1W3FA

Crystal structure of the hemolytic lectin from the mushroom laetiporus sulphureus complexed with n-acetyllactosamine in the gamma motif
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
312
structure length
312
Chain Sequence
b'DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFEDMSIDKIEYDLKDGRILSSTPNVLATQTLENTSSQTQEMSFNLSQTLTQTSTFAYTAGFTIAVGTAFKAGVPIFAETEFKVDISVDNQWNWGEENTFSKTYTATFSVRAGPGETVKAVSTVDSGIINVPFTAYLSSKSTGFEVTTEGIWRGVSSWDLRHTLTSVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYTIC LECTIN FROM LAETIPORUS SULPHUREUS
publication title Structural Analysis of the Laetiporus Sulphureus Hemolytic Pore-Forming Lectin in Complex with Sugars
pubmed doi rcsb
molecule tags Toxin/lectin
total genus 60
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03318 ETX_MTX2 Clostridium epsilon toxin ETX/Bacillus mosquitocidal toxin MTX2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1w3fA01
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1w3fA02
2NM1A 2IHOA 4IONA 2DRZA 1TP0A 1WD3A 3FJJA 3PUBA 4I4XA 4OWLA 1ISXA 3HALA 3N7JA 3CA0A 3Q7WA 4ISQA 9ILBA 4ZFYB 4A7KA 4I96A 1HIBA 1GGPB 1YYNA 4USOA 2KI4A 3F1RA 3UJ0A 1G9DA 4J23B 5BXTA 4I6IA 2AFGA 1I1BA 1V6XA 3BAGA 4HA2A 1JT5A 1YTOA 3BA5A 3BX1C 1AVXB 2E4MC 1MC9A 3BRDA 2D42A 4I4RA 3G4OA 3CA4A 1L2HA 1DLLA 3BAOA 4GP3A 4JKQA 5EC5A 8I1BA 3BAQA 2BFHA 1Q04A 1IRPA 1FQ9A 2YUGA 3UD9A 4P6AA 4JP0A 2D44A 3FJ8A 3Q7YA 3OJ2A 2D43A 5E24E 2D7IA 2AAIB 4L4HA 5I1BA 3LTQA 1G82A 3NBCA 1IILA 5F8WA 5DUYA 4ZOTA 3E8LC 4LO2A 4Q9GA 1HCDA 3HBWA 4JAWA 4P0KA 1CVSA 2VUAA 3P6JA 1IT0A 1SR4A 1SR4C 1BLAA 4LO3C 4I1BA 1EYLA 5EHAA 5FNWA 1TIEA 3N7LA 2ERMA 4Z9WB 2LIEA 5FNXA 4XKIA 4II0A 1QXMA 2AQZA 2ZQOA 2KH2A 4EB2B 3CA6A 2NZ9A 2P39A 2GO2A 3OBTA 2VXRA 4IQPA 2VXTI 3ZC9A 5BVPI 2FO1A 1FWVA 1F31A 4QKSA 4KEIA 2UUSA 3WO3A 3R4SA 4G6MA 3W9TA 3WO4A 2QN4A 4OEFA 3JRRA 1EV2A 7I1BA 3O4CA 1ISZA 4OUJA 1NZKA 3ZC8A 4LO0A 1BA7A 4ZGRB 2KLLA 3PG0A 4IHZA 3CAHA 2D23A 3SNVA 2FGFA 2HW9A 1I1EA 4GP0A 1DFCA 1BASA 4G6JA 4ZFWB 3G4NA 3O4BA 4I4VA 4KC3A 1YF8B 1ISYA 1G9CA 4I3NA 4KEJA 2GZBA 3AZWA 1RY7A 3C0OA 3CRIA 4CJMA 3ZJXA 4ZLBB 1YXWA 41BIA 1TWMA 2R9KB 2ESUA 3A23A 4AN7B 2VLCA 1XYFA 1IHKA 2FFUA 1HWMB 5G00A 4GOVA 4QC4A 1SZ6B 3V0AB 1Z2VA 5B2HA 1Z4SA 3FGMA 2RSTA 4Z8SB 2K43A 3WMUA 3OGFA 3S8KA 3EF2A 1XHBA 4G9MA 4OEEA 3PMEA 1S0CA 2Z49A 4AN6A 3O4AA 1T4QA 1FV3A 2NYYA 2D20A 4Q9PA 3IAGC 1J0SA 3D7WB 5BQUA 3FFZA 1R8OA 1QQKA 2D24A 4DCKC 1FMZA 1AVWB 1TOOA 1W3AA 3JUTA 3BRFA 3BAVA 1AVAC 1JLXA 4HR6C 3RMYA 1ABRB 3AKGA 1IRAX 3V0BA 5DSSB 1PREA 3VT2A 3V0BB 3BA4A 1WBCA 4WBCA 1VCLA 4LO8B 5D62A 3TC2A 3CQAA 1AFCA 4L4IA 4QKRA 4ENDA 3NJ5A 1DQOA 1ISVA 3ZX7A 1DZCA 1V6WA 2FDBM 21BIA 2XOAA 2ZR1B 4G1RA 4LO1A 4LO1C 1R8NA 1V6UA 3FUQA 2DRYA 2AXMA 3OBRA 1ITBA 1S0GA 1JQZA 4GAIA 4DENA 3O5WB 3HOMA 5BXPA 3C0MA 3CRHA 4LO2C 3NBDA 3MALA 3O4DA 3OJVA 3H6QA 1DZDA 2NTDA 3AZVA 4EEEB 1WD4A 3AKHA 4QD2C 3VUOA 1BFBA 2BEBA 4I4YA 1EVTA 1UYJA 3HMYA 4QD2B 3KMVA 3CRGA 1G9AA 1K5VA 1JY0A 5JLVA 1DIWA 1RG8A 1JLYA 3CU1B 3BAHA 4EKXB 3FJDA 5F90A 3MPPG 2DREA 3ILAA 1UPSA 2F2FA 2KI6B 1IJTA 4D0ZA 3FJ9A 4A7ZA 4LO0C 4I4OA 1PWAA 3BRGC 4D0TA 3PHZA 4YOLA 3P6IA 4QBCA 2D22A 2Y9XE 4USPA 3FJBA 3BADA 5JMCA 1W3FA 5FZUA 3WA1A 3OJMA 3POKA 1JT3A 1FN0A 1M2TB 1BFGA 3IM5A 3OGGA 4I2SA 1V6VA 1FMMS 1TWEA 4XFTA 1HWOB 2I1BA 2K8RA 2VSEA 4EFQA 1AXMA 3NBEA 1S0DA 3NBNA 4J2YA 5DVHA 3AH4A 31BIA 1S0FA 3VEQA 2RQ9A 5EG6C 2Q9XA 4ZBVB 1RZOB 3ZXGA 3VSZA 3VT1A 3S8JA 3AH2A 1S0BA 1Z52A 4GAFA 2P23A 2Y9GA 4P0LA 5F8YA 2NP0A 5BQUC 2Q3NB 1PUMB 4I37A 4IYBA 4OW4A 4IY9A 1DFQA 4J2XA 3R4UA 3QR5A 1IOBA 1S0EA 1N4KA 4ZKTB 4J2KA 5BP5A 1II4A 3UD7A 3AJ6A 1CE7B 2Y9WC 4X39A 2X2TA 2M49A 1D0HA 4TLPA 3A07A 4ZA3B 2J3PA 3RTIB 4J2SA 2X2SA 3N0KA 4XFSA 2HZ9A 3BTAA 2D1ZA 2F8XC 1PC8B 1HWNB 2QYIB 1M16A 2ZQNA 1KNMA 3C9ZA 2HWMA 3CA3A 1AVUA 1BARA 3H6SE 4I8MA 3I29B 3N7MA 3AH1A 3I2XA 3AKIA 4X38A 4LO7C 3FJHA 1TTUA 3RTJB 3AJ5A 2WBCA 1E0OA 3A21A 5FZZA 3HSMA 