1W3GA

Hemolytic lectin from the mushroom laetiporus sulphureus complexed with two n-acetyllactosamine molecules.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
312
structure length
312
Chain Sequence
DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFEDMSIDKIEYDLKDGRILSSTPNVLATQTLENTSSQTQEMSFNLSQTLTQTSTFAYTAGFTIAVGTAFKAGVPIFAETEFKVDISVDNQWNWGEENTFSKTYTATFSVRAGPGETVKAVSTVDSGIINVPFTAYLSSKSTGFEVTTEGIWRGVSSWDLRHTLTSVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Laetiporus Sulphureus Hemolytic Pore-Forming Lectin in Complex with Sugars
pubmed doi rcsb
molecule keywords HEMOLYTIC LECTIN FROM LAETIPORUS SULPHUREUS
molecule tags Toxin/lectin
total genus 59
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03318 ETX_MTX2 Clostridium epsilon toxin ETX/Bacillus mosquitocidal toxin MTX2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1w3gA01
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1w3gA02
1D0HA 2D22A 1ISYA 1BFFA 1Z0HA 3A22A 3FJFA 3HMYA 5D62A 2ET2A 1S0LA 2K43A 5BXRA 4A7KA 3BAOA 3BA4A 3OBTA 1EV2A 2K8RA 1W3FA 5FZUA 1UPSA 1SR4A 4OEFA 4I7IA 1Z2VA 2Q9XA 4KEIA 4LO8B 2ESUA 3AKGA 3NBCA 5EC5A 1HKNA 3O3QA 4I4OA 3AH4A 1KNMA 2ZR1B 4IZEA 5FZYA 3FJBA 4LO0A 3HBWA 4D0ZA 3UDAA 4LO1C 3CRHA 5I1BA 3CRGA 2VSAA 1BASA 1AVXB 4LO3C 1IILA 5GAQA 3VT2A 3ILAA 2I1BA 3VT1A 4A7ZA 3BB2A 2D20A 1K5UA 3CA1A 7I1BA 3VUOA 3IAGC 1JLXA 1FWVA 1QQKA 4P0JA 1G9CA 2HWMA 4A7YA 1AFCA 5F90A 1ISWA 4ZBVB 3N7LA 1Q04A 4HR6C 1FN0A 1JT7A 2D24A 5BXTA 1BARA 4I4UA 1J0SA 1BLDA 2KLLA 5JMCA 3MPPG 2HWAA 4GP3A 3H6QA 3V0BB 1DLLA 4J2XA 4Z9WB 4I4PA 4IY8A 5FNWA 5BQUA 1S0BA 4II0A 2R9KB 2YUGA 4P0LA 3D7WB 1V6UA 1WBAA 4JQ0A 1FMMS 4EFQA 1G9BA 2D1ZA 3BAQA 3NBEA 3IM5A 4ISRA 4IY9A 1NUNA 3WO2A 4I8MA 3R4UA 4R6UB 1WD3A 4QBVA 4QBCA 1TOOA 3VSFA 3A23A 41BIA 1IRPA 3IIRA 1DFCA 1T9FA 3WMUA 1N4KA 1DFQA 4D8HA 3AKIA 1QQLA 31BIA 1AXMA 4I6IA 2X2SA 4ENDA 1V6VA 1HWOB 5DVHA 8I1BA 2MC2A 3W9TA 2P39A 4G9MA 3HN1A 2AAIB 4LO2C 3AH1A 3LLPA 1BFCA 5DSSB 3FJIA 3VWCA 1L2HA 3ZJXA 1II4A 3FFZA 1M16A 4HA2A 3K1XA 1CE7B 1S0FA 4YOLA 3WINA 2GZBA 1HWNB 3C0MA 2VXRA 1Z52A 1JLYA 1JQZA 3CA0A 4J2KA 1JTCA 2M49A 2KI6B 3BAVA 3OJ2A 3WO4A 1QXMA 2HZ9A 5G00A 3V0BA 4GP0A 1EVTA 2D42A 2KKIA 3N7MA 4ZGRB 3ZXDA 2NP0A 1DQGA 3H6SE 1TWMA 2D7RA 2XOAA 1RY7A 3RMXA 3BADA 1S0DA 2KI4A 4OW4A 3S8JA 3RMYA 3F1RA 4P6AA 3SNVA 2LIQA 4Q9PA 2J3PA 2Y9XE 1IT0A 1BFBA 2DREA 3AZWA 1HIBA 3BAUA 3JUTA 3P6IA 3KMVA 2P23A 4QO3A 1Z4SA 2DRYA 1TFMB 3I29B 4EEEB 1PUUB 3IM6A 4LO1A 4ZFUB 2RSTA 1DZDA 2NYYA 4I3NA 1AF9A 2VLCA 3AKHA 4OWLA 1FQ9A 1Q03A 3C0NA 4CJMA 4I96A 3FJHA 3AJ6A 2L5XA 1XZZA 2NVHA 4I4YA 4JAWA 3QYDA 3O4DA 4FVVA 5BXSA 3QR5A 4TLPA 4KEJA 4I0YA 3EF2A 1FWUA 4GAIA 2Z48A 1SR4C 3UD8A 5DZUA 1M2TB 2VU9A 1TP0A 2RG9B 3G4NA 3BTAA 3BA7A 4OEGA 3A21A 1IJTA 1V6WA 3OBRA 2FO1A 4AN6A 1JT3A 4QD2C 2Y9WC 3WO3A 4P0KA 3O4CA 2BEAA 1K5VA 4IONA 2FDBM 3I2AA 4LO0C 4GAFA 3CA3A 4OWJA 3FJAA 1G82A 1GGPB 3FJCA 2BFHA 3LTQA 2QN4A 3BRGC 4I37A 3Q7YA 1PWAA 1JY0A 4XFSA 3NBNA 3NBDA 3V0AA 4H9WA 1BA7A 1F31A 3B9UA 1R8NA 1G9AA 2VSEA 3FJJA 3UD9A 3S8KA 4KEKA 3RSJA 4LO7C 3FUOA 3FJKA 3UJ0A 4I1EA 3ZC8A 5D63A 3AH2A 3UD7A 3V79C 1MC9A 5HPZA 1YYNA 4F34A 3PUBA 1FV3A 1RG8A 4EKXB 4LO2A 1UYJA 1AVWB 3I2XA 4I4XA 4G1RA 2IWTB 3CA5A 2F8XC 3FJDA 3HSMA 3C0OA 5BQUC 1I1BA 3ZC9A 4EFRA 1FMZA 3ZX7A 3UJ4A 2FGFA 3BA5A 1IRAX 1PZZA 4DCKC 1P63A 2Q3NB 3RTJB 4G6MA 4QD2B 4X3AA 1E0OA 3A07A 4ISQA 3TC2A 1XG6A 3CA4A 2F2FA 3HOMA 2LIEA 3O4AA 3AJ5A 3POKA 1V6XA 2D23A 3WA1A 3Q7WA 1ABRB 2FFUA 1G9DA 4QC4A 2X2TA 2GO2A 3AZVA 5EG6C 1HCEA 3VSZA 1JT4A 4IYBA 4DEPA 1NZKA 2MIBA 4I4QA 1YF8B 3VT0A 2HW9A 3C9ZA 4L4HA 4I2SA 21BIA 1XHBA 2AFGA 3H6RB 5BP5C 4QALA 3CQAA 4EFPA 5JLVA 4IHZA 3CAHA 4J23B 3V0AB 4GOYA 2E4MC 4JKQA 2Y9FA 4I4SA 5E24E 1CVSA 4I1BA 2QYIB 4OUJA 3WINC 1Q1UA 1DJSB 3N7KA 1ISXA 2Y9GA 4KC3A 4LO3A 5F8YA 5BOWA 4Q9GA 1W3GA 2ZQOA 4G9NA 5BXPA 1FGAA 4ZFWB 4EB2B 3FJ8A 4USPA 3BX1C 4F83A 3E8LC 1A8DA 4Z8SB 4JKXB 4WBCA 2UUSA 