1W3GA

Hemolytic lectin from the mushroom laetiporus sulphureus complexed with two n-acetyllactosamine molecules.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
312
structure length
312
Chain Sequence
DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFEDMSIDKIEYDLKDGRILSSTPNVLATQTLENTSSQTQEMSFNLSQTLTQTSTFAYTAGFTIAVGTAFKAGVPIFAETEFKVDISVDNQWNWGEENTFSKTYTATFSVRAGPGETVKAVSTVDSGIINVPFTAYLSSKSTGFEVTTEGIWRGVSSWDLRHTLTSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYTIC LECTIN FROM LAETIPORUS SULPHUREUS
publication title Structural Analysis of the Laetiporus Sulphureus Hemolytic Pore-Forming Lectin in Complex with Sugars
pubmed doi rcsb
molecule tags Toxin/lectin
total genus 59
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03318 ETX_MTX2 Clostridium epsilon toxin ETX/Bacillus mosquitocidal toxin MTX2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1w3gA01
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1w3gA02
3VSFA 4Z9WB 4GP0A 4Q9GA 3Q7WA 5BXRA 1DJSB 3A23A 3FFZA 2NP0A 3AZWA 1HKNA 4A7KA 3POKA 2D43A 3WA1A 4X37A 1IRPA 1YYNA 4JRAA 4OW4A 3C0NA 4II0A 3K1XA 1HWMB 3WMUA 4PC4A 2LIQA 1JT4A 3PUBA 4I8MA 5FZYA 3W9TA 2DS0A 4LO8B 3OBRA 3BADA 4X3AA 3FJFA 2DRZA 4XFUA 4QALA 1WD4A 3OGFA 5EG6C 3N7KA 4ENDA 1Q03A 2R9KB 3NBEA 2M49A 3BX1C 4QKSA 2BEAA 2RG9B 2KI6B 3A21A 3AH4A 3UDAA 4H9WA 3A07A 3G4OA 5FNXA 4QKRA 3T8SA 1IOBA 1XYFA 2VUAA 1YF8B 3PG0A 1TTUA 1DZDA 5G00A 1M2TB 3FJIA 3AKIA 3VWCA 1V6UA 1BASA 3ILAA 4ZFWB 2Y9FA 3OJMA 3LLPA 4WBCA 3IIRA 4I4RA 4EFQA 1ILR1 1V6WA 2AFGA 1JQZA 3I2XA 3HSMA 4I2SA 3VEQA 2Q9XA 5DZUA 3F62B 3E8LC 2VXRA 4R6UB 4I6IA 4KEIA 1FWUA 3H6RB 4EFRA 2KKIA 1PUUB 3AJ5A 1ISVA 4KBBA 3HALA 3RMYA 2IHOA 3NJ5A 3QYDA 3BRDA 3CA0A 2D20A 1W3GA 1EV2A 3UJ0A 4XFSA 1BFGA 3FJ8A 1AXMA 4J23B 3B9UA 2HWMA 1RZOB 5F8WA 3N0KA 5EC5A 3BAVA 4JPZA 2VSEA 3N7MA 3CQAA 4KC3A 4IQPA 3VSZA 2VSAA 1Z4SA 3MPPG 1YBIA 4J2KA 2Z48A 4ISRA 3S8KA 5FZUA 7I1BA 1R8OA 1SZ6B 3O44A 3AZVA 2I1BA 1R8NA 4I4UA 1BLAA 3BA7A 3CRGA 4JP0A 2WRYA 2FGFA 4CJMA 1DLLA 5DSSB 2D1ZA 2MC2A 3H6QA 3ZXGA 2K4AB 1S0EA 2VLCA 3FJ9A 3O4AA 4GOYA 4I4OA 6I1BA 5BQUA 3G4NA 3AH2A 4LO3A 4GOVA 4F83A 1HIBA 1K5UA 2F8XC 4QC4A 2HZ9A 3BTAA 1S0GA 3WO2A 4H04A 4I37A 1DQGA 2NVHA 3V0BB 1XZZA 3UD7A 3A22A 1DQOA 1QQLA 4ZGRB 3I2AA 2Y9XE 3FJKA 3OGGA 1FQ9A 1PC8B 2FDBM 2WBCA 2X2SA 1FMMS 5BQUC 4LO7C 4LO3C 4ZFYB 2ZR1B 3WINA 4I3NA 1CE7B 4J2SA 41BIA 1QQKA 3FJHA 1FWVA 4D0ZA 1S0BA 2UUSA 2Y9GA 1UPSA 4HA2A 5D62A 3VUOA 2ERMA 2ET2A 3C0MA 2ESUA 4FVVA 1GGPB 3AH1A 4QBCA 1DFCA 3BA4A 1S0CA 8I1BA 3CAHA 1ISXA 2AXMA 4EFPA 1FV3A 3AKFA 4Z8SB 3AKGA 1M16A 3S8JA 3WINC 3HBWA 2QN4A 3VT2A 4G9MA 31BIA 4I4PA 3WMVA 1PREA 4OEGA 3V0AA 4KEJA 4EEEB 1Z52A 3BAQA 2X2TA 3IM5A 3O4BA 3NBNA 1EYLA 5FNWA 4ZOTA 2L5XA 1MC9A 3QR5A 2HWAA 1FN0A 2RQ9A 3PMEA 3FJEA 4LO7B 1DIWA 1TFMB 4DENA 4P0LA 1TWEA 3PHZA 1W3FA 3IM6A 4I4QA 4G9NA 3N7LA 1RMLA 4LO0A 1AVUA 21BIA 3CA1A 2Z49A 5F8YA 1V6XA 1G9AA 1HWNB 2KH2A 3FGMA 3O5WB 2E4MA 3RTJB 4LO1A 1AFCA 2NTDA 3P6JA 1JT7A 2D7RA 1PUMB 3BAOA 1BFBA 1HWOB 1FMZA 4A7ZA 5BXSA 3HN1A 1NZKA 3V79C 2LIEA 3CA4A 1IJTA 4I7IA 4P6AA 4LO0C 3D7WB 3WO3A 2QYIB 1TIEA 3RMXA 1Z0HA 1JT5A 4I4VA 1VCLA 1EPWA 1N4KA 1WD3A 1JT3A 4ZKTB 3HMYA 4P0JA 2ZQOA 2E4MC 1G9DA 4LO1C 1T9FA 4FGFA 1RY7A 3NBCA 4LO2A 2VU9A 5BOWA 3O4CA 2NZ9A 3H6SE 3V0AB 3O49A 2DREA 3O3QA 3CA6A 3N7JA 4P0KA 5JMCA 2D24A 5D61A 9ILBA 2D44A 4OWKA 1YTOA 3JRRA 4OEFA 2AQZA 1YXWA 3IM7A 3ZX7A 3HOMA 1ISWA 4I0YA 1K5VA 4LO2C 1QXMA 3AJ6A 4QO3A 1XG6A 4IZEA 3BB2A 1PWAA 1A8DA 2MLLB 4DCKC 3ZXDA 5BP5A 1JY0A 3LTQA 4JKQA 4KEKA 3BAUA 3R4SA 2YUGA 4JAWA 4IZXA 5EHAA 3NBDA 3CRIA 4L4IA 1F31A 3FJAA 4ZA3B 1BFFA 3BAGA 1Q1UA 4I4YA 3Q7XA 4YOLA 4ZFUB 3UD8A 4X39A 4IONA 1EVTA 3ZC9A 1ABRB 4ZBVB 5GAQA 2FFUA 4I1BA 2RSTA 4IY9A 2NYYA 4J2YA 4EB2B 1ITBA 3CRHA 4JKXB 5E24E 5BP5C 2D42A 5D63A 4XFTA 1IT0A 2GO2A 2HW9A 1JLXA 4OWJA 3UJ4A 3MALA 1WBCA 4OUJA 1Z2VA 1ISYA 3CA3A 1HWPB 1JTCA 3H6RA 4Q9PA 1L2HA 3FUOA 1MD6A 5JLVA 