2DS0A 2IWTB 1DQGA 2MC2A 5DZUA 4LO7B 4JQ0A 2D7RA 2LIQA 2E4MA 3CA5A 3CA1A 4GOYA 3FJEA 1FWUA 2Z48A 1JT4A 1BFFA 3C0NA 3VWCA 5D63A 1HWPB 4I1EA 1Q03A 4F34A 4OEGA 1QQLA 4X3AA 4JKXB 3WMVA 3K1XA 5BXSA 2KKIA 4I4UA 5GAQA 4H9WA 3VSFA 3T8SA 3H6RA 2K4AB 3LLPA 4I7IA 1MD6A 5HPZA 3VT0A 1XG6A 4LO3A 1P63A 5F8SA 2WRYA 3IM7A 1BFCA 4I0YA 1YBIA 5D61A 3FJIA 3H6RB 4IY8A 3FJAA 2F2FC 1ONKB 4FGFA 1FGAA 3P53A 2VSAA 3V79C 1Q1UA 1AF9A 4I4PA 4IZXA 1G9BA 1K5UA 3I2AA 1HCEA 2FFVA 4D8HA 1DJSB 1NUNA 1BLDA 1T9FA 3RMXA 1PZZA 3A22A 2L5XA 5BOWA 4QO3A 3RSJA 3IM6A 1ILR1 4FVVA 3IIRA 3FJCA 2RG9B 3AKFA 4OWJA 1JTCA 4F83A 3ZXDA 4I4QA 4QALA 3QYDA 4HJJA 3O4OA 1FV2A 3FUOA 2Y9FA 4IZEA 4JPZA 4QBVA 3BA7A 4OWKA 2MLLB 4H04A 1S0LA 1RMLA 4G9NA 4EFRA 3BB2A 1OQLB 2BEAA 1HKNA 1XZZA 4Q91A 3UJ4A 1EPWA 4X37A 5BXRA 4JRAA 4A7YA 3O49A 1TFMB 3UDAA 3V0AA 5FZYA 3B9UA 3N7KA 6I1BA 3F62B 4ISRA 4KEKA 3O3QA 1JT7A 4PC4A 3Q7XA 1WBAA 2HWAA 4KBBA 3FJFA 4EFPA 5BP5C 2ET2A 3WINC 3WINA 3WO2A 3BAUA 4P0JA 2VU9A 3O44A 1Z0HA 1W3GA 3FJKA 1A8DA 4ZFUB 3UD8A 3HN1A 2MIBA 4R6UB 4XFUA 4I4SA 1PUUB 2NVHA 1ISWA 4DEPA
chains in the Genus database with same CATH superfamily
2NM1A 2IHOA 4IONA 2DRZA 1TP0A 1WD3A 3FJJA 3PUBA 4I4XA 4OWLA 1ISXA 3HALA 3N7JA 3CA0A 3Q7WA 4ISQA 9ILBA 4ZFYB 4A7KA 4I96A 1HIBA 1GGPB 1YYNA 4USOA 2KI4A 3F1RA 3UJ0A 1G9DA 4J23B 5BXTA 4I6IA 2AFGA 1I1BA 1V6XA 3BAGA 4HA2A 1JT5A 1YTOA 3BA5A 3BX1C 1AVXB 2E4MC 1MC9A 3BRDA 2D42A 4I4RA 3G4OA 3CA4A 1L2HA 1DLLA 3BAOA 4GP3A 4JKQA 5EC5A 8I1BA 3BAQA 2BFHA 1Q04A 1IRPA 1FQ9A 2YUGA 3UD9A 4P6AA 4JP0A 2D44A 3FJ8A 3Q7YA 3OJ2A 2D43A 5E24E 2D7IA 2AAIB 4L4HA 5I1BA 3LTQA 1G82A 3NBCA 1IILA 5F8WA 5DUYA 4ZOTA 3E8LC 4LO2A 4Q9GA 1HCDA 3HBWA 4JAWA 4P0KA 1CVSA 2VUAA 3P6JA 1IT0A 1SR4A 1SR4C 1BLAA 4LO3C 4MZHA 4I1BA 1EYLA 5EHAA 5FNWA 1TIEA 3N7LA 2ERMA 4Z9WB 2LIEA 5FNXA 4XKIA 4II0A 1QXMA 2AQZA 2ZQOA 2KH2A 4EB2B 3CA6A 2NZ9A 2P39A 2GO2A 3OBTA 2VXRA 4IQPA 2VXTI 3ZC9A 5BVPI 2FO1A 1FWVA 1F31A 4QKSA 4KEIA 2UUSA 3WO3A 3R4SA 4G6MA 3W9TA 3WO4A 2QN4A 4OEFA 3JRRA 1EV2A 7I1BA 3O4CA 1ISZA 4OUJA 1NZKA 3ZC8A 4LO0A 1BA7A 4ZGRB 2KLLA 3PG0A 4IHZA 3CAHA 2D23A 3SNVA 2FGFA 2HW9A 1I1EA 4GP0A 1DFCA 1BASA 4G6JA 4ZFWB 3G4NA 3O4BA 4I4VA 4KC3A 1YF8B 1ISYA 1G9CA 4I3NA 4KEJA 2GZBA 3AZWA 1RY7A 3C0OA 3CRIA 4CJMA 3ZJXA 4ZLBB 1YXWA 41BIA 1TWMA 2R9KB 2ESUA 3A23A 4AN7B 2VLCA 1XYFA 1IHKA 2FFUA 1HWMB 5G00A 4GOVA 4QC4A 1SZ6B 3V0AB 1Z2VA 5B2HA 1Z4SA 3FGMA 2RSTA 4Z8SB 2K43A 3WMUA 3OGFA 3S8KA 3EF2A 1XHBA 4G9MA 4OEEA 3PMEA 1S0CA 2Z49A 4AN6A 3O4AA 1T4QA 1FV3A 2NYYA 2D20A 4Q9PA 3IAGC 1J0SA 3D7WB 5BQUA 3FFZA 1R8OA 1QQKA 2D24A 4DCKC 1FMZA 1AVWB 1TOOA 1W3AA 3JUTA 3BRFA 3BAVA 1AVAC 1JLXA 4HR6C 3RMYA 1ABRB 3AKGA 1IRAX 3V0BA 5DSSB 1PREA 3VT2A 3V0BB 3BA4A 1WBCA 4WBCA 1VCLA 4LO8B 5D62A 3TC2A 3CQAA 1AFCA 4L4IA 4QKRA 4ENDA 3NJ5A 1DQOA 1ISVA 3ZX7A 1DZCA 1V6WA 2FDBM 21BIA 2XOAA 2ZR1B 4G1RA 4LO1A 4LO1C 1R8NA 1V6UA 3FUQA 2DRYA 2AXMA 3OBRA 1ITBA 1S0GA 1JQZA 4GAIA 4DENA 3O5WB 3HOMA 5BXPA 3C0MA 3CRHA 4LO2C 3NBDA 3MALA 3O4DA 3OJVA 3H6QA 1DZDA 2NTDA 3AZVA 4EEEB 1WD4A 3AKHA 4QD2C 3VUOA 1BFBA 2BEBA 4I4YA 1EVTA 1UYJA 3HMYA 4QD2B 3KMVA 3CRGA 1G9AA 1K5VA 1JY0A 5JLVA 1DIWA 1RG8A 1JLYA 3CU1B 3BAHA 4EKXB 3FJDA 5F90A 3MPPG 2DREA 3ILAA 1UPSA 2F2FA 2KI6B 1IJTA 4D0ZA 3FJ9A 4A7ZA 4LO0C 4I4OA 1PWAA 3BRGC 4D0TA 3PHZA 4YOLA 3P6IA 4QBCA 2D22A 2Y9XE 4USPA 3FJBA 3BADA 5JMCA 1W3FA 5FZUA 3WA1A 3OJMA 3POKA 1JT3A 1FN0A 1M2TB 1BFGA 3IM5A 3OGGA 4I2SA 1V6VA 1FMMS 1TWEA 4XFTA 4H75A 1HWOB 2I1BA 2K8RA 2VSEA 4EFQA 1AXMA 3NBEA 1S0DA 3NBNA 4J2YA 5DVHA 3AH4A 31BIA 1S0FA 3VEQA 2RQ9A 5EG6C 2Q9XA 4ZBVB 1RZOB 3ZXGA 3VSZA 3VT1A 3S8JA 3AH2A 1S0BA 1Z52A 4GAFA 2P23A 2Y9GA 4P0LA 5F8YA 2NP0A 5BQUC 2Q3NB 1PUMB 4I37A 4IYBA 4OW4A 4IY9A 1DFQA 4J2XA 3R4UA 3QR5A 1IOBA 1S0EA 1N4KA 4ZKTB 4J2KA 5BP5A 1II4A 3UD7A 3AJ6A 1CE7B 2Y9WC 4X39A 2X2TA 2M49A 1D0HA 4TLPA 3A07A 4ZA3B 2J3PA 3RTIB 4J2SA 2X2SA 3N0KA 4XFSA 2HZ9A 3BTAA 2D1ZA 2F8XC 1PC8B 1HWNB 2QYIB 1M16A 2ZQNA 1KNMA 3C9ZA 2HWMA 3CA3A 