1FV2A 5EHAA 3CU1B 1ILR1 1RMLA 1HWPB 1EYLA 4H04A 3OJMA 3O5WB 4X37A 1S0EA 3N0KA 1TIEA 4KBBA 3HALA 3PHZA 4JRAA 2NTDA 3NJ5A 2IHOA 4HJJA 5DUYA 3FJ9A 1OQLB 4OEEA 2K4AB 1YXWA 4DENA 4L4IA 2WRYA 4J2SA 1XYFA 4ZKTB 1DIWA 1WD4A 5F8SA 3AKFA 4USOA 4OWKA 2DS0A 4FGFA 1DZCA 4ZOTA 3OGFA 2D7IA 3T8SA 3RTIB 1W3AA 4X39A 1VCLA 2Z49A 3OJVA 4PC4A 1IOBA 1JT5A 4JP0A 3H6RA 4JPZA 1EPWA 1TTUA 3CA6A 1ISZA 1YTOA 5FZZA 2WBCA 5FNXA 1IHKA 3F62B 4I4RA 1PUMB 4G6JA 6I1BA 2ZQNA 3CRIA 3MALA 1BFGA 3ZXGA 1SZ6B 1RZOB 5D61A 1AVAC 3BRDA 3FUQA 1MD6A 2FFVA 4I4VA 4IQPA 4QKRA 2NZ9A 2VUAA 1ITBA 3N7JA 9ILBA 3P6JA 3BAHA 3O4BA 5F8WA 4XFTA 1PREA 1I1EA 5BVPI 3OGGA 1BLAA 3FJEA 4ZA3B 3BAGA 2BEBA 4D0TA 1HWMB 1TWEA 4IZXA 2KH2A 2D43A 3BRFA 1T4QA 3O49A 1DQOA 4QKSA 4GOVA 1ONKB 3WMVA 1WBCA 3PMEA 4Q91A 2D44A 1S0GA 4XKIA 2AQZA 2RQ9A 1YBIA 2AXMA 3O44A 4J2YA 5BP5A 2NM1A 3G4OA 2E4MA 2MLLB 1ISVA 3R4SA 1HCDA 1R8OA 3IM7A 2DRZA 4ZLBB 4LO7B 3P53A 3O4OA 2VXTI 4AN7B 4ZFYB 3Q7XA 3JRRA 1AVUA 3PG0A 5B2HA 1PC8B 3FGMA 4XFUA 2ERMA 4X38A 1S0CA 3VEQA 2F2FC
chains in the Genus database with same CATH superfamily
1D0HA 2D22A 1ISYA 1BFFA 1Z0HA 3A22A 3FJFA 3HMYA 5D62A 2ET2A 1S0LA 2K43A 5BXRA 4A7KA 3BAOA 3BA4A 3OBTA 1EV2A 2K8RA 1W3FA 5FZUA 1UPSA 1SR4A 4OEFA 4I7IA 1Z2VA 2Q9XA 4KEIA 4LO8B 2ESUA 3AKGA 3NBCA 5EC5A 1HKNA 3O3QA 4I4OA 3AH4A 4UY4A 1KNMA 2ZR1B 4IZEA 5FZYA 3FJBA 4LO0A 3HBWA 4D0ZA 3UDAA 4LO1C 3CRHA 5I1BA 3CRGA 2NS2A 2VSAA 1BASA 1AVXB 4LO3C 1IILA 5GAQA 3VT2A 3ILAA 2I1BA 3VT1A 4A7ZA 3BB2A 2D20A 1K5UA 3CA1A 7I1BA 3VUOA 3IAGC 1JLXA 1FWVA 1QQKA 4P0JA 1G9CA 2HWMA 4A7YA 1AFCA 5F90A 1ISWA 4ZBVB 3N7LA 1Q04A 4HR6C 1FN0A 1JT7A 2D24A 5BXTA 1BARA 4I4UA 1J0SA 1BLDA 2KLLA 5JMCA 3MPPG 2HWAA 4GP3A 3H6QA 3V0BB 1DLLA 4J2XA 4Z9WB 4I4PA 4IY8A 5FNWA 5BQUA 1S0BA 4II0A 2R9KB 2YUGA 4P0LA 3D7WB 1V6UA 1WBAA 4JQ0A 1FMMS 4EFQA 1G9BA 2D1ZA 3BAQA 3NBEA 3IM5A 4ISRA 4IY9A 1NUNA 3WO2A 4I8MA 3R4UA 4R6UB 1WD3A 4QBVA 4QBCA 1TOOA 3VSFA 3A23A 41BIA 1IRPA 3IIRA 1DFCA 1T9FA 3WMUA 1N4KA 1DFQA 4D8HA 3AKIA 1QQLA 31BIA 1AXMA 4I6IA 2X2SA 4ENDA 1V6VA 1HWOB 5DVHA 8I1BA 2MC2A 3W9TA 2P39A 4MZGB 4G9MA 3HN1A 2AAIB 4LO2C 3AH1A 3LLPA 1BFCA 5DSSB 3FJIA 3VWCA 1L2HA 3ZJXA 1II4A 3FFZA 1M16A 4HA2A 3K1XA 1CE7B 1S0FA 4YOLA 3WINA 2GZBA 1HWNB 3C0MA 2VXRA 1Z52A 1JLYA 1JQZA 3CA0A 4J2KA 1JTCA 2M49A 2KI6B 3BAVA 3OJ2A 3WO4A 1QXMA 2HZ9A 5G00A 3V0BA 4GP0A 1EVTA 2D42A 2KKIA 3N7MA 4ZGRB 3ZXDA 2NP0A 1DQGA 3H6SE 1TWMA 2D7RA 2XOAA 1RY7A 3RMXA 3BADA 1S0DA 2KI4A 4OW4A 3S8JA 3RMYA 3F1RA 4P6AA 3SNVA 2LIQA 4Q9PA 2J3PA 2Y9XE 1IT0A 1BFBA 2DREA 3AZWA 1HIBA 3BAUA 3JUTA 3P6IA 3KMVA 2P23A 4QO3A 1Z4SA 2DRYA 1TFMB 3I29B 4EEEB 1PUUB 3IM6A 4LO1A 4ZFUB 2RSTA 1DZDA 2NYYA 4I3NA 1AF9A 2VLCA 3AKHA 4OWLA 1FQ9A 1Q03A 3C0NA 4CJMA 4I96A 3FJHA 3AJ6A 2L5XA 1XZZA 2NVHA 4I4YA 4JAWA 3QYDA 3O4DA 4FVVA 5BXSA 3QR5A 4TLPA 4KEJA 4I0YA 3EF2A 1FWUA 4GAIA 2Z48A 1SR4C 3UD8A 5DZUA 1M2TB 2VU9A 1TP0A 2RG9B 3G4NA 3BTAA 3BA7A 4OEGA 3A21A 1IJTA 1V6WA 3OBRA 2FO1A 4AN6A 1JT3A 4QD2C 2Y9WC 3WO3A 4P0KA 3O4CA 2BEAA 1K5VA 4IONA 2FDBM 3I2AA 4LO0C 4GAFA 3CA3A 4OWJA 3FJAA 1G82A 1GGPB 3FJCA 2BFHA 3LTQA 2QN4A 3BRGC 4I37A 3Q7YA 1PWAA 1JY0A 4XFSA 3NBNA 3NBDA 3V0AA 4H9WA 1BA7A 1F31A 3B9UA 1R8NA 1G9AA 2VSEA 3FJJA 3UD9A 3S8KA 4KEKA 3RSJA 4LO7C 3FUOA 3FJKA 3UJ0A 4I1EA 3ZC8A 5D63A 3AH2A 3UD7A 3V79C 1MC9A 5HPZA 1YYNA 4F34A 3PUBA 1FV3A 1RG8A 4EKXB 4LO2A 1UYJA 1AVWB 3I2XA 4I4XA 4G1RA 2IWTB 3CA5A 2F8XC 3FJDA 3HSMA 3C0OA 5BQUC 1I1BA 3ZC9A 4EFRA 1FMZA 4MZFB 3ZX7A 3UJ4A 2FGFA 3BA5A 1IRAX 1PZZA 4DCKC 1P63A 2Q3NB 3RTJB 4G6MA 4QD2B 4X3AA 1E0OA 3A07A 4ISQA 3TC2A 1XG6A 3CA4A 2F2FA 3HOMA 2LIEA 3O4AA 3AJ5A 3POKA 1V6XA 2D23A 3WA1A 3Q7WA 1ABRB 2FFUA 1G9DA 4QC4A 2X2TA 2GO2A 3AZVA 5EG6C 1HCEA 3VSZA 1JT4A 4IYBA 4DEPA 1NZKA 2MIBA 4I4QA 1YF8B 3VT0A 2HW9A 3C9ZA 4L4HA 4I2SA 21BIA 1XHBA 2AFGA 3H6RB 5BP5C 4QALA 3CQAA 4EFPA 5JLVA 4IHZA 3CAHA 4J23B 3V0AB 4GOYA 2E4MC 4JKQA 2Y9FA 4I4SA 5E24E 1CVSA 4I1BA 2QYIB 4OUJA 3WINC 1Q1UA 1DJSB 3N7KA 1ISXA 