4GP3A 2D22A 1IRAX 2NM1A 3FJCA 4AN7B 2P23A 1TP0A 3VT0A 1ONKB 3JUTA 4ZLBB 4L4HA 3RSJA 4I4XA 4G6JA 3O4DA 1G9BA 1NUNA 2DRYA 3TC2A 3SNVA 5HPZA 1P63A 1G82A 4Q91A 1AVWB 1W3AA 1S0DA 3P6IA 4XKIA 3ZC8A 3FJDA 2MIBA 3OBTA 1BARA 3OJVA 1DFQA 1HCEA 1Q04A 1SR4A 2ZQNA 1D0HA 5I1BA 1FV2A 4QD2C 1FGAA 4J2XA 1PZZA 1I1BA 3UD9A 2FO1A 2FFVA 5B2HA 3BA5A 2XOAA 2VXTI 4IY8A 2AAIB 1G9CA 1AVXB 4I96A 3C0OA 1AF9A 4OEEA 5F90A 1SR4C 3FJJA 3I29B 2KLLA 3V0BA 1V6VA 3KMVA 1S0LA 2BFHA 4GAFA 5DUYA 4HR6C 1S0FA 1TWMA 3F1RA 4USOA 1UYJA 5DVHA 1RG8A 2Q3NB 2KI4A 4HJJA 3RTIB 1HCDA 1IILA 3C9ZA 4G6MA 5BXPA 2F2FA 1OQLB 4D0TA 2D7IA 4IHZA 4OWLA 2D23A 3VT1A 2IWTB 3WO4A 4AN6A 3IAGC 4X38A 2J3PA 4QD2B 1KNMA 1IHKA 4EKXB 5F8SA 4A7YA 4GAIA 3BRFA 1BFCA 3R4UA 3CA5A 1II4A 3BAHA 1I1EA 1JLYA 1TOOA 4ISQA 2BEBA 2GZBA 1CVSA 4QBVA 3FUQA 2F2FC 2K43A 3O4OA 3CU1B 4G1RA 4I1EA 4JQ0A 1E0OA 5FZZA 2Y9WC 4DEPA 4IYBA 3FJBA 3OJ2A 4TLPA 4USPA 3BRGC 4F34A 3AKHA 3ZJXA 5BXTA 3EF2A 1DZCA 1BLDA 1T4QA 1WBAA 2P39A 1ISZA 1AVAC 1XHBA 3Q7YA 1BA7A 4I4SA 4D8HA 2K8RA 3P53A 5BVPI 1J0SA
chains in the Genus database with same CATH superfamily
3VSFA 4Z9WB 4GP0A 4Q9GA 3Q7WA 5BXRA 1DJSB 3A23A 3FFZA 2NP0A 3AZWA 1HKNA 4A7KA 3POKA 2D43A 3WA1A 4X37A 1IRPA 1YYNA 4JRAA 4OW4A 3C0NA 4II0A 3K1XA 1HWMB 3WMUA 4PC4A 2LIQA 1JT4A 3PUBA 4I8MA 5FZYA 3W9TA 2DS0A 4LO8B 3OBRA 3BADA 4X3AA 3FJFA 2DRZA 4XFUA 4QALA 1WD4A 3OGFA 5EG6C 3N7KA 4ENDA 1Q03A 2R9KB 3NBEA 2M49A 3BX1C 4QKSA 2BEAA 2RG9B 2KI6B 3A21A 3AH4A 3UDAA 4H9WA 3A07A 3G4OA 5FNXA 4QKRA 3T8SA 1IOBA 1XYFA 2VUAA 1YF8B 3PG0A 1TTUA 1DZDA 5G00A 1M2TB 3FJIA 3AKIA 3VWCA 1V6UA 1BASA 3ILAA 4ZFWB 2Y9FA 3OJMA 3LLPA 4WBCA 3IIRA 4I4RA 4EFQA 1ILR1 1V6WA 2AFGA 1JQZA 3I2XA 3HSMA 4I2SA 3VEQA 2Q9XA 5DZUA 3F62B 3E8LC 2VXRA 4R6UB 4I6IA 4KEIA 1FWUA 3H6RB 4EFRA 2KKIA 1PUUB 3AJ5A 1ISVA 4KBBA 3HALA 3RMYA 2IHOA 3NJ5A 3QYDA 3BRDA 3CA0A 2D20A 1W3GA 1EV2A 3UJ0A 4XFSA 1BFGA 3FJ8A 1AXMA 4J23B 3B9UA 2HWMA 1RZOB 5F8WA 3N0KA 5EC5A 3BAVA 4JPZA 2VSEA 3N7MA 3CQAA 4KC3A 4IQPA 3VSZA 2VSAA 1Z4SA 3MPPG 1YBIA 4J2KA 2Z48A 4ISRA 4MZGB 3S8KA 5FZUA 7I1BA 1R8OA 1SZ6B 3O44A 3AZVA 2I1BA 1R8NA 4I4UA 1BLAA 3BA7A 3CRGA 4JP0A 2WRYA 2FGFA 4CJMA 1DLLA 5DSSB 2D1ZA 2MC2A 3H6QA 3ZXGA 2K4AB 1S0EA 2VLCA 3FJ9A 3O4AA 4GOYA 4I4OA 6I1BA 5BQUA 3G4NA 3AH2A 4LO3A 4GOVA 4F83A 1HIBA 1K5UA 2F8XC 4QC4A 2HZ9A 3BTAA 1S0GA 3WO2A 4H04A 4I37A 1DQGA 2NVHA 3V0BB 1XZZA 3UD7A 3A22A 1DQOA 1QQLA 4ZGRB 3I2AA 2Y9XE 3FJKA 3OGGA 1FQ9A 1PC8B 2FDBM 2WBCA 2X2SA 1FMMS 5BQUC 4LO7C 4LO3C 4ZFYB 2ZR1B 3WINA 4I3NA 1CE7B 4J2SA 41BIA 1QQKA 3FJHA 1FWVA 4D0ZA 1S0BA 2UUSA 2Y9GA 1UPSA 4HA2A 5D62A 3VUOA 2ERMA 2ET2A 3C0MA 2ESUA 4FVVA 1GGPB 3AH1A 4QBCA 1DFCA 3BA4A 1S0CA 8I1BA 3CAHA 1ISXA 2AXMA 4EFPA 1FV3A 3AKFA 4Z8SB 3AKGA 1M16A 3S8JA 3WINC 3HBWA 2QN4A 3VT2A 4G9MA 31BIA 4I4PA 3WMVA 1PREA 4OEGA 3V0AA 4KEJA 4EEEB 1Z52A 3BAQA 2X2TA 3IM5A 3O4BA 3NBNA 1EYLA 5FNWA 4ZOTA 2L5XA 1MC9A 3QR5A 2HWAA 1FN0A 2RQ9A 3PMEA 3FJEA 4LO7B 1DIWA 1TFMB 4DENA 4P0LA 1TWEA 3PHZA 1W3FA 3IM6A 4I4QA 4G9NA 3N7LA 1RMLA 4LO0A 1AVUA 21BIA 3CA1A 2Z49A 5F8YA 1V6XA 1G9AA 1HWNB 2KH2A 3FGMA 3O5WB 2E4MA 3RTJB 4LO1A 1AFCA 2NTDA 3P6JA 1JT7A 2D7RA 1PUMB 3BAOA 1BFBA 1HWOB 1FMZA 4A7ZA 5BXSA 3HN1A 1NZKA 3V79C 2LIEA 3CA4A 1IJTA 4I7IA 4P6AA 4LO0C 3D7WB 3WO3A 2QYIB 1TIEA 3RMXA 1Z0HA 1JT5A 4I4VA 1VCLA 1EPWA 1N4KA 1WD3A 1JT3A 4ZKTB 4UY4A 3HMYA 4P0JA 2ZQOA 2E4MC 1G9DA 4LO1C 1T9FA 4FGFA 1RY7A 3NBCA 4LO2A 2VU9A 5BOWA 3O4CA 2NZ9A 3H6SE 3V0AB 3O49A 4MZFB 2DREA 4H75A 3O3QA 3CA6A 3N7JA 4P0KA 5JMCA 2D24A 5D61A 9ILBA 2D44A 4OWKA 1YTOA 3JRRA 4OEFA 2AQZA 1YXWA 3IM7A 3ZX7A 3HOMA 1ISWA 4I0YA 1K5VA 4LO2C 1QXMA 3AJ6A 4QO3A 1XG6A 4IZEA 3BB2A 1PWAA 1A8DA 2MLLB 4DCKC 3ZXDA 5BP5A 1JY0A 3LTQA 4JKQA 4KEKA 3BAUA 3R4SA 2YUGA 4JAWA 4IZXA 5EHAA 3NBDA 3CRIA 4L4IA 1F31A 3FJAA 4ZA3B 1BFFA 3BAGA 1Q1UA 4I4YA 3Q7XA 4YOLA 4ZFUB 3UD8A 4X39A 4IONA 1EVTA 3ZC9A 1ABRB 4ZBVB 5GAQA 2FFUA 4I1BA 2RSTA 4IY9A 2NYYA 4J2YA 4EB2B 1ITBA 3CRHA 4JKXB 5E24E 5BP5C 