1AVUA 1BARA 3H6SE 4I8MA 3I29B 4MZGB 3N7MA 3AH1A 3I2XA 3AKIA 4X38A 4LO7C 3FJHA 1TTUA 3RTJB 3AJ5A 2NS2A 2WBCA 1E0OA 3A21A 5FZZA 3HSMA 2DS0A 2IWTB 1DQGA 2MC2A 4UY4A 5DZUA 4LO7B 4JQ0A 2D7RA 2LIQA 2E4MA 3CA5A 3CA1A 4GOYA 3FJEA 1FWUA 2Z48A 1JT4A 1BFFA 3C0NA 3VWCA 5D63A 1HWPB 4I1EA 1Q03A 4F34A 4OEGA 1QQLA 4X3AA 4JKXB 3WMVA 3K1XA 5BXSA 2KKIA 4I4UA 5GAQA 4H9WA 3VSFA 3T8SA 3H6RA 2K4AB 3LLPA 4I7IA 1MD6A 5HPZA 3VT0A 1XG6A 4LO3A 1P63A 5F8SA 2WRYA 3IM7A 1BFCA 4I0YA 1YBIA 5D61A 3FJIA 3H6RB 4IY8A 3FJAA 2F2FC 1ONKB 4FGFA 1FGAA 3P53A 2VSAA 3V79C 1Q1UA 1AF9A 4I4PA 4IZXA 1G9BA 1K5UA 3I2AA 1HCEA 2FFVA 4D8HA 1DJSB 1NUNA 1BLDA 1T9FA 3RMXA 1PZZA 3A22A 2L5XA 5BOWA 4QO3A 3RSJA 3IM6A 1ILR1 4FVVA 3IIRA 3FJCA 2RG9B 3AKFA 4OWJA 1JTCA 4F83A 3ZXDA 4I4QA 4QALA 3QYDA 4HJJA 3O4OA 1FV2A 3FUOA 2Y9FA 4IZEA 4JPZA 4QBVA 3BA7A 4OWKA 2MLLB 4H04A 1S0LA 1RMLA 4G9NA 4EFRA 3BB2A 1OQLB 2BEAA 1HKNA 1XZZA 4Q91A 3UJ4A 1EPWA 4X37A 5BXRA 4JRAA 4A7YA 3O49A 1TFMB 3UDAA 3V0AA 5FZYA 3B9UA 3N7KA 6I1BA 3F62B 4ISRA 4KEKA 3O3QA 1JT7A 4PC4A 3Q7XA 1WBAA 2HWAA 4KBBA 3FJFA 4EFPA 5BP5C 2ET2A 3WINC 3WINA 3WO2A 3BAUA 4P0JA 2VU9A 3O44A 1Z0HA 1W3GA 3FJKA 1A8DA 4MZFB 4ZFUB 3UD8A 3HN1A 2MIBA 4R6UB 4XFUA 4I4SA 1PUUB 2NVHA 1ISWA 4DEPA
chains in the Genus database with same CATH topology
2NM1A 2IHOA 4IONA 2DRZA 1TP0A 1WD3A 3FJJA 3PUBA 4I4XA 4OWLA 1ISXA 3HALA 3N7JA 3CA0A 3Q7WA 4ISQA 9ILBA 4ZFYB 4A7KA 4I96A 1HIBA 1GGPB 1YYNA 4USOA 2KI4A 3F1RA 3UJ0A 1G9DA 4J23B 5BXTA 4I6IA 2AFGA 1I1BA 1V6XA 3BAGA 4HA2A 1JT5A 1YTOA 3BA5A 3BX1C 1AVXB 2E4MC 1MC9A 3BRDA 2D42A 4I4RA 3G4OA 3CA4A 1L2HA 1DLLA 3BAOA 4GP3A 4JKQA 5EC5A 8I1BA 3BAQA 2BFHA 1Q04A 1IRPA 1FQ9A 2YUGA 3UD9A 4P6AA 4JP0A 2D44A 3FJ8A 3Q7YA 3OJ2A 2D43A 5E24E 2D7IA 2AAIB 4L4HA 5I1BA 3LTQA 1G82A 3NBCA 1IILA 5F8WA 5DUYA 4ZOTA 3E8LC 4LO2A 4Q9GA 1HCDA 3HBWA 4JAWA 4P0KA 1CVSA 2VUAA 3P6JA 1IT0A 1SR4A 1SR4C 1BLAA 4LO3C 4MZHA 4I1BA 1EYLA 5EHAA 5FNWA 1TIEA 3N7LA 2ERMA 4Z9WB 2LIEA 5FNXA 4XKIA 4II0A 1QXMA 2AQZA 2ZQOA 2KH2A 4EB2B 3CA6A 2NZ9A 2P39A 2GO2A 3OBTA 2VXRA 4IQPA 2VXTI 3ZC9A 5BVPI 2FO1A 1FWVA 1F31A 4QKSA 4KEIA 2UUSA 3WO3A 3R4SA 4G6MA 3W9TA 3WO4A 2QN4A 4OEFA 3JRRA 1EV2A 7I1BA 3O4CA 1ISZA 4OUJA 1NZKA 3ZC8A 4LO0A 1BA7A 4ZGRB 2KLLA 3PG0A 4IHZA 3CAHA 2D23A 3SNVA 2FGFA 2HW9A 1I1EA 4GP0A 1DFCA 1BASA 4G6JA 4ZFWB 3G4NA 3O4BA 4I4VA 4KC3A 1YF8B 1ISYA 1G9CA 4I3NA 4KEJA 2GZBA 3AZWA 1RY7A 3C0OA 3CRIA 4CJMA 3ZJXA 4ZLBB 1YXWA 41BIA 1TWMA 2R9KB 2ESUA 3A23A 4AN7B 2VLCA 1XYFA 1IHKA 2FFUA 1HWMB 5G00A 4GOVA 4QC4A 1SZ6B 3V0AB 1Z2VA 5B2HA 1Z4SA 3FGMA 2RSTA 4Z8SB 2K43A 3WMUA 3OGFA 3S8KA 3EF2A 1XHBA 4G9MA 4OEEA 3PMEA 1S0CA 2Z49A 4AN6A 3O4AA 1T4QA 1FV3A 2NYYA 2D20A 4Q9PA 3IAGC 1J0SA 3D7WB 5BQUA 3FFZA 1R8OA 1QQKA 2D24A 4DCKC 1FMZA 1AVWB 1TOOA 1W3AA 3JUTA 3BRFA 3BAVA 1AVAC 1JLXA 4HR6C 3RMYA 1ABRB 3AKGA 1IRAX 3V0BA 5DSSB 1PREA 3VT2A 3V0BB 3BA4A 1WBCA 4WBCA 1VCLA 4LO8B 5D62A 3TC2A 3CQAA 1AFCA 4L4IA 4QKRA 4ENDA 3NJ5A 1DQOA 1ISVA 3ZX7A 1DZCA 1V6WA 2FDBM 21BIA 2XOAA 2ZR1B 4G1RA 4LO1A 4LO1C 1R8NA 1V6UA 3FUQA 2DRYA 2AXMA 3OBRA 1ITBA 1S0GA 1JQZA 4GAIA 4DENA 3O5WB 3HOMA 5BXPA 3C0MA 3CRHA 4LO2C 3NBDA 3MALA 3O4DA 3OJVA 3H6QA 1DZDA 2NTDA 3AZVA 4EEEB 1WD4A 3AKHA 4QD2C 3VUOA 1BFBA 2BEBA 4I4YA 1EVTA 1UYJA 3HMYA 4QD2B 3KMVA 3CRGA 1G9AA 1K5VA 1JY0A 5JLVA 1DIWA 1RG8A 1JLYA 3CU1B 3BAHA 4EKXB 3FJDA 5F90A 3MPPG 2DREA 3ILAA 1UPSA 2F2FA 2KI6B 1IJTA 4D0ZA 3FJ9A 4A7ZA 4LO0C 4I4OA 1PWAA 3BRGC 4D0TA 3PHZA 4YOLA 3P6IA 4QBCA 2D22A 2Y9XE 4USPA 3FJBA 3BADA 5JMCA 1W3FA 5FZUA 3WA1A 3OJMA 3POKA 1JT3A 1FN0A 1M2TB 1BFGA 3IM5A 3OGGA 4I2SA 1V6VA 1FMMS 1TWEA 4XFTA 4H75A 1HWOB 2I1BA 2K8RA 2VSEA 4EFQA 1AXMA 3NBEA 1S0DA 3NBNA 4J2YA 5DVHA 3AH4A 31BIA 1S0FA 3VEQA 2RQ9A 5EG6C 2Q9XA 4ZBVB 1RZOB 3ZXGA 3VSZA 3VT1A 3S8JA 3AH2A 1S0BA 1Z52A 4GAFA 2P23A 2Y9GA 4P0LA 5F8YA 2NP0A 5BQUC 2Q3NB 1PUMB 4I37A 4IYBA 4OW4A 4IY9A 1DFQA 4J2XA 3R4UA 3QR5A 1IOBA 1S0EA 1N4KA 4ZKTB 4J2KA 5BP5A 1II4A 3UD7A 3AJ6A 1CE7B 2Y9WC 4X39A 2X2TA 