2Y9GA 4KC3A 4LO3A 5F8YA 5BOWA 4Q9GA 1W3GA 2ZQOA 4G9NA 5BXPA 1FGAA 4ZFWB 4EB2B 3FJ8A 4USPA 3BX1C 4F83A 3E8LC 1A8DA 4Z8SB 4JKXB 4WBCA 2UUSA 1FV2A 5EHAA 3CU1B 1ILR1 1RMLA 1HWPB 1EYLA 4H04A 3OJMA 3O5WB 4X37A 1S0EA 3N0KA 1TIEA 4KBBA 3HALA 3PHZA 4JRAA 2NTDA 3NJ5A 2IHOA 4HJJA 5DUYA 3FJ9A 1OQLB 4MZHA 4OEEA 2K4AB 1YXWA 4DENA 4L4IA 2WRYA 4J2SA 1XYFA 4ZKTB 1DIWA 1WD4A 5F8SA 3AKFA 4USOA 4OWKA 2DS0A 4FGFA 1DZCA 4ZOTA 3OGFA 2D7IA 3T8SA 3RTIB 1W3AA 4X39A 1VCLA 2Z49A 3OJVA 4PC4A 1IOBA 1JT5A 4JP0A 3H6RA 4JPZA 1EPWA 1TTUA 3CA6A 1ISZA 4H75A 1YTOA 5FZZA 2WBCA 5FNXA 1IHKA 3F62B 4I4RA 1PUMB 4G6JA 6I1BA 2ZQNA 3CRIA 3MALA 1BFGA 3ZXGA 1SZ6B 1RZOB 5D61A 1AVAC 3BRDA 3FUQA 1MD6A 2FFVA 4I4VA 4IQPA 4QKRA 2NZ9A 2VUAA 1ITBA 3N7JA 9ILBA 3P6JA 3BAHA 3O4BA 5F8WA 4XFTA 1PREA 1I1EA 5BVPI 3OGGA 1BLAA 3FJEA 4ZA3B 3BAGA 2BEBA 4D0TA 1HWMB 1TWEA 4IZXA 2KH2A 2D43A 3BRFA 1T4QA 3O49A 1DQOA 4QKSA 4GOVA 1ONKB 3WMVA 1WBCA 3PMEA 4Q91A 2D44A 1S0GA 4XKIA 2AQZA 2RQ9A 1YBIA 2AXMA 3O44A 4J2YA 5BP5A 2NM1A 3G4OA 2E4MA 2MLLB 1ISVA 3R4SA 1HCDA 1R8OA 3IM7A 2DRZA 4ZLBB 4LO7B 3P53A 3O4OA 2VXTI 4AN7B 4ZFYB 3Q7XA 3JRRA 1AVUA 3PG0A 5B2HA 1PC8B 3FGMA 4XFUA 2ERMA 4X38A 1S0CA 3VEQA 2F2FC
chains in the Genus database with same CATH topology
1D0HA 2D22A 1ISYA 1BFFA 1Z0HA 3A22A 3FJFA 3HMYA 5D62A 2ET2A 1S0LA 2K43A 5BXRA 4A7KA 3BAOA 3BA4A 3OBTA 1EV2A 2K8RA 1W3FA 5FZUA 1UPSA 1SR4A 4OEFA 4I7IA 1Z2VA 2Q9XA 4KEIA 4LO8B 2ESUA 3AKGA 3NBCA 5EC5A 1HKNA 3O3QA 4I4OA 3AH4A 4UY4A 1KNMA 2ZR1B 4IZEA 5FZYA 3FJBA 4LO0A 3HBWA 4D0ZA 3UDAA 4LO1C 3CRHA 5I1BA 3CRGA 2NS2A 2VSAA 1BASA 1AVXB 4LO3C 1IILA 5GAQA 3VT2A 3ILAA 2I1BA 3VT1A 4A7ZA 3BB2A 2D20A 1K5UA 3CA1A 7I1BA 3VUOA 3IAGC 1JLXA 1FWVA 1QQKA 4P0JA 1G9CA 2HWMA 4A7YA 1AFCA 5F90A 1ISWA 4ZBVB 3N7LA 1Q04A 4HR6C 1FN0A 1JT7A 2D24A 5BXTA 1BARA 4I4UA 1J0SA 1BLDA 2KLLA 5JMCA 3MPPG 2HWAA 4GP3A 3H6QA 3V0BB 1DLLA 4J2XA 4Z9WB 4I4PA 4IY8A 5FNWA 5BQUA 1S0BA 4II0A 2R9KB 2YUGA 4P0LA 3D7WB 1V6UA 1WBAA 4JQ0A 1FMMS 4EFQA 1G9BA 2D1ZA 3BAQA 3NBEA 3IM5A 4ISRA 4IY9A 1NUNA 3WO2A 4I8MA 3R4UA 4R6UB 1WD3A 4QBVA 4QBCA 1TOOA 3VSFA 3A23A 41BIA 1IRPA 3IIRA 1DFCA 1T9FA 3WMUA 1N4KA 1DFQA 4D8HA 3AKIA 1QQLA 31BIA 1AXMA 4I6IA 2X2SA 4ENDA 1V6VA 1HWOB 5DVHA 8I1BA 2MC2A 3W9TA 2P39A 4MZGB 4G9MA 3HN1A 2AAIB 4LO2C 3AH1A 3LLPA 1BFCA 5DSSB 3FJIA 3VWCA 1L2HA 3ZJXA 1II4A 3FFZA 1M16A 4HA2A 3K1XA 1CE7B 1S0FA 4YOLA 3WINA 2GZBA 1HWNB 3C0MA 2VXRA 1Z52A 1JLYA 1JQZA 3CA0A 4J2KA 1JTCA 2M49A 2KI6B 3BAVA 3OJ2A 3WO4A 1QXMA 2HZ9A 5G00A 3V0BA 4GP0A 1EVTA 2D42A 2KKIA 3N7MA 4ZGRB 3ZXDA 2NP0A 1DQGA 3H6SE 1TWMA 2D7RA 2XOAA 1RY7A 3RMXA 3BADA 1S0DA 2KI4A 4OW4A 3S8JA 3RMYA 3F1RA 4P6AA 3SNVA 2LIQA 4Q9PA 2J3PA 2Y9XE 1IT0A 1BFBA 2DREA 3AZWA 1HIBA 3BAUA 3JUTA 3P6IA 3KMVA 2P23A 4QO3A 1Z4SA 2DRYA 1TFMB 3I29B 4EEEB 1PUUB 3IM6A 4LO1A 4ZFUB 2RSTA 1DZDA 2NYYA 4I3NA 1AF9A 2VLCA 3AKHA 4OWLA 1FQ9A 1Q03A 3C0NA 4CJMA 4I96A 3FJHA 3AJ6A 2L5XA 1XZZA 2NVHA 4I4YA 4JAWA 3QYDA 3O4DA 4FVVA 5BXSA 3QR5A 4TLPA 4KEJA 4I0YA 3EF2A 1FWUA 4GAIA 2Z48A 1SR4C 3UD8A 5DZUA 1M2TB 2VU9A 1TP0A 2RG9B 3G4NA 3BTAA 3BA7A 4OEGA 3A21A 1IJTA 1V6WA 3OBRA 2FO1A 4AN6A 1JT3A 4QD2C 2Y9WC 3WO3A 4P0KA 3O4CA 2BEAA 1K5VA 4IONA 2FDBM 3I2AA 4LO0C 4GAFA 3CA3A 4OWJA 3FJAA 1G82A 1GGPB 3FJCA 2BFHA 3LTQA 2QN4A 3BRGC 4I37A 3Q7YA 1PWAA 1JY0A 4XFSA 3NBNA 3NBDA 3V0AA 4H9WA 1BA7A 1F31A 3B9UA 1R8NA 1G9AA 2VSEA 3FJJA 3UD9A 3S8KA 4KEKA 3RSJA 4LO7C 3FUOA 3FJKA 3UJ0A 4I1EA 3ZC8A 5D63A 3AH2A 3UD7A 3V79C 1MC9A 5HPZA 1YYNA 4F34A 3PUBA 1FV3A 1RG8A 4EKXB 4LO2A 1UYJA 1AVWB 3I2XA 4I4XA 4G1RA 2IWTB 3CA5A 2F8XC 3FJDA 3HSMA 3C0OA 5BQUC 1I1BA 3ZC9A 4EFRA 1FMZA 4MZFB 3ZX7A 3UJ4A 2FGFA 3BA5A 1IRAX 1PZZA 4DCKC 1P63A 2Q3NB 3RTJB 4G6MA 4QD2B 4X3AA 1E0OA 3A07A 4ISQA 3TC2A 1XG6A 3CA4A 2F2FA 3HOMA 2LIEA 3O4AA 3AJ5A 3POKA 1V6XA 2D23A 3WA1A 3Q7WA 1ABRB 2FFUA 1G9DA 4QC4A 2X2TA 2GO2A 3AZVA 5EG6C 1HCEA 3VSZA 1JT4A 4IYBA 4DEPA 1NZKA 2MIBA 4I4QA 1YF8B 3VT0A 2HW9A 3C9ZA 4L4HA 4I2SA 21BIA 1XHBA 2AFGA 