2D42A 5D63A 4XFTA 1IT0A 2GO2A 2HW9A 1JLXA 4OWJA 3UJ4A 3MALA 1WBCA 4OUJA 1Z2VA 1ISYA 3CA3A 1HWPB 1JTCA 3H6RA 4Q9PA 1L2HA 3FUOA 1MD6A 5JLVA 4GP3A 2D22A 1IRAX 2NM1A 3FJCA 4AN7B 2P23A 1TP0A 3VT0A 1ONKB 3JUTA 4ZLBB 4L4HA 3RSJA 4I4XA 4G6JA 3O4DA 1G9BA 1NUNA 2DRYA 3TC2A 3SNVA 5HPZA 1P63A 1G82A 4Q91A 1AVWB 1W3AA 1S0DA 3P6IA 4XKIA 3ZC8A 3FJDA 2MIBA 3OBTA 1BARA 3OJVA 4MZHA 1DFQA 1HCEA 1Q04A 1SR4A 2NS2A 2ZQNA 1D0HA 5I1BA 1FV2A 4QD2C 1FGAA 4J2XA 1PZZA 1I1BA 3UD9A 2FO1A 2FFVA 5B2HA 3BA5A 2XOAA 2VXTI 4IY8A 2AAIB 1G9CA 1AVXB 4I96A 3C0OA 1AF9A 4OEEA 5F90A 1SR4C 3FJJA 3I29B 2KLLA 3V0BA 1V6VA 3KMVA 1S0LA 2BFHA 4GAFA 5DUYA 4HR6C 1S0FA 1TWMA 3F1RA 4USOA 1UYJA 5DVHA 1RG8A 2Q3NB 2KI4A 4HJJA 3RTIB 1HCDA 1IILA 3C9ZA 4G6MA 5BXPA 2F2FA 1OQLB 4D0TA 2D7IA 4IHZA 4OWLA 2D23A 3VT1A 2IWTB 3WO4A 4AN6A 3IAGC 4X38A 2J3PA 4QD2B 1KNMA 1IHKA 4EKXB 5F8SA 4A7YA 4GAIA 3BRFA 1BFCA 3R4UA 3CA5A 1II4A 3BAHA 1I1EA 1JLYA 1TOOA 4ISQA 2BEBA 2GZBA 1CVSA 4QBVA 3FUQA 2F2FC 2K43A 3O4OA 3CU1B 4G1RA 4I1EA 4JQ0A 1E0OA 5FZZA 2Y9WC 4DEPA 4IYBA 3FJBA 3OJ2A 4TLPA 4USPA 3BRGC 4F34A 3AKHA 3ZJXA 5BXTA 3EF2A 1DZCA 1BLDA 1T4QA 1WBAA 2P39A 1ISZA 1AVAC 1XHBA 3Q7YA 1BA7A 4I4SA 4D8HA 2K8RA 3P53A 5BVPI 1J0SA
chains in the Genus database with same CATH topology
3VSFA 4Z9WB 4GP0A 4Q9GA 3Q7WA 5BXRA 1DJSB 3A23A 3FFZA 2NP0A 3AZWA 1HKNA 4A7KA 3POKA 2D43A 3WA1A 4X37A 1IRPA 1YYNA 4JRAA 4OW4A 3C0NA 4II0A 3K1XA 1HWMB 3WMUA 4PC4A 2LIQA 1JT4A 3PUBA 4I8MA 5FZYA 3W9TA 2DS0A 4LO8B 3OBRA 3BADA 4X3AA 3FJFA 2DRZA 4XFUA 4QALA 1WD4A 3OGFA 5EG6C 3N7KA 4ENDA 1Q03A 2R9KB 3NBEA 2M49A 3BX1C 4QKSA 2BEAA 2RG9B 2KI6B 3A21A 3AH4A 3UDAA 4H9WA 3A07A 3G4OA 5FNXA 4QKRA 3T8SA 1IOBA 1XYFA 2VUAA 1YF8B 3PG0A 1TTUA 1DZDA 5G00A 1M2TB 3FJIA 3AKIA 3VWCA 1V6UA 1BASA 3ILAA 4ZFWB 2Y9FA 3OJMA 3LLPA 4WBCA 3IIRA 4I4RA 4EFQA 1ILR1 1V6WA 2AFGA 1JQZA 3I2XA 3HSMA 4I2SA 3VEQA 2Q9XA 5DZUA 3F62B 3E8LC 2VXRA 4R6UB 4I6IA 4KEIA 1FWUA 3H6RB 4EFRA 2KKIA 1PUUB 3AJ5A 1ISVA 4KBBA 3HALA 3RMYA 2IHOA 3NJ5A 3QYDA 3BRDA 3CA0A 2D20A 1W3GA 1EV2A 3UJ0A 4XFSA 1BFGA 3FJ8A 1AXMA 4J23B 3B9UA 2HWMA 1RZOB 5F8WA 3N0KA 5EC5A 3BAVA 4JPZA 2VSEA 3N7MA 3CQAA 4KC3A 4IQPA 3VSZA 2VSAA 1Z4SA 3MPPG 1YBIA 4J2KA 2Z48A 4ISRA 4MZGB 3S8KA 5FZUA 7I1BA 1R8OA 1SZ6B 3O44A 3AZVA 2I1BA 1R8NA 4I4UA 1BLAA 3BA7A 3CRGA 4JP0A 2WRYA 2FGFA 4CJMA 1DLLA 5DSSB 2D1ZA 2MC2A 3H6QA 3ZXGA 2K4AB 1S0EA 2VLCA 3FJ9A 3O4AA 4GOYA 4I4OA 6I1BA 5BQUA 3G4NA 3AH2A 4LO3A 4GOVA 4F83A 1HIBA 1K5UA 2F8XC 4QC4A 2HZ9A 3BTAA 1S0GA 3WO2A 4H04A 4I37A 1DQGA 2NVHA 3V0BB 1XZZA 3UD7A 3A22A 1DQOA 1QQLA 4ZGRB 3I2AA 2Y9XE 3FJKA 3OGGA 1FQ9A 1PC8B 2FDBM 2WBCA 2X2SA 1FMMS 5BQUC 4LO7C 4LO3C 4ZFYB 2ZR1B 3WINA 4I3NA 1CE7B 4J2SA 41BIA 1QQKA 3FJHA 1FWVA 4D0ZA 1S0BA 2UUSA 2Y9GA 1UPSA 4HA2A 5D62A 3VUOA 2ERMA 2ET2A 3C0MA 2ESUA 4FVVA 1GGPB 3AH1A 4QBCA 1DFCA 3BA4A 1S0CA 8I1BA 3CAHA 1ISXA 2AXMA 4EFPA 1FV3A 3AKFA 4Z8SB 3AKGA 1M16A 3S8JA 3WINC 3HBWA 2QN4A 3VT2A 4G9MA 31BIA 4I4PA 3WMVA 1PREA 4OEGA 3V0AA 4KEJA 4EEEB 1Z52A 3BAQA 2X2TA 3IM5A 3O4BA 3NBNA 1EYLA 5FNWA 4ZOTA 2L5XA 1MC9A 3QR5A 2HWAA 1FN0A 2RQ9A 3PMEA 3FJEA 4LO7B 1DIWA 1TFMB 4DENA 4P0LA 1TWEA 3PHZA 1W3FA 3IM6A 4I4QA 4G9NA 3N7LA 1RMLA 4LO0A 1AVUA 21BIA 3CA1A 2Z49A 5F8YA 1V6XA 1G9AA 1HWNB 2KH2A 3FGMA 3O5WB 2E4MA 3RTJB 4LO1A 1AFCA 2NTDA 3P6JA 1JT7A 2D7RA 1PUMB 3BAOA 1BFBA 1HWOB 1FMZA 4A7ZA 5BXSA 3HN1A 1NZKA 3V79C 2LIEA 3CA4A 1IJTA 4I7IA 4P6AA 4LO0C 3D7WB 3WO3A 2QYIB 1TIEA 3RMXA 1Z0HA 1JT5A 4I4VA 1VCLA 1EPWA 1N4KA 1WD3A 1JT3A 4ZKTB 4UY4A 3HMYA 4P0JA 2ZQOA 2E4MC 1G9DA 4LO1C 1T9FA 4FGFA 1RY7A 3NBCA 4LO2A 2VU9A 5BOWA 3O4CA 2NZ9A 3H6SE 3V0AB 3O49A 4MZFB 2DREA 4H75A 3O3QA 3CA6A 3N7JA 4P0KA 5JMCA 2D24A 5D61A 9ILBA 2D44A 4OWKA 1YTOA 3JRRA 4OEFA 2AQZA 1YXWA 3IM7A 3ZX7A 3HOMA 1ISWA 4I0YA 1K5VA 4LO2C 1QXMA 3AJ6A 4QO3A 1XG6A 4IZEA 3BB2A 1PWAA 1A8DA 2MLLB 4DCKC 3ZXDA 5BP5A 1JY0A 3LTQA 4JKQA 4KEKA 3BAUA 3R4SA 2YUGA 4JAWA 4IZXA 5EHAA 3NBDA 3CRIA 4L4IA 1F31A 3FJAA 4ZA3B 1BFFA 3BAGA 