2M49A 1D0HA 4TLPA 3A07A 4ZA3B 2J3PA 3RTIB 4J2SA 2X2SA 3N0KA 4XFSA 2HZ9A 3BTAA 2D1ZA 2F8XC 1PC8B 1HWNB 2QYIB 1M16A 2ZQNA 1KNMA 3C9ZA 2HWMA 3CA3A 1AVUA 1BARA 3H6SE 4I8MA 3I29B 4MZGB 3N7MA 3AH1A 3I2XA 3AKIA 4X38A 4LO7C 3FJHA 1TTUA 3RTJB 3AJ5A 2NS2A 2WBCA 1E0OA 3A21A 5FZZA 3HSMA 2DS0A 2IWTB 1DQGA 2MC2A 4UY4A 5DZUA 4LO7B 4JQ0A 2D7RA 2LIQA 2E4MA 3CA5A 3CA1A 4GOYA 3FJEA 1FWUA 2Z48A 1JT4A 1BFFA 3C0NA 3VWCA 5D63A 1HWPB 4I1EA 1Q03A 4F34A 4OEGA 1QQLA 4X3AA 4JKXB 3WMVA 3K1XA 5BXSA 2KKIA 4I4UA 5GAQA 4H9WA 3VSFA 3T8SA 3H6RA 2K4AB 3LLPA 4I7IA 1MD6A 5HPZA 3VT0A 1XG6A 4LO3A 1P63A 5F8SA 2WRYA 3IM7A 1BFCA 4I0YA 1YBIA 5D61A 3FJIA 3H6RB 4IY8A 3FJAA 2F2FC 1ONKB 4FGFA 1FGAA 3P53A 2VSAA 3V79C 1Q1UA 1AF9A 4I4PA 4IZXA 1G9BA 1K5UA 3I2AA 1HCEA 2FFVA 4D8HA 1DJSB 1NUNA 1BLDA 1T9FA 3RMXA 1PZZA 3A22A 2L5XA 5BOWA 4QO3A 3RSJA 3IM6A 1ILR1 4FVVA 3IIRA 3FJCA 2RG9B 3AKFA 4OWJA 1JTCA 4F83A 3ZXDA 4I4QA 4QALA 3QYDA 4HJJA 3O4OA 1FV2A 3FUOA 2Y9FA 4IZEA 4JPZA 4QBVA 3BA7A 4OWKA 2MLLB 4H04A 1S0LA 1RMLA 4G9NA 4EFRA 3BB2A 1OQLB 2BEAA 1HKNA 1XZZA 4Q91A 3UJ4A 1EPWA 4X37A 5BXRA 4JRAA 4A7YA 3O49A 1TFMB 3UDAA 3V0AA 5FZYA 3B9UA 3N7KA 6I1BA 3F62B 4ISRA 4KEKA 3O3QA 1JT7A 4PC4A 3Q7XA 1WBAA 2HWAA 4KBBA 3FJFA 4EFPA 5BP5C 2ET2A 3WINC 3WINA 3WO2A 3BAUA 4P0JA 2VU9A 3O44A 1Z0HA 1W3GA 3FJKA 1A8DA 4MZFB 4ZFUB 3UD8A 3HN1A 2MIBA 4R6UB 4XFUA 4I4SA 1PUUB 2NVHA 1ISWA 4DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NM1 A;  2IHO A;  4ION A;  2DRZ A;  1TP0 A;  1WD3 A;  3FJJ A;  3PUB A;  4I4X A;  4OWL A;  1ISX A;  3HAL A;  3N7J A;  3CA0 A;  3Q7W A;  4ISQ A;  9ILB A;  4ZFY B;  4A7K A;  4I96 A;  1HIB A;  1GGP B;  1YYN A;  4USO A;  2KI4 A;  3F1R A;  3UJ0 A;  1G9D A;  4J23 B;  5BXT A;  4I6I A;  2AFG A;  1I1B A;  1V6X A;  3BAG A;  4HA2 A;  1JT5 A;  1YTO A;  3BA5 A;  3BX1 C;  1AVX B;  2E4M C;  1MC9 A;  3BRD A;  2D42 A;  4I4R A;  3G4O A;  3CA4 A;  1L2H A;  1DLL A;  3BAO A;  4GP3 A;  4JKQ A;  5EC5 A;  8I1B A;  3BAQ A;  2BFH A;  1Q04 A;  1IRP A;  1FQ9 A;  2YUG A;  3UD9 A;  4P6A A;  4JP0 A;  2D44 A;  3FJ8 A;  3Q7Y A;  3OJ2 A;  2D43 A;  5E24 E;  2D7I A;  2AAI B;  4L4H A;  5I1B A;  3LTQ A;  1G82 A;  3NBC A;  1IIL A;  5F8W A;  5DUY A;  4ZOT A;  3E8L C;  4LO2 A;  4Q9G A;  1HCD A;  3HBW A;  4JAW A;  4P0K A;  1CVS A;  2VUA A;  3P6J A;  1IT0 A;  1SR4 A;  1SR4 C;  1BLA A;  4LO3 C;  4I1B A;  1EYL A;  5EHA A;  5FNW A;  1TIE A;  3N7L A;  2ERM A;  4Z9W B;  2LIE A;  5FNX A;  4XKI A;  4II0 A;  1QXM A;  2AQZ A;  2ZQO A;  2KH2 A;  4EB2 B;  3CA6 A;  2NZ9 A;  2P39 A;  2GO2 A;  3OBT A;  2VXR A;  4IQP A;  2VXT I;  3ZC9 A;  5BVP I;  2FO1 A;  1FWV A;  1F31 A;  4QKS A;  4KEI A;  2UUS A;  3WO3 A;  3R4S A;  4G6M A;  3W9T A;  3WO4 A;  2QN4 A;  4OEF A;  3JRR A;  1EV2 A;  7I1B A;  3O4C A;  1ISZ A;  4OUJ A;  1NZK A;  3ZC8 A;  4LO0 A;  1BA7 A;  4ZGR B;  2KLL A;  3PG0 A;  4IHZ A;  3CAH A;  2D23 A;  3SNV A;  2FGF A;  2HW9 A;  1I1E A;  4GP0 A;  1DFC A;  1BAS A;  4G6J A;  4ZFW B;  3G4N A;  3O4B A;  4I4V A;  4KC3 A;  1YF8 B;  1ISY A;  1G9C A;  4I3N A;  4KEJ A;  2GZB A;  3AZW A;  1RY7 A;  3C0O A;  3CRI A;  4CJM A;  3ZJX A;  4ZLB B;  1YXW A;  41BI A;  1TWM A;  2R9K B;  2ESU A;  3A23 A;  4AN7 B;  2VLC A;  1XYF A;  1IHK A;  2FFU A;  1HWM B;  5G00 A;  4GOV A;  4QC4 A;  1SZ6 B;  3V0A B;  1Z2V A;  5B2H A;  1Z4S A;  3FGM A;  2RST A;  4Z8S B;  2K43 A;  3WMU A;  3OGF A;  3S8K A;  3EF2 A;  1XHB A;  4G9M A;  4OEE A;  3PME A;  1S0C A;  2Z49 A;  4AN6 A;  3O4A A;  1T4Q A;  1FV3 A;  2NYY A;  2D20 A;  4Q9P A;  3IAG C;  1J0S A;  3D7W B;  5BQU A;  3FFZ A;  1R8O A;  1QQK A;  2D24 A;  4DCK C;  1FMZ A;  1AVW B;  1TOO A;  1W3A A;  3JUT A;  3BRF A;  3BAV A;  1AVA C;  1JLX A;  4HR6 C;  3RMY A;  1ABR B;  3AKG A;  1IRA X;  3V0B A;  5DSS B;  1PRE A;  3VT2 A;  3V0B B;  3BA4 A;  1WBC A;  4WBC A;  1VCL A;  4LO8 B;  5D62 A;  3TC2 A;  3CQA A;  1AFC A;  4L4I A;  4QKR A;  4END A;  3NJ5 A;  1DQO A;  1ISV A;  3ZX7 A;  1DZC A;  1V6W A;  2FDB M;  21BI