1W3GA

Hemolytic lectin from the mushroom laetiporus sulphureus complexed with two n-acetyllactosamine molecules.
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
312
structure length
312
Chain Sequence
b'DIYIPPEGLYFRLLGFASRQVIFARNSPSPDVGLSPVNDQATDQYFSLIYGTGEHAGLYAIKSKATGKVLFSRRPAEPYVGQIDGDGRYPDNWFKIEPGKTYLSKYFRLVQPSTGTALVSRTHLQPYFWNHPQTEVFDDQYFTFLFEDMSIDKIEYDLKDGRILSSTPNVLATQTLENTSSQTQEMSFNLSQTLTQTSTFAYTAGFTIAVGTAFKAGVPIFAETEFKVDISVDNQWNWGEENTFSKTYTATFSVRAGPGETVKAVSTVDSGIINVPFTAYLSSKSTGFEVTTEGIWRGVSSWDLRHTLTSVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMOLYTIC LECTIN FROM LAETIPORUS SULPHUREUS
publication title Structural Analysis of the Laetiporus Sulphureus Hemolytic Pore-Forming Lectin in Complex with Sugars
pubmed doi rcsb
molecule tags Toxin/lectin
total genus 59
structure length 312
sequence length 312
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03318 ETX_MTX2 Clostridium epsilon toxin ETX/Bacillus mosquitocidal toxin MTX2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1w3gA01
2.170.15.10 Mainly Beta Beta Complex Proaerolysin; Chain A, domain 3 Proaerolysin, chain A, domain 3 1w3gA02
1MC9A 3B9UA 3CA1A 1AVWB 4ISQA 3FJ9A 5DVHA 3CA3A 3FUQA 3CRGA 2ZQOA 4I37A 1FV3A 1DFQA 3NBDA 4GP3A 4X37A 1PZZA 2QYIB 1ONKB 1WD4A 2E4MC 3O5WB 1YXWA 1DZCA 2NM1A 2VXTI 5HPZA 3AKFA 5FZYA 1IRPA 41BIA 2D23A 2LIEA 1S0LA 1NZKA 4ZFUB 1JLYA 1T4QA 1PUUB 1Z2VA 3FUOA 5FZZA 3O4DA 1F31A 2Q9XA 1FV2A 2P39A 3V0BA 3BA7A 2F2FA 1R8OA 1CVSA 5DSSB 1HCDA 3BA4A 4LO3A 1DIWA 3EF2A 4GAFA 1IILA 1ISZA 2X2TA 4I4XA 3OGGA 4YOLA 3BADA 4QD2C 1ITBA 1GGPB 4CJMA 4LO7B 3AH4A 1RG8A 2RG9B 1D0HA 3OJ2A 1R8NA 4D0ZA 4JRAA 2Z49A 3S8KA 1BFFA 3IM7A 4J2YA 1QQKA 3H6QA 4IY9A 3N7MA 3FFZA 4I0YA 2Y9FA 1MD6A 4I4UA 3VSZA 2FFUA 3WO2A 3C9ZA 2HW9A 4KC3A 3AH2A 4R6UB 4Z8SB 1JT7A 4ZA3B 4A7ZA 3G4NA 3BTAA 2UUSA 4QC4A 4XKIA 3P6JA 5JMCA 2F2FC 1EVTA 2BEAA 1JT5A 2DRYA 4LO3C 4I4VA 3O49A 4P0LA 1YYNA 3BAOA 3C0NA 1NUNA 4IONA 3JUTA 3A22A 4G6JA 1BLDA 2Q3NB 4H04A 3K1XA 3V0AA 4J2XA 3CU1B 1JTCA 2RSTA 4XFTA 1J0SA 1Z0HA 2VXRA 5BOWA 3F62B 3G4OA 4WBCA 3TC2A 2D43A 2Y9GA 4LO2A 3OJVA 1W3FA 4G9NA 3UD8A 2MIBA 7I1BA 3O3QA 4G1RA 3H6RA 1AFCA 1AVUA 1HWNB 4I4YA 3AH1A 4GOVA 4XFUA 1II4A 2KH2A 3BAQA 4I6IA 1M2TB 1N4KA 3HOMA 5F8SA 2ZQNA 2X2SA 2BEBA 4IZEA 1PWAA 3FJFA 4HR6C 3RSJA 3WMVA 2NVHA 4AN6A 3MALA 1JY0A 1JT3A 3QR5A 3R4SA 1T9FA 3A07A 3ZC8A 3RTJB 3UD7A 1K5VA 1S0EA 3Q7WA 3CA0A 3LTQA 3Q7YA 2Y9WC 4G6MA 2NP0A 4OWKA 5DUYA 4JQ0A 4ENDA 4ZOTA 3ZJXA 1CE7B 1JQZA 4OW4A 4A7YA 4I8MA 4LO2C 4DEPA 4P0JA 2KKIA 4QO3A 3NBEA 3POKA 2D44A 3N7LA 4I4OA 1HWPB 2J3PA 2AXMA 4D0TA 1OQLB 31BIA 1G9DA 3VUOA 2BFHA 1SZ6B 1V6XA 3H6RB 3FJDA 3I2AA 5D63A 1AVAC 2HZ9A 5I1BA 4I96A 4JKQA 9ILBA 4XFSA 1W3AA 4I4SA 3AJ6A 3BAVA 1Z4SA 4LO0A 4KEJA 3W9TA 3D7WB 3ILAA 1TTUA 4Q9GA 2MC2A 5FNWA 4GP0A 1BFBA 5BP5A 1BARA 4II0A 1IHKA 3NJ5A 3NBNA 3UJ4A 1IT0A 2DREA 5G00A 3VWCA 1ISVA 2ESUA 3VT2A 4ZFWB 4I1EA 3CA4A 3FJ8A 4QD2B 2ERMA 4OWLA 4A7KA 5EC5A 2VUAA 3O4BA 1KNMA 4X38A 4DCKC 1WBAA 3BX1C 3O4AA 5D62A 4ZGRB 2D7RA 3O4OA 4LO0C 1JLXA 1TWEA 4QBCA 1ILR1 3RTIB 2M49A 4IQPA 5BXPA 3BRGC 1G9AA 5EHAA 1BFGA 3FGMA 1TP0A 4KEIA 1ISWA 3C0MA 3ZXGA 1W3GA 1Z52A 3CA6A 4ZKTB 3C0OA 4G9MA 4JPZA 4JP0A 5BP5C 4QALA 1WBCA 3V0BB 1VCLA 1XZZA 3VSFA 3A23A 4X3AA 3T8SA 3MPPG 1I1BA 1K5UA 2R9KB 4F34A 5FNXA 4ZFYB 5JLVA 1AF9A 4LO1A 2FFVA 1S0CA 4I7IA 1S0BA 2D24A 4F83A 2YUGA 3FJIA 4OEFA 3Q7XA 5BXSA 2FGFA 4QKSA 4LO8B 3ZXDA 3BAGA 3KMVA 2NTDA 4TLPA 3JRRA 4Z9WB 3O44A 3HALA 1TWMA 1HWMB 2IWTB 3IM5A 3FJHA 1A8DA 2AFGA 1AVXB 1ISYA 2K43A 3AZVA 3O4CA 2MLLB 4OEGA 3NBCA 4P0KA 1AXMA 1XYFA 3UDAA 3N0KA 1RMLA 4OUJA 3RMXA 1BFCA 3RMYA 1RZOB 1TIEA 1Q04A 4I4RA 4Q9PA 2VSAA 2GZBA 4I1BA 2HWAA 1BASA 1DJSB 1FMZA 3AKGA 3HSMA 4JAWA 1V6VA 4LO1C 4OEEA 3V0AB 5F90A 1S0DA 1FQ9A 1DFCA 2KI6B 2AQZA 2NYYA 1BA7A 2GO2A 1FWUA 4J2SA 3FJAA 3AZWA 2L5XA 3UJ0A 3V79C 1JT4A 1HWOB 1PC8B 3PUBA 3ZX7A 1V6UA 1YBIA 3FJCA 4EFRA 3F1RA 3ZC9A 3PHZA 2I1BA 4IY8A 