1Q1UA 4I4YA 3Q7XA 4YOLA 4ZFUB 3UD8A 4X39A 4IONA 1EVTA 3ZC9A 1ABRB 4ZBVB 5GAQA 2FFUA 4I1BA 2RSTA 4IY9A 2NYYA 4J2YA 4EB2B 1ITBA 3CRHA 4JKXB 5E24E 5BP5C 2D42A 5D63A 4XFTA 1IT0A 2GO2A 2HW9A 1JLXA 4OWJA 3UJ4A 3MALA 1WBCA 4OUJA 1Z2VA 1ISYA 3CA3A 1HWPB 1JTCA 3H6RA 4Q9PA 1L2HA 3FUOA 1MD6A 5JLVA 4GP3A 2D22A 1IRAX 2NM1A 3FJCA 4AN7B 2P23A 1TP0A 3VT0A 1ONKB 3JUTA 4ZLBB 4L4HA 3RSJA 4I4XA 4G6JA 3O4DA 1G9BA 1NUNA 2DRYA 3TC2A 3SNVA 5HPZA 1P63A 1G82A 4Q91A 1AVWB 1W3AA 1S0DA 3P6IA 4XKIA 3ZC8A 3FJDA 2MIBA 3OBTA 1BARA 3OJVA 4MZHA 1DFQA 1HCEA 1Q04A 1SR4A 2NS2A 2ZQNA 1D0HA 5I1BA 1FV2A 4QD2C 1FGAA 4J2XA 1PZZA 1I1BA 3UD9A 2FO1A 2FFVA 5B2HA 3BA5A 2XOAA 2VXTI 4IY8A 2AAIB 1G9CA 1AVXB 4I96A 3C0OA 1AF9A 4OEEA 5F90A 1SR4C 3FJJA 3I29B 2KLLA 3V0BA 1V6VA 3KMVA 1S0LA 2BFHA 4GAFA 5DUYA 4HR6C 1S0FA 1TWMA 3F1RA 4USOA 1UYJA 5DVHA 1RG8A 2Q3NB 2KI4A 4HJJA 3RTIB 1HCDA 1IILA 3C9ZA 4G6MA 5BXPA 2F2FA 1OQLB 4D0TA 2D7IA 4IHZA 4OWLA 2D23A 3VT1A 2IWTB 3WO4A 4AN6A 3IAGC 4X38A 2J3PA 4QD2B 1KNMA 1IHKA 4EKXB 5F8SA 4A7YA 4GAIA 3BRFA 1BFCA 3R4UA 3CA5A 1II4A 3BAHA 1I1EA 1JLYA 1TOOA 4ISQA 2BEBA 2GZBA 1CVSA 4QBVA 3FUQA 2F2FC 2K43A 3O4OA 3CU1B 4G1RA 4I1EA 4JQ0A 1E0OA 5FZZA 2Y9WC 4DEPA 4IYBA 3FJBA 3OJ2A 4TLPA 4USPA 3BRGC 4F34A 3AKHA 3ZJXA 5BXTA 3EF2A 1DZCA 1BLDA 1T4QA 1WBAA 2P39A 1ISZA 1AVAC 1XHBA 3Q7YA 1BA7A 4I4SA 4D8HA 2K8RA 3P53A 5BVPI 1J0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VSF A;  4Z9W B;  4GP0 A;  4Q9G A;  3Q7W A;  5BXR A;  1DJS B;  3A23 A;  3FFZ A;  2NP0 A;  3AZW A;  1HKN A;  4A7K A;  3POK A;  2D43 A;  3WA1 A;  4X37 A;  1IRP A;  1YYN A;  4JRA A;  4OW4 A;  3C0N A;  4II0 A;  3K1X A;  1HWM B;  3WMU A;  4PC4 A;  2LIQ A;  1JT4 A;  3PUB A;  4I8M A;  5FZY A;  3W9T A;  2DS0 A;  4LO8 B;  3OBR A;  3BAD A;  4X3A A;  3FJF A;  2DRZ A;  4XFU A;  4QAL A;  1WD4 A;  3OGF A;  5EG6 C;  3N7K A;  4END A;  1Q03 A;  2R9K B;  3NBE A;  2M49 A;  3BX1 C;  4QKS A;  2BEA A;  2RG9 B;  2KI6 B;  3A21 A;  3AH4 A;  3UDA A;  4H9W A;  3A07 A;  3G4O A;  5FNX A;  4QKR A;  3T8S A;  1IOB A;  1XYF A;  2VUA A;  1YF8 B;  3PG0 A;  1TTU A;  1DZD A;  5G00 A;  1M2T B;  3FJI A;  3AKI A;  3VWC A;  1V6U A;  1BAS A;  3ILA A;  4ZFW B;  2Y9F A;  3OJM A;  3LLP A;  4WBC A;  3IIR A;  4I4R A;  4EFQ A;  1ILR 1;  1V6W A;  2AFG A;  1JQZ A;  3I2X A;  3HSM A;  4I2S A;  3VEQ A;  2Q9X A;  5DZU A;  3F62 B;  3E8L C;  2VXR A;  4R6U B;  4I6I A;  4KEI A;  1FWU A;  3H6R B;  4EFR A;  2KKI A;  1PUU B;  3AJ5 A;  1ISV A;  4KBB A;  3HAL A;  3RMY A;  2IHO A;  3NJ5 A;  3QYD A;  3BRD A;  3CA0 A;  2D20 A;  1W3G A;  1EV2 A;  3UJ0 A;  4XFS A;  1BFG A;  3FJ8 A;  1AXM A;  4J23 B;  3B9U A;  2HWM A;  1RZO B;  5F8W A;  3N0K A;  5EC5 A;  3BAV A;  4JPZ A;  2VSE A;  3N7M A;  3CQA A;  4KC3 A;  4IQP A;  3VSZ A;  2VSA A;  1Z4S A;  3MPP G;  1YBI A;  4J2K A;  2Z48 A;  4ISR A;  3S8K A;  5FZU A;  7I1B A;  1R8O A;  1SZ6 B;  3O44 A;  3AZV A;  2I1B A;  1R8N A;  4I4U A;  1BLA A;  3BA7 A;  3CRG A;  4JP0 A;  2WRY A;  2FGF A;  4CJM A;  1DLL A;  5DSS B;  2D1Z A;  2MC2 A;  3H6Q A;  3ZXG A;  2K4A B;  1S0E A;  2VLC A;  3FJ9 A;  3O4A A;  4GOY A;  4I4O A;  6I1B A;  5BQU A;  3G4N A;  3AH2 A;  4LO3 A;  4GOV A;  4F83 A;  1HIB A;  1K5U A;  2F8X C;  4QC4 A;  2HZ9 A;  3BTA A;  1S0G A;  3WO2 A;  4H04 A;  4I37 A;  1DQG A;  2NVH A;  3V0B B;  1XZZ A;  3UD7 A;  3A22 A;  1DQO A;  1QQL A;  4ZGR B;  3I2A A;  2Y9X E;  3FJK A;  3OGG A;  1FQ9 A;  1PC8 B;  2FDB M;  2WBC A;  2X2S A;  1FMM S;  5BQU C;  4LO7 C;  4LO3 C;  4ZFY B;  2ZR1 B;  3WIN A;  4I3N A;  1CE7 B;  4J2S A;  41BI A;  1QQK A;  3FJH A;  1FWV A;  4D0Z A;  1S0B A;  2UUS A;  2Y9G A;  1UPS A;  4HA2 A;  5D62 A;  3VUO A;  2ERM A;  2ET2 A;  3C0M A;  2ESU A;  4FVV A;  1GGP B;  3AH1 A;  4QBC A;  1DFC A;  3BA4 A;  1S0C A;  8I1B A;  3CAH A;  1ISX A;  2AXM A;  4EFP A;  1FV3 A;  3AKF A;  4Z8S B;  3AKG A;  1M16 A;  3S8J A;  3WIN C;  3HBW A;  2QN4 A;  3VT2 A;  4G9M A;  31BI A;  4I4P A;  3WMV A;  1PRE A;  4OEG A;  3V0A