1W3UA

Crystal structure of phosphoserine aminotransferase from bacillus circulans var. alkalophilus
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
360
structure length
360
Chain Sequence
b'ERAYNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMSHRGAVYEAVHNEAQARLLALLGNPTGYKVLFIQGGASTQFAMIPMNFLKEGQTANYVMTGSWASKALKEAKLIGDTHVAASSEASNYMTLPKLQEIQLQDNAAYLHLTSNETIEGAQFKAFPDTGSVPLIGDMSSDILSRPFDLNQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKHLPTMLRYDTYVKNNSLYNTPPSFGIYMVNEVLKWIEERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCVDVDSRSDMNITFRLASEELEKEFVKASEQEGFVGLKGHRSVGGLRASIYNAVPYESCEALVQFMEHFKRSRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Enzyme Adaptation to Alkaline Ph: Atomic Resolution (1.08 A) Structure of Phosphoserine Aminotransferase from Bacillus Alcalophilus
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Transferase
total genus 121
structure length 360
sequence length 360
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2004-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1w3uA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1w3uA02
2Z1ZA 2EGYA 5EUEA 4HVKA 1QJ3A 1CQ7A 3WGBA 1WYVB 5FT8A 4OT8A 2CJHA 1AMAA 4JEXA 1MDZA 3GETA 3MBBA 5F9SA 1YJYA 4Y0IA 1BQAA 2VGTA 1TOKA 3MC6A 2YHKA 2D7YA 3JWBA 1QIRA 3L44A 3MAFB 1M32A 3NYUA 1MDOA 1QZ9A 4JE5D 1PG8A 1AHGA 3VP6A 3WZFA 4ZM4A 1J04A 4ZWVA 2VMTA 2AY8A 1IVRA 1IBJA 1M0PA 4IYOA 4XJOA 1WYUA 3EUCA 3GWPA 5EAVA 3I5TA 4MKKA 5M46A 1GC0A 3KGXA 3Q8NA 1I41A 1SVVA 3LY1A 3HMUA 1LS3A 1KKJA 1V72A 5BJ4A 3DU4A 3AENA 8AATA 2OGAA 3B8XA 2DR1A 3K7YA 2FQ6A 3EZSA 2C7TA 1JS3A 1D7RA 1LC7A 1D7SA 2VIAA 1N2TA 2BWNA 2DKJA 1WYTA 2BIEA 2HP1A 1C0NA 2HORA 4TMRA 4XJMA 3FDDA 1ASGA 1B8GA 5EUDA 5G0AA 1PFFA 1S06A 2BI1A 1SPAA 3PAAA 5DJ9A 5E3KA 5FT6A 4A6TA 2CJGA 1PMMA 3EZ1A 1CZEA 1G4VA 2HOXA 1CL1A 1ASBA 1BJ4A 2JGTA 3N75A 3NDNA 3BN1A 3RCHB 3LVMA 3VK4A 4PIWA 1W7LA 4EMYA 2PO3A 4WXFA 2YRIA 2O0RA 3FDBA 4R8DA 1ARIA 2E7JA 3JU7A 3B1CA 1RVUA 2AY3A 3FZ6A 4MQRA 1X0MA 3IF2A 2Z9XA 1ASEA 3UWCA 2ZYJA 4A0HA 1KL2A 3W1HA 3WY7A 1WKGA 2O7CA 2JJGA 2W8WA 2W7FA 4OBUA 3JZLA 1MLYA 3I16A 1TARA 4AOAA 2ZC0A 5E4ZA 2CH1A 2EH6A 2Z1YA 4HF8A 1ASFA 1EJIA 2C0RA 2CANA 3E77A 4XK1A 4AZKA 4B98A 1IUGA 2D5YA 1C7GA 3F0HA 4F5HA 4WLJA 4WBTA 3GR9A 2JJHA 4IYOB 5EIGA 4AZJA 1WYUB 2CB1A 1AKCA 2CH2A 1GCKA 1FG3A 3BCAA 3PJ0A 2VGVA 4OCAA 4UHOA 1MLZA 1AICA 1S07A 3VK3A 5AX8A 4EB7A 2XH1A 4IXOA 5G4IA 4RKCA 3IHJA 1AIAA 3ACZA 4GDYA 1UU2A 2Z9UA 2VGWA 3QM2A 4WYFA 2D64A 4GE4A 1S09A 1PMOA 4A0RA 1AAMA 5JAYA 1GEYA 2X5DA 2EZ2A 1W23A 1WYTB 2W7DA 3PDBA 4F5LA 2GMSA 1CZCA 5M4DA 3CBFA 1B5OA 2W7GA 3A9ZA 4GSAA 3EIAA 1OXPA 3R9AA 1BKGA 1SF2A 3A8UX 4MSOA 5G2QA 3UAKA 2VMRA 5DB5A 2X3LA 1DGEA 2QBTA 3FCRA 3ZRQA 2VMXA 3RBLA 4JEWA 5LHAA 3FQ8A 1W3UA 3ATHA 2CY8A 2FN6A 3AEOA 5FT4A 4MQPA 3CQ4A 1OHWA 4ITXA 1SFFA 3AEJC 5M49A 1BJNA 2AY2A 2ZY2A 