C;  5JLV A;  1M16 A;  2NYY A;  1F31 A;  5DUY A;  3BAU A;  3N7L A;  4USO A;  4OWK A;  3CA1 A;  3QR5 A;  4KC3 A;  5FNW A;  3ZX7 A;  4AN6 A;  2IWT B;  4J23 B;  2RG9 B;  2DS0 A;  1MD6 A;  3O4A A;  3AH1 A;  1JY0 A;  4ZGR B;  4XFT A;  1JT3 A;  3O5W B;  5DVH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...