A;  4KEJ A;  4EEE B;  1Z52 A;  3BAQ A;  2X2T A;  3IM5 A;  3O4B A;  3NBN A;  1EYL A;  5FNW A;  4ZOT A;  2L5X A;  1MC9 A;  3QR5 A;  2HWA A;  1FN0 A;  2RQ9 A;  3PME A;  3FJE A;  4LO7 B;  1DIW A;  1TFM B;  4DEN A;  4P0L A;  1TWE A;  3PHZ A;  1W3F A;  3IM6 A;  4I4Q A;  4G9N A;  3N7L A;  1RML A;  4LO0 A;  1AVU A;  21BI A;  3CA1 A;  2Z49 A;  5F8Y A;  1V6X A;  1G9A A;  1HWN B;  2KH2 A;  3FGM A;  3O5W B;  2E4M A;  3RTJ B;  4LO1 A;  1AFC A;  2NTD A;  3P6J A;  1JT7 A;  2D7R A;  1PUM B;  3BAO A;  1BFB A;  1HWO B;  1FMZ A;  4A7Z A;  5BXS A;  3HN1 A;  1NZK A;  3V79 C;  2LIE A;  3CA4 A;  1IJT A;  4I7I A;  4P6A A;  4LO0 C;  3D7W B;  3WO3 A;  2QYI B;  1TIE A;  3RMX A;  1Z0H A;  1JT5 A;  4I4V A;  1VCL A;  1EPW A;  1N4K A;  1WD3 A;  1JT3 A;  4ZKT B;  3HMY A;  4P0J A;  2ZQO A;  2E4M C;  1G9D A;  4LO1 C;  1T9F A;  4FGF A;  1RY7 A;  3NBC A;  4LO2 A;  2VU9 A;  5BOW A;  3O4C A;  2NZ9 A;  3H6S E;  3V0A B;  3O49 A;  2DRE A;  3O3Q A;  3CA6 A;  3N7J A;  4P0K A;  5JMC A;  2D24 A;  5D61 A;  9ILB A;  2D44 A;  4OWK A;  1YTO A;  3JRR A;  4OEF A;  2AQZ A;  1YXW A;  3IM7 A;  3ZX7 A;  3HOM A;  1ISW A;  4I0Y A;  1K5V A;  4LO2 C;  1QXM A;  3AJ6 A;  4QO3 A;  1XG6 A;  4IZE A;  3BB2 A;  1PWA A;  1A8D A;  2MLL B;  4DCK C;  3ZXD A;  5BP5 A;  1JY0 A;  3LTQ A;  4JKQ A;  4KEK A;  3BAU A;  3R4S A;  2YUG A;  4JAW A;  4IZX A;  5EHA A;  3NBD A;  3CRI A;  4L4I A;  1F31 A;  3FJA A;  4ZA3 B;  1BFF A;  3BAG A;  1Q1U A;  4I4Y A;  3Q7X A;  4YOL A;  4ZFU B;  3UD8 A;  4X39 A;  4ION A;  1EVT A;  3ZC9 A;  1ABR B;  4ZBV B;  5GAQ A;  2FFU A;  4I1B A;  2RST A;  4IY9 A;  2NYY A;  4J2Y A;  4EB2 B;  1ITB A;  3CRH A;  4JKX B;  5E24 E;  5BP5 C;  2D42 A;  5D63 A;  4XFT A;  1IT0 A;  2GO2 A;  2HW9 A;  1JLX A;  4OWJ A;  3UJ4 A;  3MAL A;  1WBC A;  4OUJ A;  1Z2V A;  1ISY A;  3CA3 A;  1HWP B;  1JTC A;  3H6R A;  4Q9P A;  1L2H A;  3FUO A;  1MD6 A;  5JLV A;  4GP3 A;  2D22 A;  1IRA X;  2NM1 A;  3FJC A;  4AN7 B;  2P23 A;  1TP0 A;  3VT0 A;  1ONK B;  3JUT A;  4ZLB B;  4L4H A;  3RSJ A;  4I4X A;  4G6J A;  3O4D A;  1G9B A;  1NUN A;  2DRY A;  3TC2 A;  3SNV A;  5HPZ A;  1P63 A;  1G82 A;  4Q91 A;  1AVW B;  1W3A A;  1S0D A;  3P6I A;  4XKI A;  3ZC8 A;  3FJD A;  2MIB A;  3OBT A;  1BAR A;  3OJV A;  1DFQ A;  1HCE A;  1Q04 A;  1SR4 A;  2ZQN A;  1D0H A;  5I1B A;  1FV2 A;  4QD2 C;  1FGA A;  4J2X A;  1PZZ A;  1I1B A;  3UD9 A;  2FO1 A;  2FFV A;  5B2H A;  3BA5 A;  2XOA A;  2VXT I;  4IY8 A;  2AAI B;  1G9C A;  1AVX B;  4I96 A;  3C0O A;  1AF9 A;  4OEE A;  5F90 A;  1SR4 C;  3FJJ A;  3I29 B;  2KLL A;  3V0B A;  1V6V A;  3KMV A;  1S0L A;  2BFH A;  4GAF A;  5DUY A;  4HR6 C;  1S0F A;  1TWM A;  3F1R A;  4USO A;  1UYJ A;  5DVH A;  1RG8 A;  2Q3N B;  2KI4 A;  4HJJ A;  3RTI B;  1HCD A;  1IIL A;  3C9Z A;  4G6M A;  5BXP A;  2F2F A;  1OQL B;  4D0T A;  2D7I A;  4IHZ A;  4OWL A;  2D23 A;  3VT1 A;  2IWT B;  3WO4 A;  4AN6 A;  3IAG C;  4X38 A;  2J3P A;  4QD2 B;  1KNM A;  1IHK A;  4EKX B;  5F8S A;  4A7Y A;  4GAI A;  3BRF A;  1BFC A;  3R4U A;  3CA5 A;  1II4 A;  3BAH A;  1I1E A;  1JLY A;  1TOO A;  4ISQ A;  2BEB A;  2GZB A;  1CVS A;  4QBV A;  3FUQ A;  2F2F C;  2K43 A;  3O4O A;  3CU1 B;  4G1R A;  4I1E A;  4JQ0 A;  1E0O A;  5FZZ A;  2Y9W C;  4DEP A;  4IYB A;  3FJB A;  3OJ2 A;  4TLP A;  4USP A;  3BRG C;  4F34 A;  3AKH A;  3ZJX A;  5BXT A;  3EF2 A;  1DZC A;  1BLD A;  1T4Q A;  1WBA A;  2P39 A;  1ISZ A;  1AVA C;  1XHB A;  3Q7Y A;  1BA7 A;  4I4S A;  4D8H A;  2K8R A;  3P53 A;  5BVP I;  1J0S A; 
#chains in the Genus database with same CATH topology