1MAQA 1JF9A 3NRAA 1BW0A 3LVJA 2BI9A 2OKJA 4RITA 1KMJA 2PB0A 2VMNA 3AV7A 3E9KA 1RV4A 3DC1A 1O69A 2DKBA 3AEJA 2W7KA 3JTXA 4P3MA 4W1WA 1AMSA 2CJDA 2VMPA 3B46A 4NOGA 1DGDA 1BT4A 2OATA 1CL2A 1QJ5A 1UU0A 3FTBA 3AELA 3QI6A 3RQ1A 1I48A 1DFOA 1ZODA 4BHDA 2ORDA 3BB8A 1ECXA 4EU1A 3BC8A 2VI9A 1YJZA 4RIZA 2JG2A 1AKBA 1I43A 4KYOA 4ZLVA 3VOMA 3BWNC 3QGUA 4WYEA 1JG8A 3ZRRA 1B9IA 2VGSA 4JEYA 4RM1A 1BJWA 2BI5A 2RFVA 4A0FA 1ASDA 1ASAA 2ZP7A 4JF1A 4A72A 4ZAHA 1N8PA 3NUIA 4K2BA 4F5MA 3NX3A 4RAEA 4UHMA 4IW7A 1V2EA 4GE7A 3G0TA 5I92A 1OHYA 3BWNA 3QN6A 3ZRPA 2HP2A 1IAXA 2YRRA 3PDBB 4O6ZA 1D7VA 2YKYA 4JEZA 2EZ1A 2BIAA 4Y0HA 5HHYA 2Z9WA 3L8AA 4IY7A 4AO9A 1GEXA 2Z67A 4L0OA 2BYLA 4XAUA 3FVUA 4ZSWA 4WP0A 2VMYA 1GC4A 3DR4A 4RJYA 4LNMA 3G7QA 1AIBA 3A9YA 2ZSMA 2ZY4A 3D6KA 3CQ5A 1AJRA 4R2NA 1KKPA 1TASA 1CQ6A 1AY4A 1OXOA 4ISYA 3W1JA 2GSAA 4WB0B 2ZY5A 3HL2A 1DJUA 5J8QA 3VK2A 2WK7A 1TPLA 4KAMA 5G2PA 1MDXA 3NU7A 4K2MA 3ELEA 1EQBA 4WD2A 3WGCA 3QHXA 3FQ7A 1U08A 3DRDA 3FZ8A 2DGKA 2FNUA 3QBOA 5D95A 4Y0DA 1H1CA 2Z61A 5HDMA 2W7EA 1RVYA 2VMSA 4Q75A 3HQTA 5DX5A 3A2BA 1ARSA 3E2YA 2R2NA 2YKXA 2AATA 2W7JA 1FG7A 5EQCA 3ASBA 1GDEA 2W7HA 1LW5A 2DOUA 1ZC9A 4W5KA 2Z9VA 4ADCA 4AH3A 1ELQA 3LVKA 4OYTA 2HOYA 4LW2A 3VAXA 3PPLA 2TPLA 1AHXA 4W1VA 9AATA 4AO4A 2OQXA 2CTZA 3BWOA 3FVSA 4J5UA 4F5KA 1OHVA 1CS1A 1M0NA 1DTYA 3JW9A 2OKKA 4GRXA 4IX8A 2HUUA 4OBVA 2YOBA 1XEYA 4ZASA 2AY7A 1ARGA 2VMQA 3BCXA 3A9XA 1X28A 2XBNA 3TQXA 3NUBA 4A0GA 2D7ZA 3HT4A 2ZJGA 3AENB 3MKJA 4KXKA 5FT5A 5G09A 4B9BA 4ZM3A 1GC2A 1XI9A 1YOOA 2WK9A 2VMUA 3LG0A 1D2FA 2D66A 1WKHA 3OP7A 3FZ7A 4ITGA 2Q7WA 3JWAA 3PIUA 1O61A 1ZOBA 4M2MA 1S0AA 4WYCA 5M4BA 2W8JA 2W7IA 1D7UA 3NTJA 1IX7A 2C44A 2EO5A 3ECDA 3K40A 2YCNA 3I4JA 2DGLA 1IAYA 2QLRA 3DR7A 2AY6A 2NMPA 1LC5A 3ASAA 1S08A 1T3IA 3FVXA 4CXRA 2OGEA 1C4KA 1M7YA 1O62A 3H7FA 3DODA 4WYDA 4A6UA 4F5JA 1AHYA 3HLMA 3GSBA 4ZDLA 1Z3ZA 1B5PA 1GC3A 3TCMA 1TOJA 1GD9A 2BYJA 2BI2A 2BWPA 1RV3A 1VP4A 4XQ2A 1UKJA 4MY5A 1X29A 4GEBA 2W8TA 3AEMC 4N0BA 1SZUA 3E6GA 3EI8A 1JS6A 2AY1A 2VMZA 4K2IA 1V2FA 1I29A 4I8AA 1GBNA 4RJ0A 1AKAA 2VMWA 3T32A 3R4TA 4LW4A 4M2KA 5C6UA 2GMUA 3LV2A 5EIGB 2JJFA 3AEMA 4DBCA 3HDOA 3ISLA 4XJPA 1AJSA 1KL1A 2FYFA 2BWOA 3UE8A 3LVLB 2ZY3A 3BS8A 1KMKA 2F8JA 1BQDA 4F5IA 3F9TA 1Y4IA 1H0CA 2R0TA 1B9HA 3NNKA 3WCNA 1AHEA 1IJIA 3FFRA 2X5FA 2VMVA 2W8UA 3HBXA 4M2JA 1SZKA 1DJEA 3GZDC 2W7MA 4ZDPA 2HUFA 1W7MA 4WXBA 4GE9A 2E7IA 3N5MA 2HUIA 1LW4A 4N0WA 1O4SA 4MGRA 2X8UA 4PFNA 3RI6A 4CBSA 3ZZKA 1CJ0A 3BV0A 2ZSLA 3G8MA 1M6SA 3ELPA 4WYAA 3MAUA 4ZSYA 4R5ZA 3GZDA 1ARTA 2YCTA 1AAWA 1ASLA 1TATA 3E2FA 3FD0A 4RKDA 2V0YA 3H14A 3KGWA 2V1PA 1V2DA 1G7XA 3COGA 4LNLA 2AEVA 3PDXA 1YJSA 2C81A 4JEVA 5LH9A 1LKCA 4EB5A 5TF5A 1BS0A 4BMKA 2EPJA 4H51A 4PVFA 2VLFA 3WKRA 2HOZA 1G4XA 1G7WA 2AY9A 3FKDA 4MKJA 1AY8A 4CBRA 4OTLA 4BQ0A 4XEWA 5DJ1A 4EFFA 2JISA 1ORDA 3CQ6A 3F6TA 1C7OA 3B1EA 2AY5A 2BHXA 2BI3A 