3A21A 4HJJA 5F8WA 2FDBM 2Z48A 4I2SA 2VSEA 3I2XA 3P6IA 1YTOA 4JKXB 4EKXB 3WO4A 1PUMB 4L4HA 3PMEA 4USOA 3WO3A 3N7KA 3QYDA 2F8XC 1EYLA 2DRZA 3S8JA 1TOOA 2AAIB 4KEKA 3PG0A 3HMYA 4EFQA 1HCEA 4IYBA 3OJMA 1V6WA 2P23A 1SR4A 2D22A 3H6SE 4H9WA 1EV2A 1QQLA 1FN0A 4GAIA 2FO1A 5E24E 1YF8B 1P63A 5D61A 2XOAA 4Q91A 1DZDA 5DZUA 1FMMS 4ISRA 3SNVA 1IRAX 3BAUA 4OWJA 3CA5A 1BLAA 3CQAA 1FWVA 1XHBA 2RQ9A 3OGFA 3VT1A 2D20A 2D7IA 4QKRA 3WMUA 4EEEB 1G9BA 1TFMB 1E0OA 1ISXA 2HWMA 5BXTA 4LO7C 5BQUA 2KI4A 2K8RA 1Q1UA 2KLLA 2VLCA 3AKHA 2QN4A 3OBRA 1S0FA 3WINA 1HIBA 2ZR1B 1WD3A 1IJTA 4EB2B 1PREA 4HA2A 1SR4C 3HN1A 3CRIA 4ZLBB 21BIA 1HKNA 3FJEA 3BRFA 3E8LC 5FZUA 2K4AB 4IZXA 4ZBVB 4J23B 3AKIA 2D1ZA 5B2HA 1DLLA 3OBTA 3IAGC 4PC4A 5BVPI 2VU9A 1FGAA 3AJ5A 5GAQA 3N7JA 4X39A 1G9CA 3WA1A 1M16A 2DS0A 1Q03A 3BAHA 5BQUC 3I29B 2Y9XE 2IHOA 4L4IA 4I4QA 5F8YA 4AN7B 4I3NA 3WINC 1IOBA 3BRDA 3CRHA 3FJKA 3UD9A 3VT0A 1DQGA 3R4UA 8I1BA 1L2HA 5EG6C 3LLPA 4J2KA 4P6AA 1EPWA 4EFPA 2ET2A 1I1EA 4DENA 2NZ9A 1DQOA 3FJJA 1XG6A 2E4MA 3P53A 4QBVA 1QXMA 4I4PA 3IIRA 3BB2A 1G82A 4FGFA 5BXRA 4USPA 2D42A 3CAHA 1RY7A 4FVVA 3FJBA 3HBWA 2WRYA 4GOYA 4KBBA 1UYJA 2WBCA 3IM6A 6I1BA 1ABRB 3BA5A 4IHZA 3VEQA 4D8HA 1S0GA 2LIQA 1UPSA
chains in the Genus database with same CATH superfamily
1MC9A 3B9UA 3CA1A 1AVWB 4ISQA 3FJ9A 5DVHA 3CA3A 3FUQA 3CRGA 2ZQOA 4I37A 1FV3A 1DFQA 3NBDA 4GP3A 4X37A 1PZZA 2QYIB 1ONKB 1WD4A 2E4MC 3O5WB 1YXWA 1DZCA 2NM1A 2VXTI 5HPZA 3AKFA 5FZYA 1IRPA 41BIA 2D23A 2LIEA 1S0LA 1NZKA 4ZFUB 1JLYA 1T4QA 1PUUB 1Z2VA 3FUOA 5FZZA 3O4DA 1F31A 2Q9XA 1FV2A 2P39A 3V0BA 3BA7A 2F2FA 1R8OA 1CVSA 5DSSB 1HCDA 3BA4A 4LO3A 1DIWA 3EF2A 4GAFA 1IILA 1ISZA 2X2TA 4I4XA 3OGGA 4YOLA 3BADA 4QD2C 1ITBA 1GGPB 4CJMA 4LO7B 3AH4A 1RG8A 2RG9B 1D0HA 3OJ2A 1R8NA 4D0ZA 4JRAA 2Z49A 3S8KA 1BFFA 3IM7A 4J2YA 1QQKA 3H6QA 4IY9A 3N7MA 3FFZA 4I0YA 2Y9FA 1MD6A 4I4UA 3VSZA 2FFUA 3WO2A 3C9ZA 2HW9A 4KC3A 3AH2A 4R6UB 4Z8SB 1JT7A 4ZA3B 4A7ZA 3G4NA 3BTAA 2UUSA 4QC4A 4XKIA 3P6JA 5JMCA 2F2FC 1EVTA 2BEAA 1JT5A 2DRYA 4LO3C 4I4VA 3O49A 4P0LA 1YYNA 3BAOA 3C0NA 1NUNA 4IONA 3JUTA 3A22A 4G6JA 1BLDA 2Q3NB 4H04A 3K1XA 3V0AA 4J2XA 3CU1B 1JTCA 2RSTA 4XFTA 1J0SA 1Z0HA 2VXRA 5BOWA 3F62B 3G4OA 4WBCA 3TC2A 2D43A 2Y9GA 4LO2A 3OJVA 1W3FA 4G9NA 3UD8A 2MIBA 7I1BA 3O3QA 4G1RA 3H6RA 1AFCA 1AVUA 1HWNB 4I4YA 3AH1A 4GOVA 4XFUA 1II4A 2KH2A 3BAQA 4I6IA 1M2TB 1N4KA 3HOMA 5F8SA 2ZQNA 2X2SA 2BEBA 4IZEA 1PWAA 3FJFA 4HR6C 3RSJA 3WMVA 2NVHA 4AN6A 3MALA 1JY0A 1JT3A 3QR5A 3R4SA 1T9FA 3A07A 3ZC8A 3RTJB 3UD7A 1K5VA 1S0EA 3Q7WA 3CA0A 3LTQA 3Q7YA 2Y9WC 4G6MA 2NP0A 4OWKA 5DUYA 4JQ0A 4ENDA 4ZOTA 3ZJXA 1CE7B 1JQZA 4OW4A 4A7YA 4I8MA 4LO2C 4DEPA 4P0JA 2KKIA 4QO3A 3NBEA 2NS2A 3POKA 2D44A 3N7LA 4I4OA 1HWPB 2J3PA 2AXMA 4D0TA 1OQLB 31BIA 1G9DA 3VUOA 2BFHA 1SZ6B 1V6XA 3H6RB 3FJDA 3I2AA 5D63A 1AVAC 2HZ9A 5I1BA 4I96A 4JKQA 9ILBA 4XFSA 1W3AA 4I4SA 3AJ6A 3BAVA 1Z4SA 4LO0A 4KEJA 3W9TA 3D7WB 3ILAA 1TTUA 4Q9GA 2MC2A 5FNWA 4GP0A 1BFBA 5BP5A 1BARA 4II0A 1IHKA 3NJ5A 3NBNA 3UJ4A 1IT0A 2DREA 5G00A 3VWCA 1ISVA 2ESUA 3VT2A 4ZFWB 4I1EA 3CA4A 3FJ8A 4QD2B 2ERMA 4OWLA 4A7KA 5EC5A 2VUAA 3O4BA 1KNMA 4X38A 4DCKC 1WBAA 3BX1C 3O4AA 5D62A 4ZGRB 2D7RA 3O4OA 4LO0C 1JLXA 1TWEA 4QBCA 1ILR1 3RTIB 2M49A 4IQPA 5BXPA 3BRGC 1G9AA 5EHAA 1BFGA 3FGMA 1TP0A 4KEIA 1ISWA 3C0MA 3ZXGA 1W3GA 1Z52A 3CA6A 4ZKTB 3C0OA 4G9MA 4JPZA 4JP0A 5BP5C 4QALA 1WBCA 3V0BB 1VCLA 1XZZA 3VSFA 3A23A 4X3AA 3T8SA 3MPPG 1I1BA 1K5UA 2R9KB 4F34A 5FNXA 4ZFYB 5JLVA 1AF9A 4LO1A 4MZHA 2FFVA 1S0CA 4I7IA 1S0BA 2D24A 4F83A 2YUGA 3FJIA 4OEFA 3Q7XA 5BXSA 2FGFA 4QKSA 4LO8B 3ZXDA 3BAGA 3KMVA 2NTDA 4TLPA 3JRRA 4Z9WB 3O44A 3HALA 1TWMA 1HWMB 2IWTB 3IM5A 3FJHA 1A8DA 2AFGA 1AVXB 1ISYA 2K43A 3AZVA 3O4CA 2MLLB 4OEGA 3NBCA 4P0KA 1AXMA 1XYFA 3UDAA 3N0KA 1RMLA 4OUJA 3RMXA 1BFCA 3RMYA 1RZOB 1TIEA 1Q04A 4I4RA 4Q9PA 2VSAA 2GZBA 4I1BA 2HWAA 1BASA 1DJSB 1FMZA 3AKGA 3HSMA 4JAWA 1V6VA 4LO1C 4OEEA 3V0AB 5F90A 1S0DA 1FQ9A 1DFCA 2KI6B 2AQZA 2NYYA 1BA7A 2GO2A 1FWUA 4J2SA 3FJAA 3AZWA 