 3VSF A;  4Z9W B;  4GP0 A;  4Q9G A;  3Q7W A;  5BXR A;  1DJS B;  3A23 A;  3FFZ A;  2NP0 A;  3AZW A;  1HKN A;  4A7K A;  3POK A;  2D43 A;  3WA1 A;  4X37 A;  1IRP A;  1YYN A;  4JRA A;  4OW4 A;  3C0N A;  4II0 A;  3K1X A;  1HWM B;  3WMU A;  4PC4 A;  2LIQ A;  1JT4 A;  3PUB A;  4I8M A;  5FZY A;  3W9T A;  2DS0 A;  4LO8 B;  3OBR A;  3BAD A;  4X3A A;  3FJF A;  2DRZ A;  4XFU A;  4QAL A;  1WD4 A;  3OGF A;  5EG6 C;  3N7K A;  4END A;  1Q03 A;  2R9K B;  3NBE A;  2M49 A;  3BX1 C;  4QKS A;  2BEA A;  2RG9 B;  2KI6 B;  3A21 A;  3AH4 A;  3UDA A;  4H9W A;  3A07 A;  3G4O A;  5FNX A;  4QKR A;  3T8S A;  1IOB A;  1XYF A;  2VUA A;  1YF8 B;  3PG0 A;  1TTU A;  1DZD A;  5G00 A;  1M2T B;  3FJI A;  3AKI A;  3VWC A;  1V6U A;  1BAS A;  3ILA A;  4ZFW B;  2Y9F A;  3OJM A;  3LLP A;  4WBC A;  3IIR A;  4I4R A;  4EFQ A;  1ILR 1;  1V6W A;  2AFG A;  1JQZ A;  3I2X A;  3HSM A;  4I2S A;  3VEQ A;  2Q9X A;  5DZU A;  3F62 B;  3E8L C;  2VXR A;  4R6U B;  4I6I A;  4KEI A;  1FWU A;  3H6R B;  4EFR A;  2KKI A;  1PUU B;  3AJ5 A;  1ISV A;  4KBB A;  3HAL A;  3RMY A;  2IHO A;  3NJ5 A;  3QYD A;  3BRD A;  3CA0 A;  2D20 A;  1W3G A;  1EV2 A;  3UJ0 A;  4XFS A;  1BFG A;  3FJ8 A;  1AXM A;  4J23 B;  3B9U A;  2HWM A;  1RZO B;  5F8W A;  3N0K A;  5EC5 A;  3BAV A;  4JPZ A;  2VSE A;  3N7M A;  3CQA A;  4KC3 A;  4IQP A;  3VSZ A;  2VSA A;  1Z4S A;  3MPP G;  1YBI A;  4J2K A;  2Z48 A;  4ISR A;  4MZG B;  3S8K A;  5FZU A;  7I1B A;  1R8O A;  1SZ6 B;  3O44 A;  3AZV A;  2I1B A;  1R8N A;  4I4U A;  1BLA A;  3BA7 A;  3CRG A;  4JP0 A;  2WRY A;  2FGF A;  4CJM A;  1DLL A;  5DSS B;  2D1Z A;  2MC2 A;  3H6Q A;  3ZXG A;  2K4A B;  1S0E A;  2VLC A;  3FJ9 A;  3O4A A;  4GOY A;  4I4O A;  6I1B A;  5BQU A;  3G4N A;  3AH2 A;  4LO3 A;  4GOV A;  4F83 A;  1HIB A;  1K5U A;  2F8X C;  4QC4 A;  2HZ9 A;  3BTA A;  1S0G A;  3WO2 A;  4H04 A;  4I37 A;  1DQG A;  2NVH A;  3V0B B;  1XZZ A;  3UD7 A;  3A22 A;  1DQO A;  1QQL A;  4ZGR B;  3I2A A;  2Y9X E;  3FJK A;  3OGG A;  1FQ9 A;  1PC8 B;  2FDB M;  2WBC A;  2X2S A;  1FMM S;  5BQU C;  4LO7 C;  4LO3 C;  4ZFY B;  2ZR1 B;  3WIN A;  4I3N A;  1CE7 B;  4J2S A;  41BI A;  1QQK A;  3FJH A;  1FWV A;  4D0Z A;  1S0B A;  2UUS A;  2Y9G A;  1UPS A;  4HA2 A;  5D62 A;  3VUO A;  2ERM A;  2ET2 A;  3C0M A;  2ESU A;  4FVV A;  1GGP B;  3AH1 A;  4QBC A;  1DFC A;  3BA4 A;  1S0C A;  8I1B A;  3CAH A;  1ISX A;  2AXM A;  4EFP A;  1FV3 A;  3AKF A;  4Z8S B;  3AKG A;  1M16 A;  3S8J A;  3WIN C;  3HBW A;  2QN4 A;  3VT2 A;  4G9M A;  31BI A;  4I4P A;  3WMV A;  1PRE A;  4OEG A;  3V0A A;  4KEJ A;  4EEE B;  1Z52 A;  3BAQ A;  2X2T A;  3IM5 A;  3O4B A;  3NBN A;  1EYL A;  5FNW A;  4ZOT A;  2L5X A;  1MC9 A;  3QR5 A;  2HWA A;  1FN0 A;  2RQ9 A;  3PME A;  3FJE A;  4LO7 B;  1DIW A;  1TFM B;  4DEN A;  4P0L A;  1TWE A;  3PHZ A;  1W3F A;  3IM6 A;  4I4Q A;  4G9N A;  3N7L A;  1RML A;  4LO0 A;  1AVU A;  21BI A;  3CA1 A;  2Z49 A;  5F8Y A;  1V6X A;  1G9A A;  1HWN B;  2KH2 A;  3FGM A;  3O5W B;  2E4M A;  3RTJ B;  4LO1 A;  1AFC A;  2NTD A;  3P6J A;  1JT7 A;  2D7R A;  1PUM B;  3BAO A;  1BFB A;  1HWO B;  1FMZ A;  4A7Z A;  5BXS A;  3HN1 A;  1NZK A;  3V79 C;  2LIE A;  3CA4 A;  1IJT A;  4I7I A;  4P6A A;  4LO0 C;  3D7W B;  3WO3 A;  2QYI B;  1TIE A;  3RMX A;  1Z0H A;  1JT5 A;  4I4V A;  1VCL A;  1EPW A;  1N4K A;  1WD3 A;  1JT3 A;  4ZKT B;  4UY4 A;  3HMY A;  4P0J A;  2ZQO A;  2E4M C;  1G9D A;  4LO1 C;  1T9F A;  4FGF A;  1RY7 A;  3NBC A;  4LO2 A;  2VU9 A;  5BOW A;  3O4C A;  2NZ9 A;  3H6S E;  3V0A B;  3O49 A;  4MZF B;  2DRE A;  4H75 A;  3O3Q A;  3CA6 A;  3N7J A;  4P0K A;  5JMC A;  2D24 A;  5D61 A;  9ILB A;  2D44 A;  4OWK A;  1YTO A;  3JRR A;  4OEF A;  2AQZ A;  1YXW A;  3IM7 A;  3ZX7 A;  3HOM A;  1ISW A;  4I0Y A;  1K5V A;  4LO2 C;  1QXM A;  3AJ6 A;  4QO3 A;  1XG6 A;  4IZE A;  3BB2 A;  1PWA A;  1A8D A;  2MLL B;  4DCK C;  3ZXD A;  5BP5 A;  1JY0 A;  3LTQ A;  4JKQ A;  4KEK A;  3BAU A;  3R4S A;  2YUG A;  4JAW A;  4IZX A;  5EHA A;  3NBD A;  3CRI A;  4L4I A;  1F31 A;  3FJA A;  4ZA3 B;  1BFF A;  3BAG A;  1Q1U A;  4I4Y A;  3Q7X A;  4YOL A;  4ZFU B;  3UD8 A;  4X39 A;  4ION A;  1EVT A;  3ZC9 A;  1ABR B;  4ZBV B;  5GAQ A;  2FFU A;  4I1B A;  2RST A;  4IY9 A;  2NYY A;  4J2Y A;  4EB2 B;  1ITB A;  3CRH A;  4JKX B;  5E24 E;  5BP5 C;  2D42 A;  5D63 A;  4XFT A;  1IT0 A;  2GO2 A;  2HW9 A;  1JLX A;  4OWJ A;  3UJ4 A;  3MAL A;  1WBC A;  