3H6RB 5BP5C 4QALA 3CQAA 4EFPA 5JLVA 4IHZA 3CAHA 4J23B 3V0AB 4GOYA 2E4MC 4JKQA 2Y9FA 4I4SA 5E24E 1CVSA 4I1BA 2QYIB 4OUJA 3WINC 1Q1UA 1DJSB 3N7KA 1ISXA 2Y9GA 4KC3A 4LO3A 5F8YA 5BOWA 4Q9GA 1W3GA 2ZQOA 4G9NA 5BXPA 1FGAA 4ZFWB 4EB2B 3FJ8A 4USPA 3BX1C 4F83A 3E8LC 1A8DA 4Z8SB 4JKXB 4WBCA 2UUSA 1FV2A 5EHAA 3CU1B 1ILR1 1RMLA 1HWPB 1EYLA 4H04A 3OJMA 3O5WB 4X37A 1S0EA 3N0KA 1TIEA 4KBBA 3HALA 3PHZA 4JRAA 2NTDA 3NJ5A 2IHOA 4HJJA 5DUYA 3FJ9A 1OQLB 4MZHA 4OEEA 2K4AB 1YXWA 4DENA 4L4IA 2WRYA 4J2SA 1XYFA 4ZKTB 1DIWA 1WD4A 5F8SA 3AKFA 4USOA 4OWKA 2DS0A 4FGFA 1DZCA 4ZOTA 3OGFA 2D7IA 3T8SA 3RTIB 1W3AA 4X39A 1VCLA 2Z49A 3OJVA 4PC4A 1IOBA 1JT5A 4JP0A 3H6RA 4JPZA 1EPWA 1TTUA 3CA6A 1ISZA 4H75A 1YTOA 5FZZA 2WBCA 5FNXA 1IHKA 3F62B 4I4RA 1PUMB 4G6JA 6I1BA 2ZQNA 3CRIA 3MALA 1BFGA 3ZXGA 1SZ6B 1RZOB 5D61A 1AVAC 3BRDA 3FUQA 1MD6A 2FFVA 4I4VA 4IQPA 4QKRA 2NZ9A 2VUAA 1ITBA 3N7JA 9ILBA 3P6JA 3BAHA 3O4BA 5F8WA 4XFTA 1PREA 1I1EA 5BVPI 3OGGA 1BLAA 3FJEA 4ZA3B 3BAGA 2BEBA 4D0TA 1HWMB 1TWEA 4IZXA 2KH2A 2D43A 3BRFA 1T4QA 3O49A 1DQOA 4QKSA 4GOVA 1ONKB 3WMVA 1WBCA 3PMEA 4Q91A 2D44A 1S0GA 4XKIA 2AQZA 2RQ9A 1YBIA 2AXMA 3O44A 4J2YA 5BP5A 2NM1A 3G4OA 2E4MA 2MLLB 1ISVA 3R4SA 1HCDA 1R8OA 3IM7A 2DRZA 4ZLBB 4LO7B 3P53A 3O4OA 2VXTI 4AN7B 4ZFYB 3Q7XA 3JRRA 1AVUA 3PG0A 5B2HA 1PC8B 3FGMA 4XFUA 2ERMA 4X38A 1S0CA 3VEQA 2F2FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D0H A;  2D22 A;  1ISY A;  1BFF A;  1Z0H A;  3A22 A;  3FJF A;  3HMY A;  5D62 A;  2ET2 A;  1S0L A;  2K43 A;  5BXR A;  4A7K A;  3BAO A;  3BA4 A;  3OBT A;  1EV2 A;  2K8R A;  1W3F A;  5FZU A;  1UPS A;  1SR4 A;  4OEF A;  4I7I A;  1Z2V A;  2Q9X A;  4KEI A;  4LO8 B;  2ESU A;  3AKG A;  3NBC A;  5EC5 A;  1HKN A;  3O3Q A;  4I4O A;  3AH4 A;  1KNM A;  2ZR1 B;  4IZE A;  5FZY A;  3FJB A;  4LO0 A;  3HBW A;  4D0Z A;  3UDA A;  4LO1 C;  3CRH A;  5I1B A;  3CRG A;  2VSA A;  1BAS A;  1AVX B;  4LO3 C;  1IIL A;  5GAQ A;  3VT2 A;  3ILA A;  2I1B A;  3VT1 A;  4A7Z A;  3BB2 A;  2D20 A;  1K5U A;  3CA1 A;  7I1B A;  3VUO A;  3IAG C;  1JLX A;  1FWV A;  1QQK A;  4P0J A;  1G9C A;  2HWM A;  4A7Y A;  1AFC A;  5F90 A;  1ISW A;  4ZBV B;  3N7L A;  1Q04 A;  4HR6 C;  1FN0 A;  1JT7 A;  2D24 A;  5BXT A;  1BAR A;  4I4U A;  1J0S A;  1BLD A;  2KLL A;  5JMC A;  3MPP G;  2HWA A;  4GP3 A;  3H6Q A;  3V0B B;  1DLL A;  4J2X A;  4Z9W B;  4I4P A;  4IY8 A;  5FNW A;  5BQU A;  1S0B A;  4II0 A;  2R9K B;  2YUG A;  4P0L A;  3D7W B;  1V6U A;  1WBA A;  4JQ0 A;  1FMM S;  4EFQ A;  1G9B A;  2D1Z A;  3BAQ A;  3NBE A;  3IM5 A;  4ISR A;  4IY9 A;  1NUN A;  3WO2 A;  4I8M A;  3R4U A;  4R6U B;  1WD3 A;  4QBV A;  4QBC A;  1TOO A;  3VSF A;  3A23 A;  41BI A;  1IRP A;  3IIR A;  1DFC A;  1T9F A;  3WMU A;  1N4K A;  1DFQ A;  4D8H A;  3AKI A;  1QQL A;  31BI A;  1AXM A;  4I6I A;  2X2S A;  4END A;  1V6V A;  1HWO B;  5DVH A;  8I1B A;  2MC2 A;  3W9T A;  2P39 A;  4G9M A;  3HN1 A;  2AAI B;  4LO2 C;  3AH1 A;  3LLP A;  1BFC A;  5DSS B;  3FJI A;  3VWC A;  1L2H A;  3ZJX A;  1II4 A;  3FFZ A;  1M16 A;  4HA2 A;  3K1X A;  1CE7 B;  1S0F A;  4YOL A;  3WIN A;  2GZB A;  1HWN B;  3C0M A;  2VXR A;  1Z52 A;  1JLY A;  1JQZ A;  3CA0 A;  4J2K A;  1JTC A;  2M49 A;  2KI6 B;  3BAV A;  3OJ2 A;  3WO4 A;  1QXM A;  2HZ9 A;  5G00 A;  3V0B A;  4GP0 A;  1EVT A;  2D42 A;  2KKI A;  3N7M A;  4ZGR B;  3ZXD A;  2NP0 A;  1DQG A;  3H6S E;  1TWM A;  2D7R A;  2XOA A;  1RY7 A;  3RMX A;  3BAD A;  1S0D A;  2KI4 A;  4OW4 A;  3S8J A;  3RMY A;  3F1R A;  4P6A A;  3SNV A;  2LIQ A;  4Q9P A;  2J3P A;  2Y9X E;  1IT0 A;  1BFB A;  2DRE A;  3AZW A;  1HIB A;  3BAU A;  3JUT A;  3P6I A;  3KMV A;  2P23 A;  4QO3 A;  1Z4S A;  2DRY A;  1TFM B;  3I29 B;  4EEE B;  1PUU B;  3IM6 A;  4LO1 A;  4ZFU B;  2RST A;  1DZD A;  2NYY A;  4I3N A;  1AF9 A;  2VLC A;  3AKH A;  4OWL A;  1FQ9 A;  1Q03 A;  3C0N A;  4CJM A;  4I96 A;  3FJH A;  3AJ6 A;  2L5X A;  1XZZ A;  2NVH A;  4I4Y A;  4JAW A;  3QYD A;  3O4D A;  4FVV A;  5BXS A;  3QR5 A;  4TLP