2L5XA 3UJ0A 3V79C 1JT4A 1HWOB 1PC8B 3PUBA 3ZX7A 1V6UA 1YBIA 3FJCA 4EFRA 3F1RA 3ZC9A 3PHZA 4UY4A 2I1BA 4IY8A 3A21A 4HJJA 5F8WA 2FDBM 2Z48A 4I2SA 2VSEA 3I2XA 3P6IA 1YTOA 4JKXB 4EKXB 3WO4A 1PUMB 4L4HA 3PMEA 4USOA 3WO3A 3N7KA 3QYDA 2F8XC 1EYLA 2DRZA 3S8JA 1TOOA 2AAIB 4KEKA 3PG0A 3HMYA 4EFQA 1HCEA 4IYBA 3OJMA 1V6WA 2P23A 1SR4A 2D22A 3H6SE 4H9WA 1EV2A 1QQLA 1FN0A 4GAIA 2FO1A 5E24E 1YF8B 1P63A 5D61A 2XOAA 4Q91A 1DZDA 5DZUA 1FMMS 4ISRA 3SNVA 1IRAX 3BAUA 4OWJA 3CA5A 1BLAA 3CQAA 1FWVA 1XHBA 2RQ9A 3OGFA 3VT1A 2D20A 2D7IA 4QKRA 3WMUA 4EEEB 1G9BA 1TFMB 1E0OA 1ISXA 2HWMA 5BXTA 4LO7C 5BQUA 2KI4A 2K8RA 1Q1UA 2KLLA 2VLCA 3AKHA 2QN4A 3OBRA 1S0FA 3WINA 1HIBA 2ZR1B 1WD3A 1IJTA 4EB2B 1PREA 4HA2A 1SR4C 3HN1A 3CRIA 4ZLBB 21BIA 1HKNA 3FJEA 3BRFA 3E8LC 5FZUA 2K4AB 4IZXA 4ZBVB 4J23B 3AKIA 2D1ZA 5B2HA 1DLLA 3OBTA 4H75A 3IAGC 4PC4A 5BVPI 2VU9A 1FGAA 3AJ5A 5GAQA 3N7JA 4X39A 1G9CA 3WA1A 1M16A 2DS0A 1Q03A 3BAHA 5BQUC 3I29B 2Y9XE 2IHOA 4L4IA 4I4QA 5F8YA 4MZFB 4AN7B 4I3NA 4MZGB 3WINC 1IOBA 3BRDA 3CRHA 3FJKA 3UD9A 3VT0A 1DQGA 3R4UA 8I1BA 1L2HA 5EG6C 3LLPA 4J2KA 4P6AA 1EPWA 4EFPA 2ET2A 1I1EA 4DENA 2NZ9A 1DQOA 3FJJA 1XG6A 2E4MA 3P53A 4QBVA 1QXMA 4I4PA 3IIRA 3BB2A 1G82A 4FGFA 5BXRA 4USPA 2D42A 3CAHA 1RY7A 4FVVA 3FJBA 3HBWA 2WRYA 4GOYA 4KBBA 1UYJA 2WBCA 3IM6A 6I1BA 1ABRB 3BA5A 4IHZA 3VEQA 4D8HA 1S0GA 2LIQA 1UPSA
chains in the Genus database with same CATH topology
1MC9A 3B9UA 3CA1A 1AVWB 4ISQA 3FJ9A 5DVHA 3CA3A 3FUQA 3CRGA 2ZQOA 4I37A 1FV3A 1DFQA 3NBDA 4GP3A 4X37A 1PZZA 2QYIB 1ONKB 1WD4A 2E4MC 3O5WB 1YXWA 1DZCA 2NM1A 2VXTI 5HPZA 3AKFA 5FZYA 1IRPA 41BIA 2D23A 2LIEA 1S0LA 1NZKA 4ZFUB 1JLYA 1T4QA 1PUUB 1Z2VA 3FUOA 5FZZA 3O4DA 1F31A 2Q9XA 1FV2A 2P39A 3V0BA 3BA7A 2F2FA 1R8OA 1CVSA 5DSSB 1HCDA 3BA4A 4LO3A 1DIWA 3EF2A 4GAFA 1IILA 1ISZA 2X2TA 4I4XA 3OGGA 4YOLA 3BADA 4QD2C 1ITBA 1GGPB 4CJMA 4LO7B 3AH4A 1RG8A 2RG9B 1D0HA 3OJ2A 1R8NA 4D0ZA 4JRAA 2Z49A 3S8KA 1BFFA 3IM7A 4J2YA 1QQKA 3H6QA 4IY9A 3N7MA 3FFZA 4I0YA 2Y9FA 1MD6A 4I4UA 3VSZA 2FFUA 3WO2A 3C9ZA 2HW9A 4KC3A 3AH2A 4R6UB 4Z8SB 1JT7A 4ZA3B 4A7ZA 3G4NA 3BTAA 2UUSA 4QC4A 4XKIA 3P6JA 5JMCA 2F2FC 1EVTA 2BEAA 1JT5A 2DRYA 4LO3C 4I4VA 3O49A 4P0LA 1YYNA 3BAOA 3C0NA 1NUNA 4IONA 3JUTA 3A22A 4G6JA 1BLDA 2Q3NB 4H04A 3K1XA 3V0AA 4J2XA 3CU1B 1JTCA 2RSTA 4XFTA 1J0SA 1Z0HA 2VXRA 5BOWA 3F62B 3G4OA 4WBCA 3TC2A 2D43A 2Y9GA 4LO2A 3OJVA 1W3FA 4G9NA 3UD8A 2MIBA 7I1BA 3O3QA 4G1RA 3H6RA 1AFCA 1AVUA 1HWNB 4I4YA 3AH1A 4GOVA 4XFUA 1II4A 2KH2A 3BAQA 4I6IA 1M2TB 1N4KA 3HOMA 5F8SA 2ZQNA 2X2SA 2BEBA 4IZEA 1PWAA 3FJFA 4HR6C 3RSJA 3WMVA 2NVHA 4AN6A 3MALA 1JY0A 1JT3A 3QR5A 3R4SA 1T9FA 3A07A 3ZC8A 3RTJB 3UD7A 1K5VA 1S0EA 3Q7WA 3CA0A 3LTQA 3Q7YA 2Y9WC 4G6MA 2NP0A 4OWKA 5DUYA 4JQ0A 4ENDA 4ZOTA 3ZJXA 1CE7B 1JQZA 4OW4A 4A7YA 4I8MA 4LO2C 4DEPA 4P0JA 2KKIA 4QO3A 3NBEA 2NS2A 3POKA 2D44A 3N7LA 4I4OA 1HWPB 2J3PA 2AXMA 4D0TA 1OQLB 31BIA 1G9DA 3VUOA 2BFHA 1SZ6B 1V6XA 3H6RB 3FJDA 3I2AA 5D63A 1AVAC 2HZ9A 5I1BA 4I96A 4JKQA 9ILBA 4XFSA 1W3AA 4I4SA 3AJ6A 3BAVA 1Z4SA 4LO0A 4KEJA 3W9TA 3D7WB 3ILAA 1TTUA 4Q9GA 2MC2A 5FNWA 4GP0A 1BFBA 5BP5A 1BARA 4II0A 1IHKA 3NJ5A 3NBNA 3UJ4A 1IT0A 2DREA 5G00A 3VWCA 1ISVA 2ESUA 3VT2A 4ZFWB 4I1EA 3CA4A 3FJ8A 4QD2B 2ERMA 4OWLA 4A7KA 5EC5A 2VUAA 3O4BA 1KNMA 4X38A 4DCKC 1WBAA 3BX1C 3O4AA 5D62A 4ZGRB 2D7RA 3O4OA 4LO0C 1JLXA 1TWEA 4QBCA 1ILR1 3RTIB 2M49A 4IQPA 5BXPA 3BRGC 1G9AA 5EHAA 1BFGA 3FGMA 1TP0A 4KEIA 1ISWA 3C0MA 3ZXGA 1W3GA 1Z52A 3CA6A 4ZKTB 3C0OA 4G9MA 4JPZA 4JP0A 5BP5C 4QALA 1WBCA 3V0BB 1VCLA 1XZZA 3VSFA 3A23A 4X3AA 3T8SA 3MPPG 1I1BA 1K5UA 2R9KB 4F34A 5FNXA 4ZFYB 5JLVA 1AF9A 4LO1A 4MZHA 2FFVA 1S0CA 4I7IA 1S0BA 2D24A 4F83A 2YUGA 3FJIA 4OEFA 3Q7XA 5BXSA 2FGFA 4QKSA 4LO8B 3ZXDA 3BAGA 3KMVA 2NTDA 4TLPA 3JRRA 4Z9WB 3O44A 3HALA 1TWMA 1HWMB 2IWTB 3IM5A 3FJHA 1A8DA 2AFGA 1AVXB 1ISYA 2K43A 3AZVA 3O4CA 2MLLB 4OEGA 3NBCA 4P0KA 1AXMA 1XYFA 3UDAA 3N0KA 1RMLA 4OUJA 3RMXA 1BFCA 3RMYA 1RZOB 1TIEA 1Q04A 4I4RA 4Q9PA 2VSAA 2GZBA 4I1BA 2HWAA 1BASA 1DJSB 