4OUJ A;  1Z2V A;  1ISY A;  3CA3 A;  1HWP B;  1JTC A;  3H6R A;  4Q9P A;  1L2H A;  3FUO A;  1MD6 A;  5JLV A;  4GP3 A;  2D22 A;  1IRA X;  2NM1 A;  3FJC A;  4AN7 B;  2P23 A;  1TP0 A;  3VT0 A;  1ONK B;  3JUT A;  4ZLB B;  4L4H A;  3RSJ A;  4I4X A;  4G6J A;  3O4D A;  1G9B A;  1NUN A;  2DRY A;  3TC2 A;  3SNV A;  5HPZ A;  1P63 A;  1G82 A;  4Q91 A;  1AVW B;  1W3A A;  1S0D A;  3P6I A;  4XKI A;  3ZC8 A;  3FJD A;  2MIB A;  3OBT A;  1BAR A;  3OJV A;  4MZH A;  1DFQ A;  1HCE A;  1Q04 A;  1SR4 A;  2NS2 A;  2ZQN A;  1D0H A;  5I1B A;  1FV2 A;  4QD2 C;  1FGA A;  4J2X A;  1PZZ A;  1I1B A;  3UD9 A;  2FO1 A;  2FFV A;  5B2H A;  3BA5 A;  2XOA A;  2VXT I;  4IY8 A;  2AAI B;  1G9C A;  1AVX B;  4I96 A;  3C0O A;  1AF9 A;  4OEE A;  5F90 A;  1SR4 C;  3FJJ A;  3I29 B;  2KLL A;  3V0B A;  1V6V A;  3KMV A;  1S0L A;  2BFH A;  4GAF A;  5DUY A;  4HR6 C;  1S0F A;  1TWM A;  3F1R A;  4USO A;  1UYJ A;  5DVH A;  1RG8 A;  2Q3N B;  2KI4 A;  4HJJ A;  3RTI B;  1HCD A;  1IIL A;  3C9Z A;  4G6M A;  5BXP A;  2F2F A;  1OQL B;  4D0T A;  2D7I A;  4IHZ A;  4OWL A;  2D23 A;  3VT1 A;  2IWT B;  3WO4 A;  4AN6 A;  3IAG C;  4X38 A;  2J3P A;  4QD2 B;  1KNM A;  1IHK A;  4EKX B;  5F8S A;  4A7Y A;  4GAI A;  3BRF A;  1BFC A;  3R4U A;  3CA5 A;  1II4 A;  3BAH A;  1I1E A;  1JLY A;  1TOO A;  4ISQ A;  2BEB A;  2GZB A;  1CVS A;  4QBV A;  3FUQ A;  2F2F C;  2K43 A;  3O4O A;  3CU1 B;  4G1R A;  4I1E A;  4JQ0 A;  1E0O A;  5FZZ A;  2Y9W C;  4DEP A;  4IYB A;  3FJB A;  3OJ2 A;  4TLP A;  4USP A;  3BRG C;  4F34 A;  3AKH A;  3ZJX A;  5BXT A;  3EF2 A;  1DZC A;  1BLD A;  1T4Q A;  1WBA A;  2P39 A;  1ISZ A;  1AVA C;  1XHB A;  3Q7Y A;  1BA7 A;  4I4S A;  4D8H A;  2K8R A;  3P53 A;  5BVP I;  1J0S A; 
#chains in the Genus database with same CATH homology
 3VSF A;  4Z9W B;  4GP0 A;  4Q9G A;  3Q7W A;  5BXR A;  1DJS B;  3A23 A;  3FFZ A;  2NP0 A;  3AZW A;  1HKN A;  4A7K A;  3POK A;  2D43 A;  3WA1 A;  4X37 A;  1IRP A;  1YYN A;  4JRA A;  4OW4 A;  3C0N A;  4II0 A;  3K1X A;  1HWM B;  3WMU A;  4PC4 A;  2LIQ A;  1JT4 A;  3PUB A;  4I8M A;  5FZY A;  3W9T A;  2DS0 A;  4LO8 B;  3OBR A;  3BAD A;  4X3A A;  3FJF A;  2DRZ A;  4XFU A;  4QAL A;  1WD4 A;  3OGF A;  5EG6 C;  3N7K A;  4END A;  1Q03 A;  2R9K B;  3NBE A;  2M49 A;  3BX1 C;  4QKS A;  2BEA A;  2RG9 B;  2KI6 B;  3A21 A;  3AH4 A;  3UDA A;  4H9W A;  3A07 A;  3G4O A;  5FNX A;  4QKR A;  3T8S A;  1IOB A;  1XYF A;  2VUA A;  1YF8 B;  3PG0 A;  1TTU A;  1DZD A;  5G00 A;  1M2T B;  3FJI A;  3AKI A;  3VWC A;  1V6U A;  1BAS A;  3ILA A;  4ZFW B;  2Y9F A;  3OJM A;  3LLP A;  4WBC A;  3IIR A;  4I4R A;  4EFQ A;  1ILR 1;  1V6W A;  2AFG A;  1JQZ A;  3I2X A;  3HSM A;  4I2S A;  3VEQ A;  2Q9X A;  5DZU A;  3F62 B;  3E8L C;  2VXR A;  4R6U B;  4I6I A;  4KEI A;  1FWU A;  3H6R B;  4EFR A;  2KKI A;  1PUU B;  3AJ5 A;  1ISV A;  4KBB A;  3HAL A;  3RMY A;  2IHO A;  3NJ5 A;  3QYD A;  3BRD A;  3CA0 A;  2D20 A;  1W3G A;  1EV2 A;  3UJ0 A;  4XFS A;  1BFG A;  3FJ8 A;  1AXM A;  4J23 B;  3B9U A;  2HWM A;  1RZO B;  5F8W A;  3N0K A;  5EC5 A;  3BAV A;  4JPZ A;  2VSE A;  3N7M A;  3CQA A;  4KC3 A;  4IQP A;  3VSZ A;  2VSA A;  1Z4S A;  3MPP G;  1YBI A;  4J2K A;  2Z48 A;  4ISR A;  4MZG B;  3S8K A;  5FZU A;  7I1B A;  1R8O A;  1SZ6 B;  3O44 A;  3AZV A;  2I1B A;  1R8N A;  4I4U A;  1BLA A;  3BA7 A;  3CRG A;  4JP0 A;  2WRY A;  2FGF A;  4CJM A;  1DLL A;  5DSS B;  2D1Z A;  2MC2 A;  3H6Q A;  3ZXG A;  2K4A B;  1S0E A;  2VLC A;  3FJ9 A;  3O4A A;  4GOY A;  4I4O A;  6I1B A;  5BQU A;  3G4N A;  3AH2 A;  4LO3 A;  4GOV A;  4F83 A;  1HIB A;  1K5U A;  2F8X C;  4QC4 A;  2HZ9 A;  3BTA A;  1S0G A;  3WO2 A;  4H04 A;  4I37 A;  1DQG A;  2NVH A;  3V0B B;  1XZZ A;  3UD7 A;  3A22 A;  1DQO A;  1QQL A;  4ZGR B;  3I2A A;  2Y9X E;  3FJK A;  3OGG A;  1FQ9 A;  1PC8 B;  2FDB M;  2WBC A;  2X2S A;  1FMM S;  5BQU C;  4LO7 C;  4LO3 C;  4ZFY B;  2ZR1 B;  3WIN A;  4I3N A;  1CE7 B;  4J2S A;  41BI A;  1QQK A;  3FJH A;  1FWV A;  4D0Z A;  1S0B