4OMAA 1P3WA 3GBXA 1QGNA 4WLHA 4F4EA 2HZPA 1TOGA 2BKWA 2AEUA 3KE3A 2VLHA 2VYCA 4ZWMA 1AMRA 1FC4A 3NYTA 1BJOA 2JJEA 1AJSB 5EUNA 4TV7A 2D61A 3TATA 4UQVA 3P6KA 4IXSA 3AEPA 4J8LA 4XJLA 1Z7DA 2WK8A 1IX8A 2Z20A 4Q76A 1OATA 1QITA 1QISA 4OC9A 4W1XA 4CXQA 1DJ9A 4LC3A 4Q6RA 3WX9A 4IXZA 2D65A 2R5EA 3PD6A 3AATA 3USFA 3LWSA 2R5CA 1LK9A 2VGZA 2VGUA 1TOIA 4E1OA 4W8IA 1MAPA 1MGVA 1E5FA 2FM1A 3E2ZA 3EI9A 2DGMA 4LNJA 1ASMA 1W7NA 1YAAA 4U2HA 3ZZJA 2VI8A 2CFBA 3PA9A 5K8BA 4DQ6A 1AMQA 3B1DA 3FRKA 3P1TA 3FSLA 3NU8A 4UHNA 2E54A 4E77A 4JE5A 3RUYA 1C9CA 1YIYA 2GQNA 2PB2A 5BJ3A 1ARHA 1EG5A 2D63A 3TFUA 2O1BA 4P7YA 1E5EA 3AOWA 4R5FA 1YNUA 2QB2A 4TN4A 1WYVA 1X2AA 3HVYA 2W8VA 1WSTA 4F5FA 1DKAA 1C7NA 3RBFA 1ASCA 1YIZA 2QB3A 3MAFA 3M5UA 4W91A 1M0OA 3EIBA 2QMAA 4WYGA 3BCBA 4ADEA 2G6WA 3WLXA 3EI6A 3K28A 1M0QA 3KKIA 1IX6A 3QPGA 2CINA 2QA3A 1BJOB 3FQAA 3OKSA 4ADDA 4ADBA 1AX4A 3TFTA 2GB3A 5EAAA 1B4XA 4E3QA 4FL0A 2BIGA 5F8VA 1UU1A 5E5IA 1GEWA 4CVQA 1ASNA 3MEBA 4A00A 3NYSA 3CAIA 4FFCA 3WCOA 2YKUA 1SZSA 4MQQA 2CSTA 1AHFA 4BA5A 3MADA 3FFHA 1J32A 4UOYA 3GZCA 2YKVA 1ELUA 2ZUKA 1CQ8A 3DZZA 3DXWA 3EI5A 4E3RA 5IWQA 4WB0A 2FNIA 4ATPA 3PD6B 1TOEA 2WKAA 2R5CB 3DXVA 4QGRA 2W7LA 4RLGA 1VJOA 3W1IA 7AATA 2E7UA 3DYDA 4A6RA 4ATQA 3WKSA 5G4JA 4ZDOA 4PFFA 4U1TA 5HXXA 3E2ZB 5D5SA 2VMOA 4BA4A 1LC8A 1M4NA 2AY4A 2VIBA 3AOVA 3RCHA 4JF0A 3GJUA 1VEFA 4WXGA 4F5GA 3II0A 3N0LA 4Q31A 2YCPA 5EFSA 1N31A 4DGTA 3MC6C 1AY5A 3EI7A 3PGYA
chains in the Genus database with same CATH superfamily
2Z1ZA 3N4SA 2EGYA 5EUEA 4HVKA 1QJ3A 1CQ7A 3WGBA 1WYVB 5FT8A 4OT8A 2CJHA 1AMAA 4JEXA 1MDZA 3GETA 3MBBA 5F9SA 1YJYA 4Y0IA 1BQAA 2VGTA 1TOKA 3MC6A 2YHKA 2D7YA 3JWBA 1QIRA 3L44A 3MAFB 1M32A 3NYUA 1MDOA 1QZ9A 4JE5D 1PG8A 1AHGA 3VP6A 3WZFA 4ZM4A 1J04A 4ZWVA 2VMTA 2AY8A 1IVRA 1IBJA 1M0PA 4IYOA 4XJOA 1WYUA 3EUCA 3GWPA 5EAVA 3I5TA 4MKKA 5M46A 1GC0A 3KGXA 3Q8NA 1I41A 1SVVA 3LY1A 3HMUA 1LS3A 1KKJA 1V72A 5BJ4A 3DU4A 3AENA 8AATA 2OGAA 3B8XA 2DR1A 3K7YA 2FQ6A 3EZSA 2C7TA 1JS3A 1D7RA 1LC7A 1D7SA 2VIAA 1N2TA 2BWNA 2DKJA 1WYTA 2BIEA 2HP1A 1C0NA 2HORA 4TMRA 4XJMA 3FDDA 1ASGA 1B8GA 5EUDA 5G0AA 1PFFA 1S06A 2BI1A 1SPAA 3PAAA 5DJ9A 5E3KA 5FT6A 4A6TA 2CJGA 1PMMA 3EZ1A 1CZEA 1G4VA 2HOXA 1CL1A 1ASBA 1BJ4A 2JGTA 3N75A 3NDNA 3BN1A 3RCHB 3LVMA 3VK4A 4PIWA 1W7LA 4EMYA 2PO3A 4WXFA 2YRIA 2O0RA 3FDBA 4R8DA 1ARIA 2E7JA 3JU7A 3B1CA 1RVUA 2G7JA 2AY3A 3FZ6A 4MQRA 1X0MA 3IF2A 2Z9XA 1ASEA 3UWCA 2ZYJA 4A0HA 1KL2A 3W1HA 3WY7A 1WKGA 2O7CA 2JJGA 2W8WA 2W7FA 4OBUA 3JZLA 1MLYA 3I16A 1TARA 4AOAA 2ZC0A 5E4ZA 2CH1A 2EH6A 2Z1YA 4HF8A 1ASFA 1EJIA 2C0RA 2CANA 3E77A 4XK1A 4AZKA 4B98A 1IUGA 2D5YA 1C7GA 3F0HA 4F5HA 3N4XA 3N7NA 4WLJA 4WBTA 3GR9A 2JJHA 4IYOB 5EIGA 4AZJA 1WYUB 2CB1A 1AKCA 2CH2A 1GCKA 1FG3A 3BCAA 3PJ0A 2VGVA 4OCAA 4UHOA 1MLZA 1AICA 1S07A 3VK3A 5AX8A 4EB7A 2XH1A 4IXOA 5G4IA 4RKCA 3IHJA 1AIAA 3ACZA 4GDYA 1UU2A 2Z9UA 2VGWA 3QM2A 