A;  4KEJ A;  4I0Y A;  3EF2 A;  1FWU A;  4GAI A;  2Z48 A;  1SR4 C;  3UD8 A;  5DZU A;  1M2T B;  2VU9 A;  1TP0 A;  2RG9 B;  3G4N A;  3BTA A;  3BA7 A;  4OEG A;  3A21 A;  1IJT A;  1V6W A;  3OBR A;  2FO1 A;  4AN6 A;  1JT3 A;  4QD2 C;  2Y9W C;  3WO3 A;  4P0K A;  3O4C A;  2BEA A;  1K5V A;  4ION A;  2FDB M;  3I2A A;  4LO0 C;  4GAF A;  3CA3 A;  4OWJ A;  3FJA A;  1G82 A;  1GGP B;  3FJC A;  2BFH A;  3LTQ A;  2QN4 A;  3BRG C;  4I37 A;  3Q7Y A;  1PWA A;  1JY0 A;  4XFS A;  3NBN A;  3NBD A;  3V0A A;  4H9W A;  1BA7 A;  1F31 A;  3B9U A;  1R8N A;  1G9A A;  2VSE A;  3FJJ A;  3UD9 A;  3S8K A;  4KEK A;  3RSJ A;  4LO7 C;  3FUO A;  3FJK A;  3UJ0 A;  4I1E A;  3ZC8 A;  5D63 A;  3AH2 A;  3UD7 A;  3V79 C;  1MC9 A;  5HPZ A;  1YYN A;  4F34 A;  3PUB A;  1FV3 A;  1RG8 A;  4EKX B;  4LO2 A;  1UYJ A;  1AVW B;  3I2X A;  4I4X A;  4G1R A;  2IWT B;  3CA5 A;  2F8X C;  3FJD A;  3HSM A;  3C0O A;  5BQU C;  1I1B A;  3ZC9 A;  4EFR A;  1FMZ A;  3ZX7 A;  3UJ4 A;  2FGF A;  3BA5 A;  1IRA X;  1PZZ A;  4DCK C;  1P63 A;  2Q3N B;  3RTJ B;  4G6M A;  4QD2 B;  4X3A A;  1E0O A;  3A07 A;  4ISQ A;  3TC2 A;  1XG6 A;  3CA4 A;  2F2F A;  3HOM A;  2LIE A;  3O4A A;  3AJ5 A;  3POK A;  1V6X A;  2D23 A;  3WA1 A;  3Q7W A;  1ABR B;  2FFU A;  1G9D A;  4QC4 A;  2X2T A;  2GO2 A;  3AZV A;  5EG6 C;  1HCE A;  3VSZ A;  1JT4 A;  4IYB A;  4DEP A;  1NZK A;  2MIB A;  4I4Q A;  1YF8 B;  3VT0 A;  2HW9 A;  3C9Z A;  4L4H A;  4I2S A;  21BI A;  1XHB A;  2AFG A;  3H6R B;  5BP5 C;  4QAL A;  3CQA A;  4EFP A;  5JLV A;  4IHZ A;  3CAH A;  4J23 B;  3V0A B;  4GOY A;  2E4M C;  4JKQ A;  2Y9F A;  4I4S A;  5E24 E;  1CVS A;  4I1B A;  2QYI B;  4OUJ A;  3WIN C;  1Q1U A;  1DJS B;  3N7K A;  1ISX A;  2Y9G A;  4KC3 A;  4LO3 A;  5F8Y A;  5BOW A;  4Q9G A;  1W3G A;  2ZQO A;  4G9N A;  5BXP A;  1FGA A;  4ZFW B;  4EB2 B;  3FJ8 A;  4USP A;  3BX1 C;  4F83 A;  3E8L C;  1A8D A;  4Z8S B;  4JKX B;  4WBC A;  2UUS A;  1FV2 A;  5EHA A;  3CU1 B;  1ILR 1;  1RML A;  1HWP B;  1EYL A;  4H04 A;  3OJM A;  3O5W B;  4X37 A;  1S0E A;  3N0K A;  1TIE A;  4KBB A;  3HAL A;  3PHZ A;  4JRA A;  2NTD A;  3NJ5 A;  2IHO A;  4HJJ A;  5DUY A;  3FJ9 A;  1OQL B;  4OEE A;  2K4A B;  1YXW A;  4DEN A;  4L4I A;  2WRY A;  4J2S A;  1XYF A;  4ZKT B;  1DIW A;  1WD4 A;  5F8S A;  3AKF A;  4USO A;  4OWK A;  2DS0 A;  4FGF A;  1DZC A;  4ZOT A;  3OGF A;  2D7I A;  3T8S A;  3RTI B;  1W3A A;  4X39 A;  1VCL A;  2Z49 A;  3OJV A;  4PC4 A;  1IOB A;  1JT5 A;  4JP0 A;  3H6R A;  4JPZ A;  1EPW A;  1TTU A;  3CA6 A;  1ISZ A;  1YTO A;  5FZZ A;  2WBC A;  5FNX A;  1IHK A;  3F62 B;  4I4R A;  1PUM B;  4G6J A;  6I1B A;  2ZQN A;  3CRI A;  3MAL A;  1BFG A;  3ZXG A;  1SZ6 B;  1RZO B;  5D61 A;  1AVA C;  3BRD A;  3FUQ A;  1MD6 A;  2FFV A;  4I4V A;  4IQP A;  4QKR A;  2NZ9 A;  2VUA A;  1ITB A;  3N7J A;  9ILB A;  3P6J A;  3BAH A;  3O4B A;  5F8W A;  4XFT A;  1PRE A;  1I1E A;  5BVP I;  3OGG A;  1BLA A;  3FJE A;  4ZA3 B;  3BAG A;  2BEB A;  4D0T A;  1HWM B;  1TWE A;  4IZX A;  2KH2 A;  2D43 A;  3BRF A;  1T4Q A;  3O49 A;  1DQO A;  4QKS A;  4GOV A;  1ONK B;  3WMV A;  1WBC A;  3PME A;  4Q91 A;  2D44 A;  1S0G A;  4XKI A;  2AQZ A;  2RQ9 A;  1YBI A;  2AXM A;  3O44 A;  4J2Y A;  5BP5 A;  2NM1 A;  3G4O A;  2E4M A;  2MLL B;  1ISV A;  3R4S A;  1HCD A;  1R8O A;  3IM7 A;  2DRZ A;  4ZLB B;  4LO7 B;  3P53 A;  3O4O A;  2VXT I;  4AN7 B;  4ZFY B;  3Q7X A;  3JRR A;  1AVU A;  3PG0 A;  5B2H A;  1PC8 B;  3FGM A;  4XFU A;  2ERM A;  4X38 A;  1S0C A;  3VEQ A;  2F2F C; 
#chains in the Genus database with same CATH topology