A;  2XOA A;  2ZR1 B;  4G1R A;  4LO1 A;  4LO1 C;  1R8N A;  1V6U A;  3FUQ A;  2DRY A;  2AXM A;  3OBR A;  1ITB A;  1S0G A;  1JQZ A;  4GAI A;  4DEN A;  3O5W B;  3HOM A;  5BXP A;  3C0M A;  3CRH A;  4LO2 C;  3NBD A;  3MAL A;  3O4D A;  3OJV A;  3H6Q A;  1DZD A;  2NTD A;  3AZV A;  4EEE B;  1WD4 A;  3AKH A;  4QD2 C;  3VUO A;  1BFB A;  2BEB A;  4I4Y A;  1EVT A;  1UYJ A;  3HMY A;  4QD2 B;  3KMV A;  3CRG A;  1G9A A;  1K5V A;  1JY0 A;  5JLV A;  1DIW A;  1RG8 A;  1JLY A;  3CU1 B;  3BAH A;  4EKX B;  3FJD A;  5F90 A;  3MPP G;  2DRE A;  3ILA A;  1UPS A;  2F2F A;  2KI6 B;  1IJT A;  4D0Z A;  3FJ9 A;  4A7Z A;  4LO0 C;  4I4O A;  1PWA A;  3BRG C;  4D0T A;  3PHZ A;  4YOL A;  3P6I A;  4QBC A;  2D22 A;  2Y9X E;  4USP A;  3FJB A;  3BAD A;  5JMC A;  1W3F A;  5FZU A;  3WA1 A;  3OJM A;  3POK A;  1JT3 A;  1FN0 A;  1M2T B;  1BFG A;  3IM5 A;  3OGG A;  4I2S A;  1V6V A;  1FMM S;  1TWE A;  4XFT A;  1HWO B;  2I1B A;  2K8R A;  2VSE A;  4EFQ A;  1AXM A;  3NBE A;  1S0D A;  3NBN A;  4J2Y A;  5DVH A;  3AH4 A;  31BI A;  1S0F A;  3VEQ A;  2RQ9 A;  5EG6 C;  2Q9X A;  4ZBV B;  1RZO B;  3ZXG A;  3VSZ A;  3VT1 A;  3S8J A;  3AH2 A;  1S0B A;  1Z52 A;  4GAF A;  2P23 A;  2Y9G A;  4P0L A;  5F8Y A;  2NP0 A;  5BQU C;  2Q3N B;  1PUM B;  4I37 A;  4IYB A;  4OW4 A;  4IY9 A;  1DFQ A;  4J2X A;  3R4U A;  3QR5 A;  1IOB A;  1S0E A;  1N4K A;  4ZKT B;  4J2K A;  5BP5 A;  1II4 A;  3UD7 A;  3AJ6 A;  1CE7 B;  2Y9W C;  4X39 A;  2X2T A;  2M49 A;  1D0H A;  4TLP A;  3A07 A;  4ZA3 B;  2J3P A;  3RTI B;  4J2S A;  2X2S A;  3N0K A;  4XFS A;  2HZ9 A;  3BTA A;  2D1Z A;  2F8X C;  1PC8 B;  1HWN B;  2QYI B;  1M16 A;  2ZQN A;  1KNM A;  3C9Z A;  2HWM A;  3CA3 A;  1AVU A;  1BAR A;  3H6S E;  4I8M A;  3I29 B;  3N7M A;  3AH1 A;  3I2X A;  3AKI A;  4X38 A;  4LO7 C;  3FJH A;  1TTU A;  3RTJ B;  3AJ5 A;  2WBC A;  1E0O A;  3A21 A;  5FZZ A;  3HSM A;  2DS0 A;  2IWT B;  1DQG A;  2MC2 A;  5DZU A;  4LO7 B;  4JQ0 A;  2D7R A;  2LIQ A;  2E4M A;  3CA5 A;  3CA1 A;  4GOY A;  3FJE A;  1FWU A;  2Z48 A;  1JT4 A;  1BFF A;  3C0N A;  3VWC A;  5D63 A;  1HWP B;  4I1E A;  1Q03 A;  4F34 A;  4OEG A;  1QQL A;  4X3A A;  4JKX B;  3WMV A;  3K1X A;  5BXS A;  2KKI A;  4I4U A;  5GAQ A;  4H9W A;  3VSF A;  3T8S A;  3H6R A;  2K4A B;  3LLP A;  4I7I A;  1MD6 A;  5HPZ A;  3VT0 A;  1XG6 A;  4LO3 A;  1P63 A;  5F8S A;  2WRY A;  3IM7 A;  1BFC A;  4I0Y A;  1YBI A;  5D61 A;  3FJI A;  3H6R B;  4IY8 A;  3FJA A;  2F2F C;  1ONK B;  4FGF A;  1FGA A;  3P53 A;  2VSA A;  3V79 C;  1Q1U A;  1AF9 A;  4I4P A;  4IZX A;  1G9B A;  1K5U A;  3I2A A;  1HCE A;  2FFV A;  4D8H A;  1DJS B;  1NUN A;  1BLD A;  1T9F A;  3RMX A;  1PZZ A;  3A22 A;  2L5X A;  5BOW A;  4QO3 A;  3RSJ A;  3IM6 A;  1ILR 1;  4FVV A;  3IIR A;  3FJC A;  2RG9 B;  3AKF A;  4OWJ A;  1JTC A;  4F83 A;  3ZXD A;  4I4Q A;  4QAL A;  3QYD A;  4HJJ A;  3O4O A;  1FV2 A;  3FUO A;  2Y9F A;  4IZE A;  4JPZ A;  4QBV A;  3BA7 A;  4OWK A;  2MLL B;  4H04 A;  1S0L A;  1RML A;  4G9N A;  4EFR A;  3BB2 A;  1OQL B;  2BEA A;  1HKN A;  1XZZ A;  4Q91 A;  3UJ4 A;  1EPW A;  4X37 A;  5BXR A;  4JRA A;  4A7Y A;  3O49 A;  1TFM B;  3UDA A;  3V0A A;  5FZY A;  3B9U A;  3N7K A;  6I1B A;  3F62 B;  4ISR A;  4KEK A;  3O3Q A;  1JT7 A;  4PC4 A;  3Q7X A;  1WBA A;  2HWA A;  4KBB A;  3FJF A;  4EFP A;  5BP5 C;  2ET2 A;  3WIN C;  3WIN A;  3WO2 A;  3BAU A;  4P0J A;  2VU9 A;  3O44 A;  1Z0H A;  1W3G A;  3FJK A;  1A8D A;  4ZFU B;  3UD8 A;  3HN1 A;  2MIB A;  4R6U B;  4XFU A;  4I4S A;  1PUU B;  2NVH A;  1ISW A;  4DEP A; 
#chains in the Genus database with same CATH topology