4WYFA 2D64A 4GE4A 1S09A 1PMOA 4A0RA 1AAMA 5JAYA 1GEYA 2X5DA 2EZ2A 1W23A 1WYTB 2W7DA 3PDBA 4F5LA 2GMSA 1CZCA 5M4DA 3CBFA 1B5OA 2W7GA 3A9ZA 4GSAA 3EIAA 1OXPA 3R9AA 1BKGA 1SF2A 3A8UX 4MSOA 5G2QA 3UAKA 2VMRA 5DB5A 2X3LA 1DGEA 2QBTA 3FCRA 3ZRQA 2VMXA 3RBLA 4JEWA 5LHAA 3FQ8A 1W3UA 3ATHA 2CY8A 2FN6A 3AEOA 5FT4A 4MQPA 3CQ4A 1OHWA 4ITXA 1SFFA 3AEJC 5M49A 1BJNA 2AY2A 2ZY2A 1MAQA 1JF9A 3NRAA 1BW0A 3LVJA 2BI9A 2OKJA 4RITA 4H63Q 1KMJA 2PB0A 2VMNA 3AV7A 2KFPA 3E9KA 1RV4A 3DC1A 1O69A 2DKBA 3AEJA 2W7KA 3JTXA 4P3MA 4W1WA 1AMSA 2CJDA 2VMPA 3B46A 4NOGA 1DGDA 1BT4A 2OATA 1CL2A 1QJ5A 1UU0A 3FTBA 3AELA 3QI6A 3RQ1A 1I48A 1DFOA 1ZODA 4BHDA 2ORDA 3BB8A 1ECXA 4EU1A 3BC8A 2VI9A 1YJZA 4RIZA 2JG2A 1AKBA 1I43A 4KYOA 4ZLVA 3VOMA 3BWNC 3QGUA 4WYEA 1JG8A 3ZRRA 1B9IA 2VGSA 4JEYA 4RM1A 1BJWA 2BI5A 2RFVA 4A0FA 1ASDA 1ASAA 2ZP7A 4JF1A 4A72A 4ZAHA 1N8PA 3NUIA 4K2BA 4F5MA 3NX3A 4RAEA 4UHMA 4IW7A 1V2EA 4GE7A 3G0TA 5I92A 1OHYA 3BWNA 3QN6A 3ZRPA 2HP2A 1IAXA 2YRRA 3PDBB 4O6ZA 1D7VA 2YKYA 4JEZA 1KAFA 2EZ1A 2BIAA 4Y0HA 5HHYA 2Z9WA 3L8AA 4IY7A 4AO9A 1GEXA 2Z67A 4L0OA 2BYLA 4XAUA 3FVUA 4ZSWA 4WP0A 2VMYA 1GC4A 3DR4A 4RJYA 4LNMA 3G7QA 1AIBA 3A9YA 2ZSMA 2ZY4A 3D6KA 3CQ5A 1AJRA 4R2NA 1KKPA 1TASA 1CQ6A 1AY4A 1OXOA 4ISYA 2FKIA 3W1JA 2GSAA 4WB0B 2ZY5A 3HL2A 1DJUA 5J8QA 3VK2A 2WK7A 1TPLA 4KAMA 5G2PA 1MDXA 3NU7A 4K2MA 3ELEA 1EQBA 4WD2A 3WGCA 3QHXA 3FQ7A 1U08A 3DRDA 3FZ8A 2DGKA 2FNUA 3QBOA 5D95A 4Y0DA 1H1CA 2Z61A 5HDMA 2W7EA 1RVYA 2VMSA 4Q75A 2EYQA 3HQTA 5DX5A 3A2BA 1ARSA 3E2YA 2R2NA 2YKXA 2AATA 2W7JA 1FG7A 5EQCA 3ASBA 1GDEA 2W7HA 1LW5A 2DOUA 1ZC9A 4W5KA 2Z9VA 4ADCA 4AH3A 1ELQA 3LVKA 4OYTA 2HOYA 4LW2A 3VAXA 3PPLA 2TPLA 1AHXA 4W1VA 9AATA 4AO4A 2OQXA 2CTZA 3BWOA 3FVSA 4J5UA 4F5KA 1OHVA 1CS1A 1M0NA 1DTYA 3JW9A 2OKKA 4GRXA 4IX8A 2HUUA 4OBVA 2YOBA 1XEYA 4ZASA 2AY7A 1ARGA 2VMQA 3BCXA 3A9XA 1X28A 2XBNA 3TQXA 3NUBA 4A0GA 2D7ZA 3HT4A 2ZJGA 3AENB 3MKJA 4KXKA 5FT5A 5G09A 4B9BA 4ZM3A 1GC2A 1XI9A 1YOOA 2WK9A 2VMUA 3LG0A 1D2FA 2D66A 1WKHA 3OP7A 3FZ7A 4ITGA 2Q7WA 3JWAA 3PIUA 1O61A 1ZOBA 4M2MA 1S0AA 4WYCA 5M4BA 2W8JA 2W7IA 1D7UA 3NTJA 1IX7A 2C44A 2EO5A 3ECDA 3K40A 2YCNA 3I4JA 2DGLA 1IAYA 2QLRA 3DR7A 2AY6A 2NMPA 1LC5A 3ASAA 1S08A 1T3IA 3FVXA 4CXRA 2OGEA 1C4KA 1M7YA 1O62A 3H7FA 3DODA 4WYDA 4A6UA 4F5JA 1AHYA 5KTBA 3HLMA 3GSBA 4ZDLA 1Z3ZA 1B5PA 1GC3A 3TCMA 1TOJA 1GD9A 2BYJA 2BI2A 2BWPA 1RV3A 1VP4A 4XQ2A 1UKJA 4MY5A 1X29A 4GEBA 2W8TA 3AEMC 4N0BA 1SZUA 3E6GA 3EI8A 1JS6A 2AY1A 2VMZA 4K2IA 1V2FA 1I29A 4I8AA 1GBNA 4RJ0A 1AKAA 2VMWA 3T32A 3R4TA 4LW4A 4M2KA 5C6UA 2GMUA 3LV2A 5EIGB 2JJFA 3AEMA 4DBCA 3HDOA 3ISLA 4XJPA 1AJSA 1KL1A 2FYFA 2BWOA 3UE8A 3LVLB 2ZY3A 3BS8A 1KMKA 2F8JA 1BQDA 4F5IA 3F9TA 1Y4IA 1H0CA 2R0TA 1B9HA 3NNKA 3WCNA 1AHEA 1IJIA 3FFRA 2X5FA 3H9XA 2VMVA 2W8UA 3HBXA 4M2JA 1SZKA 1DJEA 3GZDC 2W7MA 4ZDPA 2HUFA 1W7MA 4WXBA 4GE9A 2E7IA 3N5MA 2HUIA 1LW4A 4N0WA 1O4SA 4MGRA 2X8UA 4PFNA 