A;  2UUS A;  2Y9G A;  1UPS A;  4HA2 A;  5D62 A;  3VUO A;  2ERM A;  2ET2 A;  3C0M A;  2ESU A;  4FVV A;  1GGP B;  3AH1 A;  4QBC A;  1DFC A;  3BA4 A;  1S0C A;  8I1B A;  3CAH A;  1ISX A;  2AXM A;  4EFP A;  1FV3 A;  3AKF A;  4Z8S B;  3AKG A;  1M16 A;  3S8J A;  3WIN C;  3HBW A;  2QN4 A;  3VT2 A;  4G9M A;  31BI A;  4I4P A;  3WMV A;  1PRE A;  4OEG A;  3V0A A;  4KEJ A;  4EEE B;  1Z52 A;  3BAQ A;  2X2T A;  3IM5 A;  3O4B A;  3NBN A;  1EYL A;  5FNW A;  4ZOT A;  2L5X A;  1MC9 A;  3QR5 A;  2HWA A;  1FN0 A;  2RQ9 A;  3PME A;  3FJE A;  4LO7 B;  1DIW A;  1TFM B;  4DEN A;  4P0L A;  1TWE A;  3PHZ A;  1W3F A;  3IM6 A;  4I4Q A;  4G9N A;  3N7L A;  1RML A;  4LO0 A;  1AVU A;  21BI A;  3CA1 A;  2Z49 A;  5F8Y A;  1V6X A;  1G9A A;  1HWN B;  2KH2 A;  3FGM A;  3O5W B;  2E4M A;  3RTJ B;  4LO1 A;  1AFC A;  2NTD A;  3P6J A;  1JT7 A;  2D7R A;  1PUM B;  3BAO A;  1BFB A;  1HWO B;  1FMZ A;  4A7Z A;  5BXS A;  3HN1 A;  1NZK A;  3V79 C;  2LIE A;  3CA4 A;  1IJT A;  4I7I A;  4P6A A;  4LO0 C;  3D7W B;  3WO3 A;  2QYI B;  1TIE A;  3RMX A;  1Z0H A;  1JT5 A;  4I4V A;  1VCL A;  1EPW A;  1N4K A;  1WD3 A;  1JT3 A;  4ZKT B;  4UY4 A;  3HMY A;  4P0J A;  2ZQO A;  2E4M C;  1G9D A;  4LO1 C;  1T9F A;  4FGF A;  1RY7 A;  3NBC A;  4LO2 A;  2VU9 A;  5BOW A;  3O4C A;  2NZ9 A;  3H6S E;  3V0A B;  3O49 A;  4MZF B;  2DRE A;  4H75 A;  3O3Q A;  3CA6 A;  3N7J A;  4P0K A;  5JMC A;  2D24 A;  5D61 A;  9ILB A;  2D44 A;  4OWK A;  1YTO A;  3JRR A;  4OEF A;  2AQZ A;  1YXW A;  3IM7 A;  3ZX7 A;  3HOM A;  1ISW A;  4I0Y A;  1K5V A;  4LO2 C;  1QXM A;  3AJ6 A;  4QO3 A;  1XG6 A;  4IZE A;  3BB2 A;  1PWA A;  1A8D A;  2MLL B;  4DCK C;  3ZXD A;  5BP5 A;  1JY0 A;  3LTQ A;  4JKQ A;  4KEK A;  3BAU A;  3R4S A;  2YUG A;  4JAW A;  4IZX A;  5EHA A;  3NBD A;  3CRI A;  4L4I A;  1F31 A;  3FJA A;  4ZA3 B;  1BFF A;  3BAG A;  1Q1U A;  4I4Y A;  3Q7X A;  4YOL A;  4ZFU B;  3UD8 A;  4X39 A;  4ION A;  1EVT A;  3ZC9 A;  1ABR B;  4ZBV B;  5GAQ A;  2FFU A;  4I1B A;  2RST A;  4IY9 A;  2NYY A;  4J2Y A;  4EB2 B;  1ITB A;  3CRH A;  4JKX B;  5E24 E;  5BP5 C;  2D42 A;  5D63 A;  4XFT A;  1IT0 A;  2GO2 A;  2HW9 A;  1JLX A;  4OWJ A;  3UJ4 A;  3MAL A;  1WBC A;  4OUJ A;  1Z2V A;  1ISY A;  3CA3 A;  1HWP B;  1JTC A;  3H6R A;  4Q9P A;  1L2H A;  3FUO A;  1MD6 A;  5JLV A;  4GP3 A;  2D22 A;  1IRA X;  2NM1 A;  3FJC A;  4AN7 B;  2P23 A;  1TP0 A;  3VT0 A;  1ONK B;  3JUT A;  4ZLB B;  4L4H A;  3RSJ A;  4I4X A;  4G6J A;  3O4D A;  1G9B A;  1NUN A;  2DRY A;  3TC2 A;  3SNV A;  5HPZ A;  1P63 A;  1G82 A;  4Q91 A;  1AVW B;  1W3A A;  1S0D A;  3P6I A;  4XKI A;  3ZC8 A;  3FJD A;  2MIB A;  3OBT A;  1BAR A;  3OJV A;  4MZH A;  1DFQ A;  1HCE A;  1Q04 A;  1SR4 A;  2NS2 A;  2ZQN A;  1D0H A;  5I1B A;  1FV2 A;  4QD2 C;  1FGA A;  4J2X A;  1PZZ A;  1I1B A;  3UD9 A;  2FO1 A;  2FFV A;  5B2H A;  3BA5 A;  2XOA A;  2VXT I;  4IY8 A;  2AAI B;  1G9C A;  1AVX B;  4I96 A;  3C0O A;  1AF9 A;  4OEE A;  5F90 A;  1SR4 C;  3FJJ A;  3I29 B;  2KLL A;  3V0B A;  1V6V A;  3KMV A;  1S0L A;  2BFH A;  4GAF A;  5DUY A;  4HR6 C;  1S0F A;  1TWM A;  3F1R A;  4USO A;  1UYJ A;  5DVH A;  1RG8 A;  2Q3N B;  2KI4 A;  4HJJ A;  3RTI B;  1HCD A;  1IIL A;  3C9Z A;  4G6M A;  5BXP A;  2F2F A;  1OQL B;  4D0T A;  2D7I A;  4IHZ A;  4OWL A;  2D23 A;  3VT1 A;  2IWT B;  3WO4 A;  4AN6 A;  3IAG C;  4X38 A;  2J3P A;  4QD2 B;  1KNM A;  1IHK A;  4EKX B;  5F8S A;  4A7Y A;  4GAI A;  3BRF A;  1BFC A;  3R4U A;  3CA5 A;  1II4 A;  3BAH A;  1I1E A;  1JLY A;  1TOO A;  4ISQ A;  2BEB A;  2GZB A;  1CVS A;  4QBV A;  3FUQ A;  2F2F C;  2K43 A;  3O4O A;  3CU1 B;  4G1R A;  4I1E A;  4JQ0 A;  1E0O A;  5FZZ A;  2Y9W C;  4DEP A;  4IYB A;  3FJB A;  3OJ2 A;  4TLP A;  4USP A;  3BRG C;  4F34 A;  3AKH A;  3ZJX A;  5BXT A;  3EF2 A;  1DZC A;  1BLD A;  1T4Q A;  1WBA A;  2P39 A;  1ISZ A;  1AVA C;  1XHB A;  3Q7Y A;  1BA7 A;  4I4S A;  4D8H A;  2K8R A;  3P53 A;  5BVP I;  1J0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...