 2NM1 A;  2IHO A;  4ION A;  2DRZ A;  1TP0 A;  1WD3 A;  3FJJ A;  3PUB A;  4I4X A;  4OWL A;  1ISX A;  3HAL A;  3N7J A;  3CA0 A;  3Q7W A;  4ISQ A;  9ILB A;  4ZFY B;  4A7K A;  4I96 A;  1HIB A;  1GGP B;  1YYN A;  4USO A;  2KI4 A;  3F1R A;  3UJ0 A;  1G9D A;  4J23 B;  5BXT A;  4I6I A;  2AFG A;  1I1B A;  1V6X A;  3BAG A;  4HA2 A;  1JT5 A;  1YTO A;  3BA5 A;  3BX1 C;  1AVX B;  2E4M C;  1MC9 A;  3BRD A;  2D42 A;  4I4R A;  3G4O A;  3CA4 A;  1L2H A;  1DLL A;  3BAO A;  4GP3 A;  4JKQ A;  5EC5 A;  8I1B A;  3BAQ A;  2BFH A;  1Q04 A;  1IRP A;  1FQ9 A;  2YUG A;  3UD9 A;  4P6A A;  4JP0 A;  2D44 A;  3FJ8 A;  3Q7Y A;  3OJ2 A;  2D43 A;  5E24 E;  2D7I A;  2AAI B;  4L4H A;  5I1B A;  3LTQ A;  1G82 A;  3NBC A;  1IIL A;  5F8W A;  5DUY A;  4ZOT A;  3E8L C;  4LO2 A;  4Q9G A;  1HCD A;  3HBW A;  4JAW A;  4P0K A;  1CVS A;  2VUA A;  3P6J A;  1IT0 A;  1SR4 A;  1SR4 C;  1BLA A;  4LO3 C;  4MZH A;  4I1B A;  1EYL A;  5EHA A;  5FNW A;  1TIE A;  3N7L A;  2ERM A;  4Z9W B;  2LIE A;  5FNX A;  4XKI A;  4II0 A;  1QXM A;  2AQZ A;  2ZQO A;  2KH2 A;  4EB2 B;  3CA6 A;  2NZ9 A;  2P39 A;  2GO2 A;  3OBT A;  2VXR A;  4IQP A;  2VXT I;  3ZC9 A;  5BVP I;  2FO1 A;  1FWV A;  1F31 A;  4QKS A;  4KEI A;  2UUS A;  3WO3 A;  3R4S A;  4G6M A;  3W9T A;  3WO4 A;  2QN4 A;  4OEF A;  3JRR A;  1EV2 A;  7I1B A;  3O4C A;  1ISZ A;  4OUJ A;  1NZK A;  3ZC8 A;  4LO0 A;  1BA7 A;  4ZGR B;  2KLL A;  3PG0 A;  4IHZ A;  3CAH A;  2D23 A;  3SNV A;  2FGF A;  2HW9 A;  1I1E A;  4GP0 A;  1DFC A;  1BAS A;  4G6J A;  4ZFW B;  3G4N A;  3O4B A;  4I4V A;  4KC3 A;  1YF8 B;  1ISY A;  1G9C A;  4I3N A;  4KEJ A;  2GZB A;  3AZW A;  1RY7 A;  3C0O A;  3CRI A;  4CJM A;  3ZJX A;  4ZLB B;  1YXW A;  41BI A;  1TWM A;  2R9K B;  2ESU A;  3A23 A;  4AN7 B;  2VLC A;  1XYF A;  1IHK A;  2FFU A;  1HWM B;  5G00 A;  4GOV A;  4QC4 A;  1SZ6 B;  3V0A B;  1Z2V A;  5B2H A;  1Z4S A;  3FGM A;  2RST A;  4Z8S B;  2K43 A;  3WMU A;  3OGF A;  3S8K A;  3EF2 A;  1XHB A;  4G9M A;  4OEE A;  3PME A;  1S0C A;  2Z49 A;  4AN6 A;  3O4A A;  1T4Q A;  1FV3 A;  2NYY A;  2D20 A;  4Q9P A;  3IAG C;  1J0S A;  3D7W B;  5BQU A;  3FFZ A;  1R8O A;  1QQK A;  2D24 A;  4DCK C;  1FMZ A;  1AVW B;  1TOO A;  1W3A A;  3JUT A;  3BRF A;  3BAV A;  1AVA C;  1JLX A;  4HR6 C;  3RMY A;  1ABR B;  3AKG A;  1IRA X;  3V0B A;  5DSS B;  1PRE A;  3VT2 A;  3V0B B;  3BA4 A;  1WBC A;  4WBC A;  1VCL A;  4LO8 B;  5D62 A;  3TC2 A;  3CQA A;  1AFC A;  4L4I A;  4QKR A;  4END A;  3NJ5 A;  1DQO A;  1ISV A;  3ZX7 A;  1DZC A;  1V6W A;  2FDB M;  21BI A;  2XOA A;  2ZR1 B;  4G1R A;  4LO1 A;  4LO1 C;  1R8N A;  1V6U A;  3FUQ A;  2DRY A;  2AXM A;  3OBR A;  1ITB A;  1S0G A;  1JQZ A;  4GAI A;  4DEN A;  3O5W B;  3HOM A;  5BXP A;  3C0M A;  3CRH A;  4LO2 C;  3NBD A;  3MAL A;  3O4D A;  3OJV A;  3H6Q A;  1DZD A;  2NTD A;  3AZV A;  4EEE B;  1WD4 A;  3AKH A;  4QD2 C;  3VUO A;  1BFB A;  2BEB A;  4I4Y A;  1EVT A;  1UYJ A;  3HMY A;  4QD2 B;  3KMV A;  3CRG A;  1G9A A;  1K5V A;  1JY0 A;  5JLV A;  1DIW A;  1RG8 A;  1JLY A;  3CU1 B;  3BAH A;  4EKX B;  3FJD A;  5F90 A;  3MPP G;  2DRE A;  3ILA A;  1UPS A;  2F2F A;  2KI6 B;  1IJT A;  4D0Z A;  3FJ9 A;  4A7Z A;  4LO0 C;  4I4O A;  1PWA A;  3BRG C;  4D0T A;  3PHZ A;  4YOL A;  3P6I A;  4QBC A;  2D22 A;  2Y9X E;  4USP A;  3FJB A;  3BAD A;  5JMC A;  1W3F A;  5FZU A;  3WA1 A;  3OJM A;  3POK A;  1JT3 A;  1FN0 A;  1M2T B;  1BFG A;  3IM5 A;  3OGG A;  4I2S A;  1V6V A;  1FMM S;  1TWE A;  4XFT A;  4H75 A;  1HWO B;  2I1B A;  2K8R A;  2VSE A;  4EFQ A;  1AXM A;  3NBE A;  1S0D A;  3NBN A;  4J2Y A;  5DVH A;  3AH4 A;  31BI A;  1S0F A;  3VEQ A;  2RQ9 A;  5EG6 C;  2Q9X A;  4ZBV B;  1RZO B;  3ZXG A;  3VSZ A;  3VT1 A;  3S8J A;  3AH2 A;  1S0B A;  1Z52 A;  4GAF A;  2P23 A;  2Y9G A;  4P0L A;  5F8Y A;  2NP0 A;  5BQU C;  2Q3N B;  1PUM B;  4I37 A;  4IYB A;  4OW4 A;  4IY9 A;  1DFQ A;  4J2X A;  3R4U A;  3QR5 A;  1IOB A;  1S0E A;  1N4K A;  4ZKT B;  4J2K A;  5BP5 A;  1II4 A;  3UD7 A;  3AJ6 A;  1CE7 B;  2Y9W C;  4X39 A;  2X2T A;  2M49 A;  1D0H A;  4TLP A;  3A07 A;  4ZA3 B;  2J3P A;  3RTI B;  4J2S A;  2X2S A;  3N0K A;  4XFS A;  2HZ9 A;  3BTA A;  2D1Z A;  2F8X C;  1PC8 B;  1HWN B;  2QYI B;  1M16 A;  2ZQN A;  1KNM A;  3C9Z A;  2HWM A;  3CA3 A;  1AVU A;  1BAR A;  3H6S E;  4I8M A;  3I29 B;  4MZG B;  3N7M A;  3AH1 A;  3I2X A;  3AKI A;  4X38 A;  4LO7 C;  3FJH A;  1TTU A;  