3RI6A 4CBSA 3ZZKA 1CJ0A 3BV0A 2ZSLA 3G8MA 1M6SA 3ELPA 4WYAA 3MAUA 4ZSYA 4R5ZA 3GZDA 1ARTA 2YCTA 1AAWA 1ASLA 1TATA 3E2FA 3FD0A 4RKDA 2V0YA 3H14A 3KGWA 2V1PA 1V2DA 1G7XA 3COGA 4LNLA 2AEVA 3PDXA 1YJSA 2C81A 4JEVA 5LH9A 1LKCA 4EB5A 5TF5A 1BS0A 4BMKA 2EPJA 4H51A 4PVFA 2VLFA 3WKRA 2HOZA 1G4XA 1G7WA 2AY9A 3FKDA 4MKJA 1AY8A 4CBRA 4OTLA 4BQ0A 4XEWA 5DJ1A 4EFFA 2JISA 1ORDA 3CQ6A 3F6TA 1C7OA 3B1EA 2AY5A 2BHXA 2BI3A 4OMAA 1P3WA 3GBXA 1QGNA 4WLHA 4F4EA 2HZPA 1TOGA 2BKWA 2AEUA 3KE3A 2VLHA 2VYCA 4ZWMA 1AMRA 1FC4A 3NYTA 1BJOA 2JJEA 1AJSB 5EUNA 4TV7A 2D61A 3TATA 4UQVA 4K05A 3P6KA 4IXSA 3AEPA 4J8LA 4XJLA 1Z7DA 2WK8A 1IX8A 2Z20A 4Q76A 1OATA 1QITA 1QISA 4OC9A 2WB6A 4W1XA 4CXQA 1DJ9A 4LC3A 4Q6RA 3WX9A 4IXZA 2D65A 2R5EA 3PD6A 3AATA 3USFA 3LWSA 2R5CA 1LK9A 2VGZA 2VGUA 1TOIA 4E1OA 4W8IA 1MAPA 1MGVA 1E5FA 2FM1A 3E2ZA 3EI9A 2DGMA 4LNJA 1ASMA 1W7NA 1YAAA 4U2HA 3ZZJA 2VI8A 2CFBA 3PA9A 5K8BA 4DQ6A 1AMQA 3B1DA 3FRKA 3P1TA 3FSLA 3NU8A 4UHNA 2E54A 4E77A 4JE5A 3RUYA 1C9CA 1YIYA 2GQNA 2PB2A 5BJ3A 1ARHA 1EG5A 2D63A 3TFUA 2O1BA 4P7YA 1E5EA 3AOWA 4R5FA 1YNUA 2QB2A 4TN4A 1WYVA 1X2AA 3HVYA 2W8VA 1WSTA 4F5FA 1DKAA 1C7NA 3RBFA 1ASCA 1YIZA 2QB3A 3MAFA 3M5UA 4W91A 1M0OA 3EIBA 2QMAA 4WYGA 3BCBA 4ADEA 2G6WA 3WLXA 3EI6A 3K28A 1M0QA 3KKIA 1IX6A 3QPGA 2CINA 2QA3A 1BJOB 3FQAA 3OKSA 4ADDA 4ADBA 1AX4A 3TFTA 2GB3A 5EAAA 1B4XA 4E3QA 4FL0A 2BIGA 5F8VA 1UU1A 5E5IA 1GEWA 4CVQA 1ASNA 3MEBA 4A00A 3NYSA 3CAIA 4FFCA 3WCOA 2YKUA 1SZSA 4MQQA 3N4RA 2CSTA 1AHFA 4BA5A 3MADA 3FFHA 1J32A 4UOYA 3GZCA 2YKVA 1ELUA 2ZUKA 1CQ8A 3DZZA 3DXWA 3EI5A 4E3RA 5IWQA 4WB0A 2A1VA 2FNIA 4ATPA 3PD6B 1TOEA 2WKAA 2R5CB 3DXVA 4QGRA 2W7LA 4RLGA 1VJOA 3W1IA 7AATA 2E7UA 3DYDA 4A6RA 4ATQA 3WKSA 5G4JA 4ZDOA 4PFFA 4U1TA 5HXXA 3E2ZB 5D5SA 2VMOA 4BA4A 1LC8A 1M4NA 2AY4A 2VIBA 3AOVA 3RCHA 4JF0A 3GJUA 1VEFA 4WXGA 4F5GA 2QSRA 3II0A 3N0LA 4Q31A 2YCPA 5EFSA 1N31A 4DGTA 3MC6C 1AY5A 3EI7A 3PGYA
chains in the Genus database with same CATH topology
2Z1ZA 3N4SA 2EGYA 5EUEA 4HVKA 1QJ3A 1CQ7A 3WGBA 1WYVB 5FT8A 4OT8A 2CJHA 1AMAA 4JEXA 1MDZA 3GETA 3MBBA 5F9SA 1YJYA 4Y0IA 1BQAA 2VGTA 1TOKA 3MC6A 2YHKA 2D7YA 3JWBA 1QIRA 3L44A 3MAFB 1M32A 3NYUA 1MDOA 1QZ9A 4JE5D 1PG8A 1AHGA 3VP6A 3WZFA 4ZM4A 1J04A 4ZWVA 2VMTA 2AY8A 1IVRA 1IBJA 1M0PA 4IYOA 4XJOA 1WYUA 3EUCA 3GWPA 5EAVA 3I5TA 4MKKA 5M46A 1GC0A 3KGXA 3Q8NA 1I41A 1SVVA 3LY1A 3HMUA 1LS3A 1KKJA 1V72A 5BJ4A 3DU4A 3AENA 8AATA 2OGAA 3B8XA 2DR1A 3K7YA 2FQ6A 3EZSA 2C7TA 1JS3A 1D7RA 1LC7A 1D7SA 2VIAA 1N2TA 2BWNA 2DKJA 1WYTA 2BIEA 2HP1A 1C0NA 2HORA 4TMRA 4XJMA 3FDDA 1ASGA 1B8GA 5EUDA 5G0AA 1PFFA 1S06A 2BI1A 1SPAA 3PAAA 5DJ9A 5E3KA 5FT6A 4A6TA 2CJGA 1PMMA 3EZ1A 1CZEA 1G4VA 2HOXA 1CL1A 1ASBA 1BJ4A 2JGTA 3N75A 3NDNA 3BN1A 3RCHB 3LVMA 3VK4A 4PIWA 1W7LA 4EMYA 2PO3A 4WXFA 2YRIA 2O0RA 3FDBA 4R8DA 1ARIA 2E7JA 3JU7A 3B1CA 1RVUA 2G7JA 2AY3A 3FZ6A 4MQRA 1X0MA 3IF2A 2Z9XA 1ASEA 3UWCA 2ZYJA 