1FMZA 3AKGA 3HSMA 4JAWA 1V6VA 4LO1C 4OEEA 3V0AB 5F90A 1S0DA 1FQ9A 1DFCA 2KI6B 2AQZA 2NYYA 1BA7A 2GO2A 1FWUA 4J2SA 3FJAA 3AZWA 2L5XA 3UJ0A 3V79C 1JT4A 1HWOB 1PC8B 3PUBA 3ZX7A 1V6UA 1YBIA 3FJCA 4EFRA 3F1RA 3ZC9A 3PHZA 4UY4A 2I1BA 4IY8A 3A21A 4HJJA 5F8WA 2FDBM 2Z48A 4I2SA 2VSEA 3I2XA 3P6IA 1YTOA 4JKXB 4EKXB 3WO4A 1PUMB 4L4HA 3PMEA 4USOA 3WO3A 3N7KA 3QYDA 2F8XC 1EYLA 2DRZA 3S8JA 1TOOA 2AAIB 4KEKA 3PG0A 3HMYA 4EFQA 1HCEA 4IYBA 3OJMA 1V6WA 2P23A 1SR4A 2D22A 3H6SE 4H9WA 1EV2A 1QQLA 1FN0A 4GAIA 2FO1A 5E24E 1YF8B 1P63A 5D61A 2XOAA 4Q91A 1DZDA 5DZUA 1FMMS 4ISRA 3SNVA 1IRAX 3BAUA 4OWJA 3CA5A 1BLAA 3CQAA 1FWVA 1XHBA 2RQ9A 3OGFA 3VT1A 2D20A 2D7IA 4QKRA 3WMUA 4EEEB 1G9BA 1TFMB 1E0OA 1ISXA 2HWMA 5BXTA 4LO7C 5BQUA 2KI4A 2K8RA 1Q1UA 2KLLA 2VLCA 3AKHA 2QN4A 3OBRA 1S0FA 3WINA 1HIBA 2ZR1B 1WD3A 1IJTA 4EB2B 1PREA 4HA2A 1SR4C 3HN1A 3CRIA 4ZLBB 21BIA 1HKNA 3FJEA 3BRFA 3E8LC 5FZUA 2K4AB 4IZXA 4ZBVB 4J23B 3AKIA 2D1ZA 5B2HA 1DLLA 3OBTA 4H75A 3IAGC 4PC4A 5BVPI 2VU9A 1FGAA 3AJ5A 5GAQA 3N7JA 4X39A 1G9CA 3WA1A 1M16A 2DS0A 1Q03A 3BAHA 5BQUC 3I29B 2Y9XE 2IHOA 4L4IA 4I4QA 5F8YA 4MZFB 4AN7B 4I3NA 4MZGB 3WINC 1IOBA 3BRDA 3CRHA 3FJKA 3UD9A 3VT0A 1DQGA 3R4UA 8I1BA 1L2HA 5EG6C 3LLPA 4J2KA 4P6AA 1EPWA 4EFPA 2ET2A 1I1EA 4DENA 2NZ9A 1DQOA 3FJJA 1XG6A 2E4MA 3P53A 4QBVA 1QXMA 4I4PA 3IIRA 3BB2A 1G82A 4FGFA 5BXRA 4USPA 2D42A 3CAHA 1RY7A 4FVVA 3FJBA 3HBWA 2WRYA 4GOYA 4KBBA 1UYJA 2WBCA 3IM6A 6I1BA 1ABRB 3BA5A 4IHZA 3VEQA 4D8HA 1S0GA 2LIQA 1UPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MC9 A;  3B9U A;  3CA1 A;  1AVW B;  4ISQ A;  3FJ9 A;  5DVH A;  3CA3 A;  3FUQ A;  3CRG A;  2ZQO A;  4I37 A;  1FV3 A;  1DFQ A;  3NBD A;  4GP3 A;  4X37 A;  1PZZ A;  2QYI B;  1ONK B;  1WD4 A;  2E4M C;  3O5W B;  1YXW A;  1DZC A;  2NM1 A;  2VXT I;  5HPZ A;  3AKF A;  5FZY A;  1IRP A;  41BI A;  2D23 A;  2LIE A;  1S0L A;  1NZK A;  4ZFU B;  1JLY A;  1T4Q A;  1PUU B;  1Z2V A;  3FUO A;  5FZZ A;  3O4D A;  1F31 A;  2Q9X A;  1FV2 A;  2P39 A;  3V0B A;  3BA7 A;  2F2F A;  1R8O A;  1CVS A;  5DSS B;  1HCD A;  3BA4 A;  4LO3 A;  1DIW A;  3EF2 A;  4GAF A;  1IIL A;  1ISZ A;  2X2T A;  4I4X A;  3OGG A;  4YOL A;  3BAD A;  4QD2 C;  1ITB A;  1GGP B;  4CJM A;  4LO7 B;  3AH4 A;  1RG8 A;  2RG9 B;  1D0H A;  3OJ2 A;  1R8N A;  4D0Z A;  4JRA A;  2Z49 A;  3S8K A;  1BFF A;  3IM7 A;  4J2Y A;  1QQK A;  3H6Q A;  4IY9 A;  3N7M A;  3FFZ A;  4I0Y A;  2Y9F A;  1MD6 A;  4I4U A;  3VSZ A;  2FFU A;  3WO2 A;  3C9Z A;  2HW9 A;  4KC3 A;  3AH2 A;  4R6U B;  4Z8S B;  1JT7 A;  4ZA3 B;  4A7Z A;  3G4N A;  3BTA A;  2UUS A;  4QC4 A;  4XKI A;  3P6J A;  5JMC A;  2F2F C;  1EVT A;  2BEA A;  1JT5 A;  2DRY A;  4LO3 C;  4I4V A;  3O49 A;  4P0L A;  1YYN A;  3BAO A;  3C0N A;  1NUN A;  4ION A;  3JUT A;  3A22 A;  4G6J A;  1BLD A;  2Q3N B;  4H04 A;  3K1X A;  3V0A A;  4J2X A;  3CU1 B;  1JTC A;  2RST A;  4XFT A;  1J0S A;  1Z0H A;  2VXR A;  5BOW A;  3F62 B;  3G4O A;  4WBC A;  3TC2 A;  2D43 A;  2Y9G A;  4LO2 A;  3OJV A;  1W3F A;  4G9N A;  3UD8 A;  2MIB A;  7I1B A;  3O3Q A;  4G1R A;  3H6R A;  1AFC A;  1AVU A;  1HWN B;  4I4Y A;  3AH1 A;  4GOV A;  4XFU A;  1II4 A;  2KH2 A;  3BAQ A;  4I6I A;  1M2T B;  1N4K A;  3HOM A;  5F8S A;  2ZQN A;  2X2S A;  2BEB A;  4IZE A;  1PWA A;  3FJF A;  4HR6 C;  3RSJ A;  3WMV A;  2NVH A;  4AN6 A;  3MAL A;  1JY0 A;  1JT3 A;  3QR5 A;  3R4S A;  1T9F A;  3A07 A;  3ZC8 A;  3RTJ B;  3UD7 A;  1K5V A;  1S0E A;  3Q7W A;  3CA0 A;  3LTQ A;  3Q7Y A;  2Y9W C;  4G6M A;  2NP0 A;  4OWK A;  5DUY A;  4JQ0 A;  4END A;  4ZOT A;  3ZJX A;  1CE7 B;  1JQZ A;  4OW4 A;  4A7Y A;  4I8M A;  4LO2 C;  4DEP A;  4P0J A;  2KKI A;  4QO3 A;  3NBE A;  3POK A;  2D44 A;  3N7L A;  4I4O A;  1HWP B;  2J3P A;  2AXM A;  4D0T A;  1OQL B;  31BI A;  1G9D A;  3VUO A;  2BFH A;  1SZ6 B;  1V6X A;  3H6R B;  3FJD A;  3I2A A;  5D63 A;  1AVA C;  2HZ9 A;  5I1B A;  4I96 A;  4JKQ A;  9ILB A;  4XFS A;  1W3A A;  4I4S A;  3AJ6 A;  3BAV A;  1Z4S A;  4LO0 A;  4KEJ A;  3W9T A;  3D7W B;  3ILA A;  