3RTJ B;  3AJ5 A;  2NS2 A;  2WBC A;  1E0O A;  3A21 A;  5FZZ A;  3HSM A;  2DS0 A;  2IWT B;  1DQG A;  2MC2 A;  4UY4 A;  5DZU A;  4LO7 B;  4JQ0 A;  2D7R A;  2LIQ A;  2E4M A;  3CA5 A;  3CA1 A;  4GOY A;  3FJE A;  1FWU A;  2Z48 A;  1JT4 A;  1BFF A;  3C0N A;  3VWC A;  5D63 A;  1HWP B;  4I1E A;  1Q03 A;  4F34 A;  4OEG A;  1QQL A;  4X3A A;  4JKX B;  3WMV A;  3K1X A;  5BXS A;  2KKI A;  4I4U A;  5GAQ A;  4H9W A;  3VSF A;  3T8S A;  3H6R A;  2K4A B;  3LLP A;  4I7I A;  1MD6 A;  5HPZ A;  3VT0 A;  1XG6 A;  4LO3 A;  1P63 A;  5F8S A;  2WRY A;  3IM7 A;  1BFC A;  4I0Y A;  1YBI A;  5D61 A;  3FJI A;  3H6R B;  4IY8 A;  3FJA A;  2F2F C;  1ONK B;  4FGF A;  1FGA A;  3P53 A;  2VSA A;  3V79 C;  1Q1U A;  1AF9 A;  4I4P A;  4IZX A;  1G9B A;  1K5U A;  3I2A A;  1HCE A;  2FFV A;  4D8H A;  1DJS B;  1NUN A;  1BLD A;  1T9F A;  3RMX A;  1PZZ A;  3A22 A;  2L5X A;  5BOW A;  4QO3 A;  3RSJ A;  3IM6 A;  1ILR 1;  4FVV A;  3IIR A;  3FJC A;  2RG9 B;  3AKF A;  4OWJ A;  1JTC A;  4F83 A;  3ZXD A;  4I4Q A;  4QAL A;  3QYD A;  4HJJ A;  3O4O A;  1FV2 A;  3FUO A;  2Y9F A;  4IZE A;  4JPZ A;  4QBV A;  3BA7 A;  4OWK A;  2MLL B;  4H04 A;  1S0L A;  1RML A;  4G9N A;  4EFR A;  3BB2 A;  1OQL B;  2BEA A;  1HKN A;  1XZZ A;  4Q91 A;  3UJ4 A;  1EPW A;  4X37 A;  5BXR A;  4JRA A;  4A7Y A;  3O49 A;  1TFM B;  3UDA A;  3V0A A;  5FZY A;  3B9U A;  3N7K A;  6I1B A;  3F62 B;  4ISR A;  4KEK A;  3O3Q A;  1JT7 A;  4PC4 A;  3Q7X A;  1WBA A;  2HWA A;  4KBB A;  3FJF A;  4EFP A;  5BP5 C;  2ET2 A;  3WIN C;  3WIN A;  3WO2 A;  3BAU A;  4P0J A;  2VU9 A;  3O44 A;  1Z0H A;  1W3G A;  3FJK A;  1A8D A;  4MZF B;  4ZFU B;  3UD8 A;  3HN1 A;  2MIB A;  4R6U B;  4XFU A;  4I4S A;  1PUU B;  2NVH A;  1ISW A;  4DEP A; 
#chains in the Genus database with same CATH homology
 2NM1 A;  2IHO A;  4ION A;  2DRZ A;  1TP0 A;  1WD3 A;  3FJJ A;  3PUB A;  4I4X A;  4OWL A;  1ISX A;  3HAL A;  3N7J A;  3CA0 A;  3Q7W A;  4ISQ A;  9ILB A;  4ZFY B;  4A7K A;  4I96 A;  1HIB A;  1GGP B;  1YYN A;  4USO A;  2KI4 A;  3F1R A;  3UJ0 A;  1G9D A;  4J23 B;  5BXT A;  4I6I A;  2AFG A;  1I1B A;  1V6X A;  3BAG A;  4HA2 A;  1JT5 A;  1YTO A;  3BA5 A;  3BX1 C;  1AVX B;  2E4M C;  1MC9 A;  3BRD A;  2D42 A;  4I4R A;  3G4O A;  3CA4 A;  1L2H A;  1DLL A;  3BAO A;  4GP3 A;  4JKQ A;  5EC5 A;  8I1B A;  3BAQ A;  2BFH A;  1Q04 A;  1IRP A;  1FQ9 A;  2YUG A;  3UD9 A;  4P6A A;  4JP0 A;  2D44 A;  3FJ8 A;  3Q7Y A;  3OJ2 A;  2D43 A;  5E24 E;  2D7I A;  2AAI B;  4L4H A;  5I1B A;  3LTQ A;  1G82 A;  3NBC A;  1IIL A;  5F8W A;  5DUY A;  4ZOT A;  3E8L C;  4LO2 A;  4Q9G A;  1HCD A;  3HBW A;  4JAW A;  4P0K A;  1CVS A;  2VUA A;  3P6J A;  1IT0 A;  1SR4 A;  1SR4 C;  1BLA A;  4LO3 C;  4MZH A;  4I1B A;  1EYL A;  5EHA A;  5FNW A;  1TIE A;  3N7L A;  2ERM A;  4Z9W B;  2LIE A;  5FNX A;  4XKI A;  4II0 A;  1QXM A;  2AQZ A;  2ZQO A;  2KH2 A;  4EB2 B;  3CA6 A;  2NZ9 A;  2P39 A;  2GO2 A;  3OBT A;  2VXR A;  4IQP A;  2VXT I;  3ZC9 A;  5BVP I;  2FO1 A;  1FWV A;  1F31 A;  4QKS A;  4KEI A;  2UUS A;  3WO3 A;  3R4S A;  4G6M A;  3W9T A;  3WO4 A;  2QN4 A;  4OEF A;  3JRR A;  1EV2 A;  7I1B A;  3O4C A;  1ISZ A;  4OUJ A;  1NZK A;  3ZC8 A;  4LO0 A;  1BA7 A;  4ZGR B;  2KLL A;  3PG0 A;  4IHZ A;  3CAH A;  2D23 A;  3SNV A;  2FGF A;  2HW9 A;  1I1E A;  4GP0 A;  1DFC A;  1BAS A;  4G6J A;  4ZFW B;  3G4N A;  3O4B A;  4I4V A;  4KC3 A;  1YF8 B;  1ISY A;  1G9C A;  4I3N A;  4KEJ A;  2GZB A;  3AZW A;  1RY7 A;  3C0O A;  3CRI A;  4CJM A;  3ZJX A;  4ZLB B;  1YXW A;  41BI A;  1TWM A;  2R9K B;  2ESU A;  3A23 A;  4AN7 B;  2VLC A;  1XYF A;  1IHK A;  2FFU A;  1HWM B;  5G00 A;  4GOV A;  4QC4 A;  1SZ6 B;  3V0A B;  1Z2V A;  5B2H A;  1Z4S A;  3FGM A;  2RST A;  4Z8S B;  2K43 A;  3WMU A;  3OGF A;  3S8K A;  3EF2 A;  1XHB A;  4G9M A;  4OEE A;  3PME A;  1S0C A;  2Z49 A;  4AN6 A;  3O4A A;  1T4Q A;  1FV3 A;  2NYY A;  2D20 A;  4Q9P A;  3IAG C;  1J0S A;  3D7W B;  5BQU A;  3FFZ A;  1R8O A;  1QQK A;  2D24 A;  4DCK C;  1FMZ A;  