4A0HA 1KL2A 3W1HA 3WY7A 1WKGA 2O7CA 2JJGA 2W8WA 2W7FA 4OBUA 3JZLA 1MLYA 3I16A 1TARA 4AOAA 2ZC0A 5E4ZA 2CH1A 2EH6A 2Z1YA 4HF8A 1ASFA 1EJIA 2C0RA 2CANA 3E77A 4XK1A 4AZKA 4B98A 1IUGA 2D5YA 1C7GA 3F0HA 4F5HA 3N4XA 3N7NA 4WLJA 4WBTA 3GR9A 2JJHA 4IYOB 5EIGA 4AZJA 1WYUB 2CB1A 1AKCA 2CH2A 1GCKA 1FG3A 3BCAA 3PJ0A 2VGVA 4OCAA 4UHOA 1MLZA 1AICA 1S07A 3VK3A 5AX8A 4EB7A 2XH1A 4IXOA 5G4IA 4RKCA 3IHJA 1AIAA 3ACZA 4GDYA 1UU2A 2Z9UA 2VGWA 3QM2A 4WYFA 2D64A 4GE4A 1S09A 1PMOA 4A0RA 1AAMA 5JAYA 1GEYA 2X5DA 2EZ2A 1W23A 1WYTB 2W7DA 3PDBA 4F5LA 2GMSA 1CZCA 5M4DA 3CBFA 1B5OA 2W7GA 3A9ZA 4GSAA 3EIAA 1OXPA 3R9AA 1BKGA 1SF2A 3A8UX 4MSOA 5G2QA 3UAKA 2VMRA 5DB5A 2X3LA 1DGEA 2QBTA 3FCRA 3ZRQA 2VMXA 3RBLA 4JEWA 5LHAA 3FQ8A 1W3UA 3ATHA 2CY8A 2FN6A 3AEOA 5FT4A 4MQPA 3CQ4A 1OHWA 4ITXA 1SFFA 3AEJC 5M49A 1BJNA 2AY2A 2ZY2A 1MAQA 1JF9A 3NRAA 1BW0A 3LVJA 2BI9A 2OKJA 4RITA 4H63Q 1KMJA 2PB0A 2VMNA 3AV7A 2KFPA 3E9KA 1RV4A 3DC1A 1O69A 2DKBA 3AEJA 2W7KA 3JTXA 4P3MA 4W1WA 1AMSA 2CJDA 2VMPA 3B46A 4NOGA 1DGDA 1BT4A 2OATA 1CL2A 1QJ5A 1UU0A 3FTBA 3AELA 3QI6A 3RQ1A 1I48A 1DFOA 1ZODA 4BHDA 2ORDA 3BB8A 1ECXA 4EU1A 3BC8A 2VI9A 1YJZA 4RIZA 2JG2A 1AKBA 1I43A 4KYOA 4ZLVA 3VOMA 3BWNC 3QGUA 4WYEA 1JG8A 3ZRRA 1B9IA 2VGSA 4JEYA 4RM1A 1BJWA 2BI5A 2RFVA 4A0FA 1ASDA 1ASAA 2ZP7A 4JF1A 4A72A 4ZAHA 1N8PA 3NUIA 4K2BA 4F5MA 3NX3A 4RAEA 4UHMA 4IW7A 1V2EA 4GE7A 3G0TA 5I92A 1OHYA 3BWNA 3QN6A 3ZRPA 2HP2A 1IAXA 2YRRA 3PDBB 4O6ZA 1D7VA 2YKYA 4JEZA 2EZ1A 2BIAA 4Y0HA 5HHYA 2Z9WA 3L8AA 4IY7A 4AO9A 1GEXA 2Z67A 4L0OA 2BYLA 4XAUA 3FVUA 4ZSWA 4WP0A 2VMYA 1GC4A 3DR4A 4RJYA 4LNMA 3G7QA 1AIBA 3A9YA 2ZSMA 2ZY4A 3D6KA 3CQ5A 1AJRA 4R2NA 1KKPA 1TASA 1CQ6A 1AY4A 1OXOA 4ISYA 2FKIA 3W1JA 2GSAA 4WB0B 2ZY5A 3HL2A 1DJUA 5J8QA 3VK2A 2WK7A 1TPLA 4KAMA 5G2PA 1MDXA 3NU7A 4K2MA 3ELEA 1EQBA 4WD2A 3WGCA 3QHXA 3FQ7A 1U08A 3DRDA 3FZ8A 2DGKA 2FNUA 3QBOA 5D95A 4Y0DA 1H1CA 2Z61A 5HDMA 2W7EA 1RVYA 2VMSA 4Q75A 2EYQA 3HQTA 5DX5A 3A2BA 1ARSA 3E2YA 2R2NA 2YKXA 2AATA 2W7JA 1FG7A 5EQCA 3ASBA 1GDEA 2W7HA 1LW5A 2DOUA 1ZC9A 4W5KA 2Z9VA 4ADCA 4AH3A 1ELQA 3LVKA 4OYTA 2HOYA 4LW2A 3VAXA 3PPLA 2TPLA 1AHXA 4W1VA 9AATA 4AO4A 2OQXA 2CTZA 3BWOA 3FVSA 4J5UA 4F5KA 1OHVA 1CS1A 1M0NA 1DTYA 3JW9A 2OKKA 4GRXA 4IX8A 2HUUA 4OBVA 2YOBA 1XEYA 4ZASA 2AY7A 1ARGA 2VMQA 3BCXA 3A9XA 1X28A 2XBNA 3TQXA 3NUBA 4A0GA 2D7ZA 3HT4A 2ZJGA 3AENB 3MKJA 4KXKA 5FT5A 5G09A 4B9BA 4ZM3A 1GC2A 1XI9A 1YOOA 2WK9A 2VMUA 3LG0A 1D2FA 2D66A 1WKHA 3OP7A 3FZ7A 4ITGA 2Q7WA 3JWAA 3PIUA 1O61A 1ZOBA 4M2MA 1S0AA 4WYCA 5M4BA 2W8JA 2W7IA 1D7UA 3NTJA 1IX7A 2C44A 2EO5A 3ECDA 3K40A 2YCNA 3I4JA 2DGLA 1IAYA 2QLRA 3DR7A 2AY6A 2NMPA 1LC5A 3ASAA 1S08A 1T3IA 3FVXA 4CXRA 2OGEA 1C4KA 1M7YA 1O62A 3H7FA 3DODA 4WYDA 4A6UA 4F5JA 1AHYA 5KTBA 3HLMA 3GSBA 4ZDLA 1Z3ZA 1B5PA 1GC3A 3TCMA 1TOJA 1GD9A 2BYJA 2BI2A 2BWPA 1RV3A 1VP4A 4XQ2A 1UKJA 4MY5A 1X29A 4GEBA 2W8TA 3AEMC 4N0BA 1SZUA 3E6GA 3EI8A 