 1D0H A;  2D22 A;  1ISY A;  1BFF A;  1Z0H A;  3A22 A;  3FJF A;  3HMY A;  5D62 A;  2ET2 A;  1S0L A;  2K43 A;  5BXR A;  4A7K A;  3BAO A;  3BA4 A;  3OBT A;  1EV2 A;  2K8R A;  1W3F A;  5FZU A;  1UPS A;  1SR4 A;  4OEF A;  4I7I A;  1Z2V A;  2Q9X A;  4KEI A;  4LO8 B;  2ESU A;  3AKG A;  3NBC A;  5EC5 A;  1HKN A;  3O3Q A;  4I4O A;  3AH4 A;  4UY4 A;  1KNM A;  2ZR1 B;  4IZE A;  5FZY A;  3FJB A;  4LO0 A;  3HBW A;  4D0Z A;  3UDA A;  4LO1 C;  3CRH A;  5I1B A;  3CRG A;  2NS2 A;  2VSA A;  1BAS A;  1AVX B;  4LO3 C;  1IIL A;  5GAQ A;  3VT2 A;  3ILA A;  2I1B A;  3VT1 A;  4A7Z A;  3BB2 A;  2D20 A;  1K5U A;  3CA1 A;  7I1B A;  3VUO A;  3IAG C;  1JLX A;  1FWV A;  1QQK A;  4P0J A;  1G9C A;  2HWM A;  4A7Y A;  1AFC A;  5F90 A;  1ISW A;  4ZBV B;  3N7L A;  1Q04 A;  4HR6 C;  1FN0 A;  1JT7 A;  2D24 A;  5BXT A;  1BAR A;  4I4U A;  1J0S A;  1BLD A;  2KLL A;  5JMC A;  3MPP G;  2HWA A;  4GP3 A;  3H6Q A;  3V0B B;  1DLL A;  4J2X A;  4Z9W B;  4I4P A;  4IY8 A;  5FNW A;  5BQU A;  1S0B A;  4II0 A;  2R9K B;  2YUG A;  4P0L A;  3D7W B;  1V6U A;  1WBA A;  4JQ0 A;  1FMM S;  4EFQ A;  1G9B A;  2D1Z A;  3BAQ A;  3NBE A;  3IM5 A;  4ISR A;  4IY9 A;  1NUN A;  3WO2 A;  4I8M A;  3R4U A;  4R6U B;  1WD3 A;  4QBV A;  4QBC A;  1TOO A;  3VSF A;  3A23 A;  41BI A;  1IRP A;  3IIR A;  1DFC A;  1T9F A;  3WMU A;  1N4K A;  1DFQ A;  4D8H A;  3AKI A;  1QQL A;  31BI A;  1AXM A;  4I6I A;  2X2S A;  4END A;  1V6V A;  1HWO B;  5DVH A;  8I1B A;  2MC2 A;  3W9T A;  2P39 A;  4MZG B;  4G9M A;  3HN1 A;  2AAI B;  4LO2 C;  3AH1 A;  3LLP A;  1BFC A;  5DSS B;  3FJI A;  3VWC A;  1L2H A;  3ZJX A;  1II4 A;  3FFZ A;  1M16 A;  4HA2 A;  3K1X A;  1CE7 B;  1S0F A;  4YOL A;  3WIN A;  2GZB A;  1HWN B;  3C0M A;  2VXR A;  1Z52 A;  1JLY A;  1JQZ A;  3CA0 A;  4J2K A;  1JTC A;  2M49 A;  2KI6 B;  3BAV A;  3OJ2 A;  3WO4 A;  1QXM A;  2HZ9 A;  5G00 A;  3V0B A;  4GP0 A;  1EVT A;  2D42 A;  2KKI A;  3N7M A;  4ZGR B;  3ZXD A;  2NP0 A;  1DQG A;  3H6S E;  1TWM A;  2D7R A;  2XOA A;  1RY7 A;  3RMX A;  3BAD A;  1S0D A;  2KI4 A;  4OW4 A;  3S8J A;  3RMY A;  3F1R A;  4P6A A;  3SNV A;  2LIQ A;  4Q9P A;  2J3P A;  2Y9X E;  1IT0 A;  1BFB A;  2DRE A;  3AZW A;  1HIB A;  3BAU A;  3JUT A;  3P6I A;  3KMV A;  2P23 A;  4QO3 A;  1Z4S A;  2DRY A;  1TFM B;  3I29 B;  4EEE B;  1PUU B;  3IM6 A;  4LO1 A;  4ZFU B;  2RST A;  1DZD A;  2NYY A;  4I3N A;  1AF9 A;  2VLC A;  3AKH A;  4OWL A;  1FQ9 A;  1Q03 A;  3C0N A;  4CJM A;  4I96 A;  3FJH A;  3AJ6 A;  2L5X A;  1XZZ A;  2NVH A;  4I4Y A;  4JAW A;  3QYD A;  3O4D A;  4FVV A;  5BXS A;  3QR5 A;  4TLP A;  4KEJ A;  4I0Y A;  3EF2 A;  1FWU A;  4GAI A;  2Z48 A;  1SR4 C;  3UD8 A;  5DZU A;  1M2T B;  2VU9 A;  1TP0 A;  2RG9 B;  3G4N A;  3BTA A;  3BA7 A;  4OEG A;  3A21 A;  1IJT A;  1V6W A;  3OBR A;  2FO1 A;  4AN6 A;  1JT3 A;  4QD2 C;  2Y9W C;  3WO3 A;  4P0K A;  3O4C A;  2BEA A;  1K5V A;  4ION A;  2FDB M;  3I2A A;  4LO0 C;  4GAF A;  3CA3 A;  4OWJ A;  3FJA A;  1G82 A;  1GGP B;  3FJC A;  2BFH A;  3LTQ A;  2QN4 A;  3BRG C;  4I37 A;  3Q7Y A;  1PWA A;  1JY0 A;  4XFS A;  3NBN A;  3NBD A;  3V0A A;  4H9W A;  1BA7 A;  1F31 A;  3B9U A;  1R8N A;  1G9A A;  2VSE A;  3FJJ A;  3UD9 A;  3S8K A;  4KEK A;  3RSJ A;  4LO7 C;  3FUO A;  3FJK A;  3UJ0 A;  4I1E A;  3ZC8 A;  5D63 A;  3AH2 A;  3UD7 A;  3V79 C;  1MC9 A;  5HPZ A;  1YYN A;  4F34 A;  3PUB A;  1FV3 A;  1RG8 A;  4EKX B;  4LO2 A;  1UYJ A;  1AVW B;  3I2X A;  4I4X A;  4G1R A;  2IWT B;  3CA5 A;  2F8X C;  3FJD A;  3HSM A;  3C0O A;  5BQU C;  1I1B A;  3ZC9 A;  4EFR A;  1FMZ A;  4MZF B;  3ZX7 A;  3UJ4 A;  2FGF A;  3BA5 A;  1IRA X;  1PZZ A;  4DCK C;  1P63 A;  2Q3N B;  3RTJ B;  4G6M A;  4QD2 B;  4X3A A;  1E0O A;  3A07 A;  4ISQ A;  3TC2 A;  1XG6 A;  3CA4 A;  2F2F A;  3HOM A;  2LIE A;  3O4A A;  3AJ5 A;  3POK A;  1V6X A;  2D23 A;  3WA1 A;  3Q7W A;  1ABR B;  2FFU A;  1G9D A;  4QC4 A;  2X2T A;  2GO2 A;  3AZV A;  5EG6 C;  1HCE A;  3VSZ A;  1JT4 A;  4IYB A;  4DEP A;  1NZK A;  2MIB A;  4I4Q A;  1YF8 B;  3VT0 A;  2HW9 A;  3C9Z A;  4L4H A;  4I2S A;  21BI A;  1XHB A;  2AFG A;  3H6R B;  5BP5 C;  4QAL A;  3CQA A;  4EFP A;  5JLV A;  4IHZ A;  3CAH A;  4J23 B;  3V0A B;  4GOY A;  2E4M C;  4JKQ A;  2Y9F A;  4I4S A;  5E24 E;  1CVS A;  4I1B A;  2QYI B;  4OUJ A;  3WIN C;  1Q1U A;  1DJS B;  3N7K A;  1ISX A;  2Y9G A;  4KC3 A;  4LO3 A;  5F8Y A;  5BOW A;  4Q9G A;  1W3G A;  2ZQO A;  4G9N