1AVW B;  1TOO A;  1W3A A;  3JUT A;  3BRF A;  3BAV A;  1AVA C;  1JLX A;  4HR6 C;  3RMY A;  1ABR B;  3AKG A;  1IRA X;  3V0B A;  5DSS B;  1PRE A;  3VT2 A;  3V0B B;  3BA4 A;  1WBC A;  4WBC A;  1VCL A;  4LO8 B;  5D62 A;  3TC2 A;  3CQA A;  1AFC A;  4L4I A;  4QKR A;  4END A;  3NJ5 A;  1DQO A;  1ISV A;  3ZX7 A;  1DZC A;  1V6W A;  2FDB M;  21BI A;  2XOA A;  2ZR1 B;  4G1R A;  4LO1 A;  4LO1 C;  1R8N A;  1V6U A;  3FUQ A;  2DRY A;  2AXM A;  3OBR A;  1ITB A;  1S0G A;  1JQZ A;  4GAI A;  4DEN A;  3O5W B;  3HOM A;  5BXP A;  3C0M A;  3CRH A;  4LO2 C;  3NBD A;  3MAL A;  3O4D A;  3OJV A;  3H6Q A;  1DZD A;  2NTD A;  3AZV A;  4EEE B;  1WD4 A;  3AKH A;  4QD2 C;  3VUO A;  1BFB A;  2BEB A;  4I4Y A;  1EVT A;  1UYJ A;  3HMY A;  4QD2 B;  3KMV A;  3CRG A;  1G9A A;  1K5V A;  1JY0 A;  5JLV A;  1DIW A;  1RG8 A;  1JLY A;  3CU1 B;  3BAH A;  4EKX B;  3FJD A;  5F90 A;  3MPP G;  2DRE A;  3ILA A;  1UPS A;  2F2F A;  2KI6 B;  1IJT A;  4D0Z A;  3FJ9 A;  4A7Z A;  4LO0 C;  4I4O A;  1PWA A;  3BRG C;  4D0T A;  3PHZ A;  4YOL A;  3P6I A;  4QBC A;  2D22 A;  2Y9X E;  4USP A;  3FJB A;  3BAD A;  5JMC A;  1W3F A;  5FZU A;  3WA1 A;  3OJM A;  3POK A;  1JT3 A;  1FN0 A;  1M2T B;  1BFG A;  3IM5 A;  3OGG A;  4I2S A;  1V6V A;  1FMM S;  1TWE A;  4XFT A;  4H75 A;  1HWO B;  2I1B A;  2K8R A;  2VSE A;  4EFQ A;  1AXM A;  3NBE A;  1S0D A;  3NBN A;  4J2Y A;  5DVH A;  3AH4 A;  31BI A;  1S0F A;  3VEQ A;  2RQ9 A;  5EG6 C;  2Q9X A;  4ZBV B;  1RZO B;  3ZXG A;  3VSZ A;  3VT1 A;  3S8J A;  3AH2 A;  1S0B A;  1Z52 A;  4GAF A;  2P23 A;  2Y9G A;  4P0L A;  5F8Y A;  2NP0 A;  5BQU C;  2Q3N B;  1PUM B;  4I37 A;  4IYB A;  4OW4 A;  4IY9 A;  1DFQ A;  4J2X A;  3R4U A;  3QR5 A;  1IOB A;  1S0E A;  1N4K A;  4ZKT B;  4J2K A;  5BP5 A;  1II4 A;  3UD7 A;  3AJ6 A;  1CE7 B;  2Y9W C;  4X39 A;  2X2T A;  2M49 A;  1D0H A;  4TLP A;  3A07 A;  4ZA3 B;  2J3P A;  3RTI B;  4J2S A;  2X2S A;  3N0K A;  4XFS A;  2HZ9 A;  3BTA A;  2D1Z A;  2F8X C;  1PC8 B;  1HWN B;  2QYI B;  1M16 A;  2ZQN A;  1KNM A;  3C9Z A;  2HWM A;  3CA3 A;  1AVU A;  1BAR A;  3H6S E;  4I8M A;  3I29 B;  4MZG B;  3N7M A;  3AH1 A;  3I2X A;  3AKI A;  4X38 A;  4LO7 C;  3FJH A;  1TTU A;  3RTJ B;  3AJ5 A;  2NS2 A;  2WBC A;  1E0O A;  3A21 A;  5FZZ A;  3HSM A;  2DS0 A;  2IWT B;  1DQG A;  2MC2 A;  4UY4 A;  5DZU A;  4LO7 B;  4JQ0 A;  2D7R A;  2LIQ A;  2E4M A;  3CA5 A;  3CA1 A;  4GOY A;  3FJE A;  1FWU A;  2Z48 A;  1JT4 A;  1BFF A;  3C0N A;  3VWC A;  5D63 A;  1HWP B;  4I1E A;  1Q03 A;  4F34 A;  4OEG A;  1QQL A;  4X3A A;  4JKX B;  3WMV A;  3K1X A;  5BXS A;  2KKI A;  4I4U A;  5GAQ A;  4H9W A;  3VSF A;  3T8S A;  3H6R A;  2K4A B;  3LLP A;  4I7I A;  1MD6 A;  5HPZ A;  3VT0 A;  1XG6 A;  4LO3 A;  1P63 A;  5F8S A;  2WRY A;  3IM7 A;  1BFC A;  4I0Y A;  1YBI A;  5D61 A;  3FJI A;  3H6R B;  4IY8 A;  3FJA A;  2F2F C;  1ONK B;  4FGF A;  1FGA A;  3P53 A;  2VSA A;  3V79 C;  1Q1U A;  1AF9 A;  4I4P A;  4IZX A;  1G9B A;  1K5U A;  3I2A A;  1HCE A;  2FFV A;  4D8H A;  1DJS B;  1NUN A;  1BLD A;  1T9F A;  3RMX A;  1PZZ A;  3A22 A;  2L5X A;  5BOW A;  4QO3 A;  3RSJ A;  3IM6 A;  1ILR 1;  4FVV A;  3IIR A;  3FJC A;  2RG9 B;  3AKF A;  4OWJ A;  1JTC A;  4F83 A;  3ZXD A;  4I4Q A;  4QAL A;  3QYD A;  4HJJ A;  3O4O A;  1FV2 A;  3FUO A;  2Y9F A;  4IZE A;  4JPZ A;  4QBV A;  3BA7 A;  4OWK A;  2MLL B;  4H04 A;  1S0L A;  1RML A;  4G9N A;  4EFR A;  3BB2 A;  1OQL B;  2BEA A;  1HKN A;  1XZZ A;  4Q91 A;  3UJ4 A;  1EPW A;  4X37 A;  5BXR A;  4JRA A;  4A7Y A;  3O49 A;  1TFM B;  3UDA A;  3V0A A;  5FZY A;  3B9U A;  3N7K A;  6I1B A;  3F62 B;  4ISR A;  4KEK A;  3O3Q A;  1JT7 A;  4PC4 A;  3Q7X A;  1WBA A;  2HWA A;  4KBB A;  3FJF A;  4EFP A;  5BP5 C;  2ET2 A;  3WIN C;  3WIN A;  3WO2 A;  3BAU A;  4P0J A;  2VU9 A;  3O44 A;  1Z0H A;  1W3G A;  3FJK A;  1A8D A;  4MZF B;  4ZFU B;  3UD8 A;  3HN1 A;  2MIB A;  4R6U B;  4XFU A;  4I4S A;  1PUU B;  2NVH A;  1ISW A;  4DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...