1TTU A;  4Q9G A;  2MC2 A;  5FNW A;  4GP0 A;  1BFB A;  5BP5 A;  1BAR A;  4II0 A;  1IHK A;  3NJ5 A;  3NBN A;  3UJ4 A;  1IT0 A;  2DRE A;  5G00 A;  3VWC A;  1ISV A;  2ESU A;  3VT2 A;  4ZFW B;  4I1E A;  3CA4 A;  3FJ8 A;  4QD2 B;  2ERM A;  4OWL A;  4A7K A;  5EC5 A;  2VUA A;  3O4B A;  1KNM A;  4X38 A;  4DCK C;  1WBA A;  3BX1 C;  3O4A A;  5D62 A;  4ZGR B;  2D7R A;  3O4O A;  4LO0 C;  1JLX A;  1TWE A;  4QBC A;  1ILR 1;  3RTI B;  2M49 A;  4IQP A;  5BXP A;  3BRG C;  1G9A A;  5EHA A;  1BFG A;  3FGM A;  1TP0 A;  4KEI A;  1ISW A;  3C0M A;  3ZXG A;  1W3G A;  1Z52 A;  3CA6 A;  4ZKT B;  3C0O A;  4G9M A;  4JPZ A;  4JP0 A;  5BP5 C;  4QAL A;  1WBC A;  3V0B B;  1VCL A;  1XZZ A;  3VSF A;  3A23 A;  4X3A A;  3T8S A;  3MPP G;  1I1B A;  1K5U A;  2R9K B;  4F34 A;  5FNX A;  4ZFY B;  5JLV A;  1AF9 A;  4LO1 A;  2FFV A;  1S0C A;  4I7I A;  1S0B A;  2D24 A;  4F83 A;  2YUG A;  3FJI A;  4OEF A;  3Q7X A;  5BXS A;  2FGF A;  4QKS A;  4LO8 B;  3ZXD A;  3BAG A;  3KMV A;  2NTD A;  4TLP A;  3JRR A;  4Z9W B;  3O44 A;  3HAL A;  1TWM A;  1HWM B;  2IWT B;  3IM5 A;  3FJH A;  1A8D A;  2AFG A;  1AVX B;  1ISY A;  2K43 A;  3AZV A;  3O4C A;  2MLL B;  4OEG A;  3NBC A;  4P0K A;  1AXM A;  1XYF A;  3UDA A;  3N0K A;  1RML A;  4OUJ A;  3RMX A;  1BFC A;  3RMY A;  1RZO B;  1TIE A;  1Q04 A;  4I4R A;  4Q9P A;  2VSA A;  2GZB A;  4I1B A;  2HWA A;  1BAS A;  1DJS B;  1FMZ A;  3AKG A;  3HSM A;  4JAW A;  1V6V A;  4LO1 C;  4OEE A;  3V0A B;  5F90 A;  1S0D A;  1FQ9 A;  1DFC A;  2KI6 B;  2AQZ A;  2NYY A;  1BA7 A;  2GO2 A;  1FWU A;  4J2S A;  3FJA A;  3AZW A;  2L5X A;  3UJ0 A;  3V79 C;  1JT4 A;  1HWO B;  1PC8 B;  3PUB A;  3ZX7 A;  1V6U A;  1YBI A;  3FJC A;  4EFR A;  3F1R A;  3ZC9 A;  3PHZ A;  2I1B A;  4IY8 A;  3A21 A;  4HJJ A;  5F8W A;  2FDB M;  2Z48 A;  4I2S A;  2VSE A;  3I2X A;  3P6I A;  1YTO A;  4JKX B;  4EKX B;  3WO4 A;  1PUM B;  4L4H A;  3PME A;  4USO A;  3WO3 A;  3N7K A;  3QYD A;  2F8X C;  1EYL A;  2DRZ A;  3S8J A;  1TOO A;  2AAI B;  4KEK A;  3PG0 A;  3HMY A;  4EFQ A;  1HCE A;  4IYB A;  3OJM A;  1V6W A;  2P23 A;  1SR4 A;  2D22 A;  3H6S E;  4H9W A;  1EV2 A;  1QQL A;  1FN0 A;  4GAI A;  2FO1 A;  5E24 E;  1YF8 B;  1P63 A;  5D61 A;  2XOA A;  4Q91 A;  1DZD A;  5DZU A;  1FMM S;  4ISR A;  3SNV A;  1IRA X;  3BAU A;  4OWJ A;  3CA5 A;  1BLA A;  3CQA A;  1FWV A;  1XHB A;  2RQ9 A;  3OGF A;  3VT1 A;  2D20 A;  2D7I A;  4QKR A;  3WMU A;  4EEE B;  1G9B A;  1TFM B;  1E0O A;  1ISX A;  2HWM A;  5BXT A;  4LO7 C;  5BQU A;  2KI4 A;  2K8R A;  1Q1U A;  2KLL A;  2VLC A;  3AKH A;  2QN4 A;  3OBR A;  1S0F A;  3WIN A;  1HIB A;  2ZR1 B;  1WD3 A;  1IJT A;  4EB2 B;  1PRE A;  4HA2 A;  1SR4 C;  3HN1 A;  3CRI A;  4ZLB B;  21BI A;  1HKN A;  3FJE A;  3BRF A;  3E8L C;  5FZU A;  2K4A B;  4IZX A;  4ZBV B;  4J23 B;  3AKI A;  2D1Z A;  5B2H A;  1DLL A;  3OBT A;  3IAG C;  4PC4 A;  5BVP I;  2VU9 A;  1FGA A;  3AJ5 A;  5GAQ A;  3N7J A;  4X39 A;  1G9C A;  3WA1 A;  1M16 A;  2DS0 A;  1Q03 A;  3BAH A;  5BQU C;  3I29 B;  2Y9X E;  2IHO A;  4L4I A;  4I4Q A;  5F8Y A;  4AN7 B;  4I3N A;  3WIN C;  1IOB A;  3BRD A;  3CRH A;  3FJK A;  3UD9 A;  3VT0 A;  1DQG A;  3R4U A;  8I1B A;  1L2H A;  5EG6 C;  3LLP A;  4J2K A;  4P6A A;  1EPW A;  4EFP A;  2ET2 A;  1I1E A;  4DEN A;  2NZ9 A;  1DQO A;  3FJJ A;  1XG6 A;  2E4M A;  3P53 A;  4QBV A;  1QXM A;  4I4P A;  3IIR A;  3BB2 A;  1G82 A;  4FGF A;  5BXR A;  4USP A;  2D42 A;  3CAH A;  1RY7 A;  4FVV A;  3FJB A;  3HBW A;  2WRY A;  4GOY A;  4KBB A;  1UYJ A;  2WBC A;  3IM6 A;  6I1B A;  1ABR B;  3BA5 A;  4IHZ A;  3VEQ A;  4D8H A;  1S0G A;  2LIQ A;  1UPS A; 
#chains in the Genus database with same CATH topology