A;  5BXP A;  1FGA A;  4ZFW B;  4EB2 B;  3FJ8 A;  4USP A;  3BX1 C;  4F83 A;  3E8L C;  1A8D A;  4Z8S B;  4JKX B;  4WBC A;  2UUS A;  1FV2 A;  5EHA A;  3CU1 B;  1ILR 1;  1RML A;  1HWP B;  1EYL A;  4H04 A;  3OJM A;  3O5W B;  4X37 A;  1S0E A;  3N0K A;  1TIE A;  4KBB A;  3HAL A;  3PHZ A;  4JRA A;  2NTD A;  3NJ5 A;  2IHO A;  4HJJ A;  5DUY A;  3FJ9 A;  1OQL B;  4MZH A;  4OEE A;  2K4A B;  1YXW A;  4DEN A;  4L4I A;  2WRY A;  4J2S A;  1XYF A;  4ZKT B;  1DIW A;  1WD4 A;  5F8S A;  3AKF A;  4USO A;  4OWK A;  2DS0 A;  4FGF A;  1DZC A;  4ZOT A;  3OGF A;  2D7I A;  3T8S A;  3RTI B;  1W3A A;  4X39 A;  1VCL A;  2Z49 A;  3OJV A;  4PC4 A;  1IOB A;  1JT5 A;  4JP0 A;  3H6R A;  4JPZ A;  1EPW A;  1TTU A;  3CA6 A;  1ISZ A;  4H75 A;  1YTO A;  5FZZ A;  2WBC A;  5FNX A;  1IHK A;  3F62 B;  4I4R A;  1PUM B;  4G6J A;  6I1B A;  2ZQN A;  3CRI A;  3MAL A;  1BFG A;  3ZXG A;  1SZ6 B;  1RZO B;  5D61 A;  1AVA C;  3BRD A;  3FUQ A;  1MD6 A;  2FFV A;  4I4V A;  4IQP A;  4QKR A;  2NZ9 A;  2VUA A;  1ITB A;  3N7J A;  9ILB A;  3P6J A;  3BAH A;  3O4B A;  5F8W A;  4XFT A;  1PRE A;  1I1E A;  5BVP I;  3OGG A;  1BLA A;  3FJE A;  4ZA3 B;  3BAG A;  2BEB A;  4D0T A;  1HWM B;  1TWE A;  4IZX A;  2KH2 A;  2D43 A;  3BRF A;  1T4Q A;  3O49 A;  1DQO A;  4QKS A;  4GOV A;  1ONK B;  3WMV A;  1WBC A;  3PME A;  4Q91 A;  2D44 A;  1S0G A;  4XKI A;  2AQZ A;  2RQ9 A;  1YBI A;  2AXM A;  3O44 A;  4J2Y A;  5BP5 A;  2NM1 A;  3G4O A;  2E4M A;  2MLL B;  1ISV A;  3R4S A;  1HCD A;  1R8O A;  3IM7 A;  2DRZ A;  4ZLB B;  4LO7 B;  3P53 A;  3O4O A;  2VXT I;  4AN7 B;  4ZFY B;  3Q7X A;  3JRR A;  1AVU A;  3PG0 A;  5B2H A;  1PC8 B;  3FGM A;  4XFU A;  2ERM A;  4X38 A;  1S0C A;  3VEQ A;  2F2F C; 
#chains in the Genus database with same CATH homology
 1D0H A;  2D22 A;  1ISY A;  1BFF A;  1Z0H A;  3A22 A;  3FJF A;  3HMY A;  5D62 A;  2ET2 A;  1S0L A;  2K43 A;  5BXR A;  4A7K A;  3BAO A;  3BA4 A;  3OBT A;  1EV2 A;  2K8R A;  1W3F A;  5FZU A;  1UPS A;  1SR4 A;  4OEF A;  4I7I A;  1Z2V A;  2Q9X A;  4KEI A;  4LO8 B;  2ESU A;  3AKG A;  3NBC A;  5EC5 A;  1HKN A;  3O3Q A;  4I4O A;  3AH4 A;  4UY4 A;  1KNM A;  2ZR1 B;  4IZE A;  5FZY A;  3FJB A;  4LO0 A;  3HBW A;  4D0Z A;  3UDA A;  4LO1 C;  3CRH A;  5I1B A;  3CRG A;  2NS2 A;  2VSA A;  1BAS A;  1AVX B;  4LO3 C;  1IIL A;  5GAQ A;  3VT2 A;  3ILA A;  2I1B A;  3VT1 A;  4A7Z A;  3BB2 A;  2D20 A;  1K5U A;  3CA1 A;  7I1B A;  3VUO A;  3IAG C;  1JLX A;  1FWV A;  1QQK A;  4P0J A;  1G9C A;  2HWM A;  4A7Y A;  1AFC A;  5F90 A;  1ISW A;  4ZBV B;  3N7L A;  1Q04 A;  4HR6 C;  1FN0 A;  1JT7 A;  2D24 A;  5BXT A;  1BAR A;  4I4U A;  1J0S A;  1BLD A;  2KLL A;  5JMC A;  3MPP G;  2HWA A;  4GP3 A;  3H6Q A;  3V0B B;  1DLL A;  4J2X A;  4Z9W B;  4I4P A;  4IY8 A;  5FNW A;  5BQU A;  1S0B A;  4II0 A;  2R9K B;  2YUG A;  4P0L A;  3D7W B;  1V6U A;  1WBA A;  4JQ0 A;  1FMM S;  4EFQ A;  1G9B A;  2D1Z A;  3BAQ A;  3NBE A;  3IM5 A;  4ISR A;  4IY9 A;  1NUN A;  3WO2 A;  4I8M A;  3R4U A;  4R6U B;  1WD3 A;  4QBV A;  4QBC A;  1TOO A;  3VSF A;  3A23 A;  41BI A;  1IRP A;  3IIR A;  1DFC A;  1T9F A;  3WMU A;  1N4K A;  1DFQ A;  4D8H A;  3AKI A;  1QQL A;  31BI A;  1AXM A;  4I6I A;  2X2S A;  4END A;  1V6V A;  1HWO B;  5DVH A;  8I1B A;  2MC2 A;  3W9T A;  2P39 A;  4MZG B;  4G9M A;  3HN1 A;  2AAI B;  4LO2 C;  3AH1 A;  3LLP A;  1BFC A;  5DSS B;  3FJI A;  3VWC A;  1L2H A;  3ZJX A;  1II4 A;  3FFZ A;  1M16 A;  4HA2 A;  3K1X A;  1CE7 B;  1S0F A;  4YOL A;  3WIN A;  2GZB A;  1HWN B;  3C0M A;  2VXR A;  1Z52 A;  1JLY A;  1JQZ A;  3CA0 A;  4J2K A;  1JTC A;  2M49 A;  2KI6 B;  3BAV A;  3OJ2 A;  3WO4 A;  1QXM A;  2HZ9 A;  5G00 A;  3V0B A;  4GP0 A;  1EVT A;  2D42 A;  2KKI A;  3N7M A;  4ZGR B;  3ZXD A;  2NP0 A;  1DQG A;  3H6S E;  1TWM A;  2D7R A;  2XOA A;  1RY7 A;  3RMX A;  3BAD A;  1S0D A;  2KI4 A;  4OW4 A;  3S8J A;  3RMY A;  3F1R A;  4P6A A;  3SNV A;  2LIQ A;  4Q9P A;  2J3P A;  2Y9X E;  1IT0 A;  1BFB A;  2DRE A;  3AZW A;  