1JS6A 2AY1A 2VMZA 4K2IA 1V2FA 1I29A 4I8AA 1GBNA 4RJ0A 1AKAA 2VMWA 3T32A 3R4TA 4LW4A 4M2KA 5C6UA 2GMUA 3LV2A 5EIGB 2JJFA 3AEMA 4DBCA 3HDOA 3ISLA 4XJPA 1AJSA 1KL1A 2FYFA 2BWOA 3UE8A 3LVLB 2ZY3A 3BS8A 1KMKA 2F8JA 1BQDA 4F5IA 3F9TA 1Y4IA 1H0CA 2R0TA 1B9HA 3NNKA 3WCNA 1AHEA 1IJIA 3FFRA 2X5FA 3H9XA 2VMVA 2W8UA 3HBXA 4M2JA 1SZKA 1DJEA 3GZDC 2W7MA 4ZDPA 2HUFA 1W7MA 4WXBA 4GE9A 2E7IA 3N5MA 2HUIA 1LW4A 4N0WA 1O4SA 4MGRA 2X8UA 4PFNA 3RI6A 4CBSA 3ZZKA 1CJ0A 3BV0A 2ZSLA 3G8MA 1M6SA 3ELPA 4WYAA 3MAUA 4ZSYA 4R5ZA 3GZDA 1ARTA 2YCTA 1AAWA 1ASLA 1TATA 3E2FA 3FD0A 4RKDA 2V0YA 3H14A 3KGWA 2V1PA 1V2DA 1G7XA 3COGA 4LNLA 2AEVA 3PDXA 1YJSA 2C81A 4JEVA 5LH9A 1LKCA 4EB5A 5TF5A 1BS0A 4BMKA 2EPJA 4H51A 4PVFA 2VLFA 3WKRA 2HOZA 1G4XA 1G7WA 2AY9A 3FKDA 4MKJA 1AY8A 4CBRA 4OTLA 4BQ0A 4XEWA 5DJ1A 4EFFA 2JISA 1ORDA 3CQ6A 3F6TA 1C7OA 3B1EA 2AY5A 2BHXA 2BI3A 4OMAA 1P3WA 3GBXA 1QGNA 4WLHA 4F4EA 2HZPA 1TOGA 2BKWA 2AEUA 3KE3A 2VLHA 2VYCA 4ZWMA 1AMRA 1FC4A 3NYTA 1BJOA 2JJEA 1AJSB 5EUNA 4TV7A 2D61A 3TATA 4UQVA 4K05A 3P6KA 4IXSA 3AEPA 4J8LA 4XJLA 1Z7DA 2WK8A 1IX8A 2Z20A 4Q76A 1OATA 1QITA 1QISA 4OC9A 2WB6A 4W1XA 4CXQA 1DJ9A 4LC3A 4Q6RA 3WX9A 4IXZA 2D65A 2R5EA 3PD6A 3AATA 3USFA 3LWSA 2R5CA 1LK9A 2VGZA 2VGUA 1TOIA 4E1OA 4W8IA 1MAPA 1MGVA 1E5FA 2FM1A 3E2ZA 3EI9A 2DGMA 4LNJA 1ASMA 1W7NA 1YAAA 4U2HA 3ZZJA 2VI8A 2CFBA 3PA9A 5K8BA 4DQ6A 1AMQA 3B1DA 3FRKA 3P1TA 3FSLA 3NU8A 4UHNA 2E54A 4E77A 4JE5A 3RUYA 1C9CA 1YIYA 2GQNA 2PB2A 5BJ3A 1ARHA 1EG5A 2D63A 3TFUA 2O1BA 4P7YA 1E5EA 3AOWA 4R5FA 1YNUA 2QB2A 4TN4A 1WYVA 1X2AA 3HVYA 2W8VA 1WSTA 4F5FA 1DKAA 1C7NA 3RBFA 1ASCA 1YIZA 2QB3A 3MAFA 3M5UA 4W91A 1M0OA 3EIBA 2QMAA 4WYGA 3BCBA 4ADEA 2G6WA 3WLXA 3EI6A 3K28A 1M0QA 3KKIA 1IX6A 3QPGA 2CINA 2QA3A 1BJOB 3FQAA 3OKSA 4ADDA 4ADBA 1AX4A 3TFTA 2GB3A 5EAAA 1B4XA 4E3QA 4FL0A 2BIGA 5F8VA 1UU1A 5E5IA 1GEWA 4CVQA 1ASNA 3MEBA 4A00A 3NYSA 3CAIA 4FFCA 3WCOA 2YKUA 1SZSA 4MQQA 3N4RA 2CSTA 1AHFA 4BA5A 3MADA 3FFHA 1J32A 4UOYA 3GZCA 2YKVA 1ELUA 2ZUKA 1CQ8A 3DZZA 3DXWA 3EI5A 4E3RA 5IWQA 4WB0A 2A1VA 2FNIA 4ATPA 3PD6B 1TOEA 2WKAA 2R5CB 3DXVA 4QGRA 2W7LA 4RLGA 1VJOA 3W1IA 7AATA 2E7UA 3DYDA 4A6RA 4ATQA 3WKSA 5G4JA 4ZDOA 4PFFA 4U1TA 5HXXA 3E2ZB 5D5SA 2VMOA 4BA4A 1LC8A 1M4NA 2AY4A 2VIBA 3AOVA 3RCHA 4JF0A 3GJUA 1VEFA 4WXGA 4F5GA 2QSRA 3II0A 3N0LA 4Q31A 2YCPA 5EFSA 1N31A 4DGTA 3MC6C 1AY5A 3EI7A 3PGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1Z A;  2EGY A;  5EUE A;  4HVK A;  1QJ3 A;  1CQ7 A;  3WGB A;  1WYV B;  5FT8 A;  4OT8 A;  2CJH A;  1AMA A;  4JEX A;  1MDZ A;  3GET A;  3MBB A;  5F9S A;  1YJY A;  4Y0I A;  1BQA A;  2VGT A;  1TOK A;  3MC6 A;  2YHK A;  2D7Y A;  3JWB A;  1QIR A;  3L44 A;  3MAF B;  1M32 A;  3NYU A;  1MDO A;  1QZ9 A;  4JE5 D;  1PG8 A;  1AHG A;  3VP6 A;  3WZF A;  4ZM4 A;  1J04 A;  4ZWV A;  2VMT A;  2AY8 A;  1IVR A;  1IBJ A;  1M0P A;  4IYO A;  4XJO A;  1WYU A;  3EUC A;  3GWP A;  