 1MC9 A;  3B9U A;  3CA1 A;  1AVW B;  4ISQ A;  3FJ9 A;  5DVH A;  3CA3 A;  3FUQ A;  3CRG A;  2ZQO A;  4I37 A;  1FV3 A;  1DFQ A;  3NBD A;  4GP3 A;  4X37 A;  1PZZ A;  2QYI B;  1ONK B;  1WD4 A;  2E4M C;  3O5W B;  1YXW A;  1DZC A;  2NM1 A;  2VXT I;  5HPZ A;  3AKF A;  5FZY A;  1IRP A;  41BI A;  2D23 A;  2LIE A;  1S0L A;  1NZK A;  4ZFU B;  1JLY A;  1T4Q A;  1PUU B;  1Z2V A;  3FUO A;  5FZZ A;  3O4D A;  1F31 A;  2Q9X A;  1FV2 A;  2P39 A;  3V0B A;  3BA7 A;  2F2F A;  1R8O A;  1CVS A;  5DSS B;  1HCD A;  3BA4 A;  4LO3 A;  1DIW A;  3EF2 A;  4GAF A;  1IIL A;  1ISZ A;  2X2T A;  4I4X A;  3OGG A;  4YOL A;  3BAD A;  4QD2 C;  1ITB A;  1GGP B;  4CJM A;  4LO7 B;  3AH4 A;  1RG8 A;  2RG9 B;  1D0H A;  3OJ2 A;  1R8N A;  4D0Z A;  4JRA A;  2Z49 A;  3S8K A;  1BFF A;  3IM7 A;  4J2Y A;  1QQK A;  3H6Q A;  4IY9 A;  3N7M A;  3FFZ A;  4I0Y A;  2Y9F A;  1MD6 A;  4I4U A;  3VSZ A;  2FFU A;  3WO2 A;  3C9Z A;  2HW9 A;  4KC3 A;  3AH2 A;  4R6U B;  4Z8S B;  1JT7 A;  4ZA3 B;  4A7Z A;  3G4N A;  3BTA A;  2UUS A;  4QC4 A;  4XKI A;  3P6J A;  5JMC A;  2F2F C;  1EVT A;  2BEA A;  1JT5 A;  2DRY A;  4LO3 C;  4I4V A;  3O49 A;  4P0L A;  1YYN A;  3BAO A;  3C0N A;  1NUN A;  4ION A;  3JUT A;  3A22 A;  4G6J A;  1BLD A;  2Q3N B;  4H04 A;  3K1X A;  3V0A A;  4J2X A;  3CU1 B;  1JTC A;  2RST A;  4XFT A;  1J0S A;  1Z0H A;  2VXR A;  5BOW A;  3F62 B;  3G4O A;  4WBC A;  3TC2 A;  2D43 A;  2Y9G A;  4LO2 A;  3OJV A;  1W3F A;  4G9N A;  3UD8 A;  2MIB A;  7I1B A;  3O3Q A;  4G1R A;  3H6R A;  1AFC A;  1AVU A;  1HWN B;  4I4Y A;  3AH1 A;  4GOV A;  4XFU A;  1II4 A;  2KH2 A;  3BAQ A;  4I6I A;  1M2T B;  1N4K A;  3HOM A;  5F8S A;  2ZQN A;  2X2S A;  2BEB A;  4IZE A;  1PWA A;  3FJF A;  4HR6 C;  3RSJ A;  3WMV A;  2NVH A;  4AN6 A;  3MAL A;  1JY0 A;  1JT3 A;  3QR5 A;  3R4S A;  1T9F A;  3A07 A;  3ZC8 A;  3RTJ B;  3UD7 A;  1K5V A;  1S0E A;  3Q7W A;  3CA0 A;  3LTQ A;  3Q7Y A;  2Y9W C;  4G6M A;  2NP0 A;  4OWK A;  5DUY A;  4JQ0 A;  4END A;  4ZOT A;  3ZJX A;  1CE7 B;  1JQZ A;  4OW4 A;  4A7Y A;  4I8M A;  4LO2 C;  4DEP A;  4P0J A;  2KKI A;  4QO3 A;  3NBE A;  2NS2 A;  3POK A;  2D44 A;  3N7L A;  4I4O A;  1HWP B;  2J3P A;  2AXM A;  4D0T A;  1OQL B;  31BI A;  1G9D A;  3VUO A;  2BFH A;  1SZ6 B;  1V6X A;  3H6R B;  3FJD A;  3I2A A;  5D63 A;  1AVA C;  2HZ9 A;  5I1B A;  4I96 A;  4JKQ A;  9ILB A;  4XFS A;  1W3A A;  4I4S A;  3AJ6 A;  3BAV A;  1Z4S A;  4LO0 A;  4KEJ A;  3W9T A;  3D7W B;  3ILA A;  1TTU A;  4Q9G A;  2MC2 A;  5FNW A;  4GP0 A;  1BFB A;  5BP5 A;  1BAR A;  4II0 A;  1IHK A;  3NJ5 A;  3NBN A;  3UJ4 A;  1IT0 A;  2DRE A;  5G00 A;  3VWC A;  1ISV A;  2ESU A;  3VT2 A;  4ZFW B;  4I1E A;  3CA4 A;  3FJ8 A;  4QD2 B;  2ERM A;  4OWL A;  4A7K A;  5EC5 A;  2VUA A;  3O4B A;  1KNM A;  4X38 A;  4DCK C;  1WBA A;  3BX1 C;  3O4A A;  5D62 A;  4ZGR B;  2D7R A;  3O4O A;  4LO0 C;  1JLX A;  1TWE A;  4QBC A;  1ILR 1;  3RTI B;  2M49 A;  4IQP A;  5BXP A;  3BRG C;  1G9A A;  5EHA A;  1BFG A;  3FGM A;  1TP0 A;  4KEI A;  1ISW A;  3C0M A;  3ZXG A;  1W3G A;  1Z52 A;  3CA6 A;  4ZKT B;  3C0O A;  4G9M A;  4JPZ A;  4JP0 A;  5BP5 C;  4QAL A;  1WBC A;  3V0B B;  1VCL A;  1XZZ A;  3VSF A;  3A23 A;  4X3A A;  3T8S A;  3MPP G;  1I1B A;  1K5U A;  2R9K B;  4F34 A;  5FNX A;  4ZFY B;  5JLV A;  1AF9 A;  4LO1 A;  4MZH A;  2FFV A;  1S0C A;  4I7I A;  1S0B A;  2D24 A;  4F83 A;  2YUG A;  3FJI A;  4OEF A;  3Q7X A;  5BXS A;  2FGF A;  4QKS A;  4LO8 B;  3ZXD A;  3BAG A;  3KMV A;  2NTD A;  4TLP A;  3JRR A;  4Z9W B;  3O44 A;  3HAL A;  1TWM A;  1HWM B;  2IWT B;  3IM5 A;  3FJH A;  1A8D A;  2AFG A;  1AVX B;  1ISY A;  2K43 A;  3AZV A;  3O4C A;  2MLL B;  4OEG A;  3NBC A;  4P0K A;  1AXM A;  1XYF A;  3UDA A;  3N0K A;  1RML A;  4OUJ A;  3RMX A;  1BFC A;  3RMY A;  1RZO B;  1TIE A;  1Q04 A;  4I4R A;  4Q9P A;  2VSA A;  2GZB A;  4I1B A;  2HWA A;  1BAS A;  1DJS B;  1FMZ A;  3AKG A;  3HSM A;  4JAW A;  1V6V A;  4LO1 C;  4OEE A;  3V0A B;  5F90 A;  1S0D A;  1FQ9 A;  1DFC A;  2KI6 B;  2AQZ A;  2NYY A;  1BA7 A;  2GO2 A;  1FWU A;  4J2S A;  3FJA A;  3AZW A;  2L5X A;  3UJ0 A;  3V79 C;  1JT4 A;  1HWO B;  1PC8 B;  3PUB A;  3ZX7 A;  1V6U A;  1YBI A;  3FJC A;  4EFR A;  3F1R A;  3ZC9 A;  3PHZ A;  4UY4 A;  2I1B A;  4IY8 A;  3A21 A;  4HJJ A;  5F8W A;  2FDB M;  2Z48 A;  4I2S A;  2VSE A;  3I2X A;  3P6I A;  1YTO A;  4JKX