1HIB A;  3BAU A;  3JUT A;  3P6I A;  3KMV A;  2P23 A;  4QO3 A;  1Z4S A;  2DRY A;  1TFM B;  3I29 B;  4EEE B;  1PUU B;  3IM6 A;  4LO1 A;  4ZFU B;  2RST A;  1DZD A;  2NYY A;  4I3N A;  1AF9 A;  2VLC A;  3AKH A;  4OWL A;  1FQ9 A;  1Q03 A;  3C0N A;  4CJM A;  4I96 A;  3FJH A;  3AJ6 A;  2L5X A;  1XZZ A;  2NVH A;  4I4Y A;  4JAW A;  3QYD A;  3O4D A;  4FVV A;  5BXS A;  3QR5 A;  4TLP A;  4KEJ A;  4I0Y A;  3EF2 A;  1FWU A;  4GAI A;  2Z48 A;  1SR4 C;  3UD8 A;  5DZU A;  1M2T B;  2VU9 A;  1TP0 A;  2RG9 B;  3G4N A;  3BTA A;  3BA7 A;  4OEG A;  3A21 A;  1IJT A;  1V6W A;  3OBR A;  2FO1 A;  4AN6 A;  1JT3 A;  4QD2 C;  2Y9W C;  3WO3 A;  4P0K A;  3O4C A;  2BEA A;  1K5V A;  4ION A;  2FDB M;  3I2A A;  4LO0 C;  4GAF A;  3CA3 A;  4OWJ A;  3FJA A;  1G82 A;  1GGP B;  3FJC A;  2BFH A;  3LTQ A;  2QN4 A;  3BRG C;  4I37 A;  3Q7Y A;  1PWA A;  1JY0 A;  4XFS A;  3NBN A;  3NBD A;  3V0A A;  4H9W A;  1BA7 A;  1F31 A;  3B9U A;  1R8N A;  1G9A A;  2VSE A;  3FJJ A;  3UD9 A;  3S8K A;  4KEK A;  3RSJ A;  4LO7 C;  3FUO A;  3FJK A;  3UJ0 A;  4I1E A;  3ZC8 A;  5D63 A;  3AH2 A;  3UD7 A;  3V79 C;  1MC9 A;  5HPZ A;  1YYN A;  4F34 A;  3PUB A;  1FV3 A;  1RG8 A;  4EKX B;  4LO2 A;  1UYJ A;  1AVW B;  3I2X A;  4I4X A;  4G1R A;  2IWT B;  3CA5 A;  2F8X C;  3FJD A;  3HSM A;  3C0O A;  5BQU C;  1I1B A;  3ZC9 A;  4EFR A;  1FMZ A;  4MZF B;  3ZX7 A;  3UJ4 A;  2FGF A;  3BA5 A;  1IRA X;  1PZZ A;  4DCK C;  1P63 A;  2Q3N B;  3RTJ B;  4G6M A;  4QD2 B;  4X3A A;  1E0O A;  3A07 A;  4ISQ A;  3TC2 A;  1XG6 A;  3CA4 A;  2F2F A;  3HOM A;  2LIE A;  3O4A A;  3AJ5 A;  3POK A;  1V6X A;  2D23 A;  3WA1 A;  3Q7W A;  1ABR B;  2FFU A;  1G9D A;  4QC4 A;  2X2T A;  2GO2 A;  3AZV A;  5EG6 C;  1HCE A;  3VSZ A;  1JT4 A;  4IYB A;  4DEP A;  1NZK A;  2MIB A;  4I4Q A;  1YF8 B;  3VT0 A;  2HW9 A;  3C9Z A;  4L4H A;  4I2S A;  21BI A;  1XHB A;  2AFG A;  3H6R B;  5BP5 C;  4QAL A;  3CQA A;  4EFP A;  5JLV A;  4IHZ A;  3CAH A;  4J23 B;  3V0A B;  4GOY A;  2E4M C;  4JKQ A;  2Y9F A;  4I4S A;  5E24 E;  1CVS A;  4I1B A;  2QYI B;  4OUJ A;  3WIN C;  1Q1U A;  1DJS B;  3N7K A;  1ISX A;  2Y9G A;  4KC3 A;  4LO3 A;  5F8Y A;  5BOW A;  4Q9G A;  1W3G A;  2ZQO A;  4G9N A;  5BXP A;  1FGA A;  4ZFW B;  4EB2 B;  3FJ8 A;  4USP A;  3BX1 C;  4F83 A;  3E8L C;  1A8D A;  4Z8S B;  4JKX B;  4WBC A;  2UUS A;  1FV2 A;  5EHA A;  3CU1 B;  1ILR 1;  1RML A;  1HWP B;  1EYL A;  4H04 A;  3OJM A;  3O5W B;  4X37 A;  1S0E A;  3N0K A;  1TIE A;  4KBB A;  3HAL A;  3PHZ A;  4JRA A;  2NTD A;  3NJ5 A;  2IHO A;  4HJJ A;  5DUY A;  3FJ9 A;  1OQL B;  4MZH A;  4OEE A;  2K4A B;  1YXW A;  4DEN A;  4L4I A;  2WRY A;  4J2S A;  1XYF A;  4ZKT B;  1DIW A;  1WD4 A;  5F8S A;  3AKF A;  4USO A;  4OWK A;  2DS0 A;  4FGF A;  1DZC A;  4ZOT A;  3OGF A;  2D7I A;  3T8S A;  3RTI B;  1W3A A;  4X39 A;  1VCL A;  2Z49 A;  3OJV A;  4PC4 A;  1IOB A;  1JT5 A;  4JP0 A;  3H6R A;  4JPZ A;  1EPW A;  1TTU A;  3CA6 A;  1ISZ A;  4H75 A;  1YTO A;  5FZZ A;  2WBC A;  5FNX A;  1IHK A;  3F62 B;  4I4R A;  1PUM B;  4G6J A;  6I1B A;  2ZQN A;  3CRI A;  3MAL A;  1BFG A;  3ZXG A;  1SZ6 B;  1RZO B;  5D61 A;  1AVA C;  3BRD A;  3FUQ A;  1MD6 A;  2FFV A;  4I4V A;  4IQP A;  4QKR A;  2NZ9 A;  2VUA A;  1ITB A;  3N7J A;  9ILB A;  3P6J A;  3BAH A;  3O4B A;  5F8W A;  4XFT A;  1PRE A;  1I1E A;  5BVP I;  3OGG A;  1BLA A;  3FJE A;  4ZA3 B;  3BAG A;  2BEB A;  4D0T A;  1HWM B;  1TWE A;  4IZX A;  2KH2 A;  2D43 A;  3BRF A;  1T4Q A;  3O49 A;  1DQO A;  4QKS A;  4GOV A;  1ONK B;  3WMV A;  1WBC A;  3PME A;  4Q91 A;  2D44 A;  1S0G A;  4XKI A;  2AQZ A;  2RQ9 A;  1YBI A;  2AXM A;  3O44 A;  4J2Y A;  5BP5 A;  2NM1 A;  3G4O A;  2E4M A;  2MLL B;  1ISV A;  3R4S A;  1HCD A;  1R8O A;  3IM7 A;  2DRZ A;  4ZLB B;  4LO7 B;  3P53 A;  3O4O A;  2VXT I;  4AN7 B;  4ZFY B;  3Q7X A;  3JRR A;  1AVU A;  3PG0 A;  5B2H A;  1PC8 B;  3FGM A;  4XFU A;  2ERM A;  4X38 A;  1S0C A;  3VEQ A;  2F2F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...