B;  4EKX B;  3WO4 A;  1PUM B;  4L4H A;  3PME A;  4USO A;  3WO3 A;  3N7K A;  3QYD A;  2F8X C;  1EYL A;  2DRZ A;  3S8J A;  1TOO A;  2AAI B;  4KEK A;  3PG0 A;  3HMY A;  4EFQ A;  1HCE A;  4IYB A;  3OJM A;  1V6W A;  2P23 A;  1SR4 A;  2D22 A;  3H6S E;  4H9W A;  1EV2 A;  1QQL A;  1FN0 A;  4GAI A;  2FO1 A;  5E24 E;  1YF8 B;  1P63 A;  5D61 A;  2XOA A;  4Q91 A;  1DZD A;  5DZU A;  1FMM S;  4ISR A;  3SNV A;  1IRA X;  3BAU A;  4OWJ A;  3CA5 A;  1BLA A;  3CQA A;  1FWV A;  1XHB A;  2RQ9 A;  3OGF A;  3VT1 A;  2D20 A;  2D7I A;  4QKR A;  3WMU A;  4EEE B;  1G9B A;  1TFM B;  1E0O A;  1ISX A;  2HWM A;  5BXT A;  4LO7 C;  5BQU A;  2KI4 A;  2K8R A;  1Q1U A;  2KLL A;  2VLC A;  3AKH A;  2QN4 A;  3OBR A;  1S0F A;  3WIN A;  1HIB A;  2ZR1 B;  1WD3 A;  1IJT A;  4EB2 B;  1PRE A;  4HA2 A;  1SR4 C;  3HN1 A;  3CRI A;  4ZLB B;  21BI A;  1HKN A;  3FJE A;  3BRF A;  3E8L C;  5FZU A;  2K4A B;  4IZX A;  4ZBV B;  4J23 B;  3AKI A;  2D1Z A;  5B2H A;  1DLL A;  3OBT A;  4H75 A;  3IAG C;  4PC4 A;  5BVP I;  2VU9 A;  1FGA A;  3AJ5 A;  5GAQ A;  3N7J A;  4X39 A;  1G9C A;  3WA1 A;  1M16 A;  2DS0 A;  1Q03 A;  3BAH A;  5BQU C;  3I29 B;  2Y9X E;  2IHO A;  4L4I A;  4I4Q A;  5F8Y A;  4MZF B;  4AN7 B;  4I3N A;  4MZG B;  3WIN C;  1IOB A;  3BRD A;  3CRH A;  3FJK A;  3UD9 A;  3VT0 A;  1DQG A;  3R4U A;  8I1B A;  1L2H A;  5EG6 C;  3LLP A;  4J2K A;  4P6A A;  1EPW A;  4EFP A;  2ET2 A;  1I1E A;  4DEN A;  2NZ9 A;  1DQO A;  3FJJ A;  1XG6 A;  2E4M A;  3P53 A;  4QBV A;  1QXM A;  4I4P A;  3IIR A;  3BB2 A;  1G82 A;  4FGF A;  5BXR A;  4USP A;  2D42 A;  3CAH A;  1RY7 A;  4FVV A;  3FJB A;  3HBW A;  2WRY A;  4GOY A;  4KBB A;  1UYJ A;  2WBC A;  3IM6 A;  6I1B A;  1ABR B;  3BA5 A;  4IHZ A;  3VEQ A;  4D8H A;  1S0G A;  2LIQ A;  1UPS A; 
#chains in the Genus database with same CATH homology
 1MC9 A;  3B9U A;  3CA1 A;  1AVW B;  4ISQ A;  3FJ9 A;  5DVH A;  3CA3 A;  3FUQ A;  3CRG A;  2ZQO A;  4I37 A;  1FV3 A;  1DFQ A;  3NBD A;  4GP3 A;  4X37 A;  1PZZ A;  2QYI B;  1ONK B;  1WD4 A;  2E4M C;  3O5W B;  1YXW A;  1DZC A;  2NM1 A;  2VXT I;  5HPZ A;  3AKF A;  5FZY A;  1IRP A;  41BI A;  2D23 A;  2LIE A;  1S0L A;  1NZK A;  4ZFU B;  1JLY A;  1T4Q A;  1PUU B;  1Z2V A;  3FUO A;  5FZZ A;  3O4D A;  1F31 A;  2Q9X A;  1FV2 A;  2P39 A;  3V0B A;  3BA7 A;  2F2F A;  1R8O A;  1CVS A;  5DSS B;  1HCD A;  3BA4 A;  4LO3 A;  1DIW A;  3EF2 A;  4GAF A;  1IIL A;  1ISZ A;  2X2T A;  4I4X A;  3OGG A;  4YOL A;  3BAD A;  4QD2 C;  1ITB A;  1GGP B;  4CJM A;  4LO7 B;  3AH4 A;  1RG8 A;  2RG9 B;  1D0H A;  3OJ2 A;  1R8N A;  4D0Z A;  4JRA A;  2Z49 A;  3S8K A;  1BFF A;  3IM7 A;  4J2Y A;  1QQK A;  3H6Q A;  4IY9 A;  3N7M A;  3FFZ A;  4I0Y A;  2Y9F A;  1MD6 A;  4I4U A;  3VSZ A;  2FFU A;  3WO2 A;  3C9Z A;  2HW9 A;  4KC3 A;  3AH2 A;  4R6U B;  4Z8S B;  1JT7 A;  4ZA3 B;  4A7Z A;  3G4N A;  3BTA A;  2UUS A;  4QC4 A;  4XKI A;  3P6J A;  5JMC A;  2F2F C;  1EVT A;  2BEA A;  1JT5 A;  2DRY A;  4LO3 C;  4I4V A;  3O49 A;  4P0L A;  1YYN A;  3BAO A;  3C0N A;  1NUN A;  4ION A;  3JUT A;  3A22 A;  4G6J A;  1BLD A;  2Q3N B;  4H04 A;  3K1X A;  3V0A A;  4J2X A;  3CU1 B;  1JTC A;  2RST A;  4XFT A;  1J0S A;  1Z0H A;  2VXR A;  5BOW A;  3F62 B;  3G4O A;  4WBC A;  3TC2 A;  2D43 A;  2Y9G A;  4LO2 A;  3OJV A;  1W3F A;  4G9N A;  3UD8 A;  2MIB A;  7I1B A;  3O3Q A;  4G1R A;  3H6R A;  1AFC A;  1AVU A;  1HWN B;  4I4Y A;  3AH1 A;  4GOV A;  4XFU A;  1II4 A;  2KH2 A;  3BAQ A;  4I6I A;  1M2T B;  1N4K A;  3HOM A;  5F8S A;  2ZQN A;  2X2S A;  2BEB A;  4IZE A;  1PWA A;  3FJF A;  4HR6 C;  3RSJ A;  3WMV A;  2NVH A;  4AN6 A;  3MAL A;  1JY0 A;  1JT3 A;  3QR5 A;  3R4S A;  1T9F A;  3A07 A;  3ZC8 A;  3RTJ B;  3UD7 A;  1K5V A;  1S0E A;  3Q7W A;  3CA0 A;  3LTQ A;  3Q7Y A;  2Y9W C;  4G6M A;  2NP0 A;  4OWK A;  5DUY A;  4JQ0 A;  4END A;  4ZOT A;  3ZJX A;  1CE7 B;  1JQZ A;  4OW4 A;  4A7Y A;  4I8M A;  4LO2 C;  4DEP A;  4P0J A;  2KKI A;  4QO3 A;  3NBE A;  2NS2 A;  3POK A;  2D44 A;  3N7L A;  4I4O A;  1HWP B;  2J3P A;  2AXM A;  4D0T A;  1OQL B;  31BI A;  1G9D A;  3VUO A;  2BFH A;  1SZ6 B;  1V6X A;  3H6R B;  3FJD A;  3I2A A;  5D63 A;  1AVA C;  2HZ9 A;  5I1B A;  4I96 A;  4JKQ A;  9ILB A;  4XFS A;  1W3A A;  4I4S A;  3AJ6 A;  3BAV A;  1Z4S A;  4LO0 A;  4KEJ A;  3W9T A;  3D7W B;  3ILA A;  1TTU A;  4Q9G A;  2MC2 A;  5FNW A;  4GP0 A;  1BFB A;  5BP5 A;  1BAR A;  4II0 A;  1IHK A;  3NJ5 A;  3NBN A;  3UJ4 A;  1IT0 A;  2DRE A;  5G00 A;  3VWC A;  1ISV A;  2ESU A;  3VT2 A;  4ZFW B;  4I1E A;  3CA4 A;  3FJ8 A;  4QD2 B;  2ERM A;  4OWL A;  4A7K A;  5EC5 A;  2VUA A;  3O4B A;  1KNM A;  4X38 A;  4DCK C;  1WBA A;  3BX1 C;  3O4A A;  5D62 A;  4ZGR B;  2D7R A;  3O4O A;  4LO0 C;  1JLX A;  1TWE A;  4QBC A;  1ILR 1;  3RTI B;  2M49 A;  4IQP A;  5BXP A;  3BRG C;  1G9A A;  5EHA A;  1BFG A;  3FGM A;  1TP0 A;  4KEI A;  1ISW A;  3C0M A;  3ZXG A;  1W3G A;  1Z52 A;  3CA6 A;  4ZKT B;  3C0O A;  4G9M A;  4JPZ A;  4JP0 A;  5BP5 C;  4QAL A;  1WBC A;  3V0B B;  1VCL A;  1XZZ A;  3VSF A;  3A23 A;  4X3A A;  3T8S A;  3MPP G;  1I1B A;  1K5U A;  2R9K B;  4F34 A;  5FNX A;  4ZFY B;  5JLV A;  1AF9 A;  4LO1 A;  4MZH A;  2FFV A;  1S0C A;  4I7I A;  1S0B A;  2D24 A;  4F83 A;  2YUG A;  3FJI A;  4OEF A;  3Q7X A;  5BXS A;  2FGF A;  4QKS A;  4LO8 B;  3ZXD A;  3BAG A;  3KMV A;  2NTD A;  4TLP A;  3JRR A;  4Z9W B;  3O44 A;  3HAL A;  1TWM A;  1HWM B;  2IWT B;  3IM5 A;  3FJH A;  1A8D A;  2AFG A;  1AVX B;  1ISY A;  2K43 A;  3AZV A;  3O4C A;  2MLL B;  4OEG A;  3NBC A;  4P0K A;  1AXM A;  1XYF A;  3UDA A;  3N0K A;  1RML A;  4OUJ A;  3RMX A;  1BFC A;  3RMY A;  1RZO B;  1TIE A;  1Q04 A;  4I4R A;  4Q9P A;  2VSA A;  2GZB A;  4I1B A;  2HWA A;  1BAS A;  1DJS B;  1FMZ A;  3AKG A;  3HSM A;  4JAW A;  1V6V A;  4LO1 C;  4OEE A;  3V0A B;  5F90 A;  1S0D A;  1FQ9 A;  1DFC A;  2KI6 B;  2AQZ A;  2NYY A;  1BA7 A;  2GO2 A;  1FWU A;  4J2S A;  3FJA A;  3AZW A;  2L5X A;  3UJ0 A;  3V79 C;  1JT4 A;  1HWO B;  1PC8 B;  3PUB A;  3ZX7 A;  1V6U A;  1YBI A;  3FJC A;  4EFR A;  3F1R A;  3ZC9 A;  3PHZ A;  4UY4 A;  2I1B A;  4IY8 A;  3A21 A;  4HJJ A;  5F8W A;  2FDB M;  2Z48 A;  4I2S A;  2VSE A;  3I2X A;  3P6I A;  1YTO A;  4JKX B;  4EKX B;  3WO4 A;  1PUM B;  4L4H A;  3PME A;  4USO A;  3WO3 A;  3N7K A;  3QYD A;  2F8X C;  1EYL A;  2DRZ A;  3S8J A;  1TOO A;  2AAI B;  4KEK A;  3PG0 A;  3HMY A;  4EFQ A;  1HCE A;  4IYB A;  3OJM A;  1V6W A;  2P23 A;  1SR4 A;  2D22 A;  3H6S E;  4H9W A;  1EV2 A;  1QQL A;  1FN0 A;  4GAI A;  2FO1 A;  5E24 E;  1YF8 B;  1P63 A;  5D61 A;  2XOA A;  4Q91 A;  1DZD A;  5DZU A;  1FMM S;  4ISR A;  3SNV A;  1IRA X;  3BAU A;  4OWJ A;  3CA5 A;  1BLA A;  3CQA A;  1FWV A;  1XHB A;  2RQ9 A;  3OGF A;  3VT1 A;  2D20 A;  2D7I A;  4QKR A;  3WMU A;  4EEE B;  1G9B A;  1TFM B;  1E0O A;  1ISX A;  2HWM A;  5BXT A;  4LO7 C;  5BQU A;  2KI4 A;  2K8R A;  1Q1U A;  2KLL A;  2VLC A;  3AKH A;  2QN4 A;  3OBR A;  1S0F A;  3WIN A;  1HIB A;  2ZR1 B;  1WD3 A;  1IJT A;  4EB2 B;  1PRE A;  4HA2 A;  1SR4 C;  3HN1 A;  3CRI A;  4ZLB B;  21BI A;  1HKN A;  3FJE A;  3BRF A;  3E8L C;  5FZU A;  2K4A B;  4IZX A;  4ZBV B;  4J23 B;  3AKI A;  2D1Z A;  5B2H A;  1DLL A;  3OBT A;  4H75 A;  3IAG C;  4PC4 A;  5BVP I;  2VU9 A;  1FGA A;  3AJ5 A;  5GAQ A;  3N7J A;  4X39 A;  1G9C A;  3WA1 A;  1M16 A;  2DS0 A;  1Q03 A;  3BAH A;  5BQU C;  3I29 B;  2Y9X E;  2IHO A;  4L4I A;  4I4Q A;  5F8Y A;  4MZF B;  4AN7 B;  4I3N A;  4MZG B;  3WIN C;  1IOB A;  3BRD A;  3CRH A;  3FJK A;  3UD9 A;  3VT0 A;  1DQG A;  3R4U A;  8I1B A;  1L2H A;  5EG6 C;  3LLP A;  4J2K A;  4P6A A;  1EPW A;  4EFP A;  2ET2 A;  1I1E A;  4DEN A;  2NZ9 A;  1DQO A;  3FJJ A;  1XG6 A;  2E4M A;  3P53 A;  4QBV A;  1QXM A;  4I4P A;  3IIR A;  3BB2 A;  1G82 A;  4FGF A;  5BXR A;  4USP A;  2D42 A;  3CAH A;  1RY7 A;  4FVV A;  3FJB A;  3HBW A;  2WRY A;  4GOY A;  4KBB A;  1UYJ A;  2WBC A;  3IM6 A;  6I1B A;  1ABR B;  3BA5 A;  4IHZ A;  3VEQ A;  4D8H A;  1S0G A;  2LIQ A;  1UPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...