5EAV A;  3I5T A;  4MKK A;  5M46 A;  1GC0 A;  3KGX A;  3Q8N A;  1I41 A;  1SVV A;  3LY1 A;  3HMU A;  1LS3 A;  1KKJ A;  1V72 A;  5BJ4 A;  3DU4 A;  3AEN A;  8AAT A;  2OGA A;  3B8X A;  2DR1 A;  3K7Y A;  2FQ6 A;  3EZS A;  2C7T A;  1JS3 A;  1D7R A;  1LC7 A;  1D7S A;  2VIA A;  1N2T A;  2BWN A;  2DKJ A;  1WYT A;  2BIE A;  2HP1 A;  1C0N A;  2HOR A;  4TMR A;  4XJM A;  3FDD A;  1ASG A;  1B8G A;  5EUD A;  5G0A A;  1PFF A;  1S06 A;  2BI1 A;  1SPA A;  3PAA A;  5DJ9 A;  5E3K A;  5FT6 A;  4A6T A;  2CJG A;  1PMM A;  3EZ1 A;  1CZE A;  1G4V A;  2HOX A;  1CL1 A;  1ASB A;  1BJ4 A;  2JGT A;  3N75 A;  3NDN A;  3BN1 A;  3RCH B;  3LVM A;  3VK4 A;  4PIW A;  1W7L A;  4EMY A;  2PO3 A;  4WXF A;  2YRI A;  2O0R A;  3FDB A;  4R8D A;  1ARI A;  2E7J A;  3JU7 A;  3B1C A;  1RVU A;  2AY3 A;  3FZ6 A;  4MQR A;  1X0M A;  3IF2 A;  2Z9X A;  1ASE A;  3UWC A;  2ZYJ A;  4A0H A;  1KL2 A;  3W1H A;  3WY7 A;  1WKG A;  2O7C A;  2JJG A;  2W8W A;  2W7F A;  4OBU A;  3JZL A;  1MLY A;  3I16 A;  1TAR A;  4AOA A;  2ZC0 A;  5E4Z A;  2CH1 A;  2EH6 A;  2Z1Y A;  4HF8 A;  1ASF A;  1EJI A;  2C0R A;  2CAN A;  3E77 A;  4XK1 A;  4AZK A;  4B98 A;  1IUG A;  2D5Y A;  1C7G A;  3F0H A;  4F5H A;  4WLJ A;  4WBT A;  3GR9 A;  2JJH A;  4IYO B;  5EIG A;  4AZJ A;  1WYU B;  2CB1 A;  1AKC A;  2CH2 A;  1GCK A;  1FG3 A;  3BCA A;  3PJ0 A;  2VGV A;  4OCA A;  4UHO A;  1MLZ A;  1AIC A;  1S07 A;  3VK3 A;  5AX8 A;  4EB7 A;  2XH1 A;  4IXO A;  5G4I A;  4RKC A;  3IHJ A;  1AIA A;  3ACZ A;  4GDY A;  1UU2 A;  2Z9U A;  2VGW A;  3QM2 A;  4WYF A;  2D64 A;  4GE4 A;  1S09 A;  1PMO A;  4A0R A;  1AAM A;  5JAY A;  1GEY A;  2X5D A;  2EZ2 A;  1W23 A;  1WYT B;  2W7D A;  3PDB A;  4F5L A;  2GMS A;  1CZC A;  5M4D A;  3CBF A;  1B5O A;  2W7G A;  3A9Z A;  4GSA A;  3EIA A;  1OXP A;  3R9A A;  1BKG A;  1SF2 A;  3A8U X;  4MSO A;  5G2Q A;  3UAK A;  2VMR A;  5DB5 A;  2X3L A;  1DGE A;  2QBT A;  3FCR A;  3ZRQ A;  2VMX A;  3RBL A;  4JEW A;  5LHA A;  3FQ8 A;  1W3U A;  3ATH A;  2CY8 A;  2FN6 A;  3AEO A;  5FT4 A;  4MQP A;  3CQ4 A;  1OHW A;  4ITX A;  1SFF A;  3AEJ C;  5M49 A;  1BJN A;  2AY2 A;  2ZY2 A;  1MAQ A;  1JF9 A;  3NRA A;  1BW0 A;  3LVJ A;  2BI9 A;  2OKJ A;  4RIT A;  1KMJ A;  2PB0 A;  2VMN A;  3AV7 A;  3E9K A;  1RV4 A;  3DC1 A;  1O69 A;  2DKB A;  3AEJ A;  2W7K A;  3JTX A;  4P3M A;  4W1W A;  1AMS A;  2CJD A;  2VMP A;  3B46 A;  4NOG A;  1DGD A;  1BT4 A;  2OAT A;  1CL2 A;  1QJ5 A;  1UU0 A;  3FTB A;  3AEL A;  3QI6 A;  3RQ1 A;  1I48 A;  1DFO A;  1ZOD A;  4BHD A;  2ORD A;  3BB8 A;  1ECX A;  4EU1 A;  3BC8 A;  2VI9 A;  1YJZ A;  4RIZ A;  2JG2 A;  1AKB A;  1I43 A;  4KYO A;  4ZLV A;  3VOM A;  3BWN C;  3QGU A;  4WYE A;  1JG8 A;  3ZRR A;  1B9I A;  2VGS A;  4JEY A;  4RM1 A;  1BJW A;  2BI5 A;  2RFV A;  4A0F A;  1ASD A;  1ASA A;  2ZP7 A;  4JF1 A;  4A72 A;  4ZAH A;  1N8P A;  3NUI A;  4K2B A;  4F5M A;  3NX3 A;  4RAE A;  4UHM A;  4IW7 A;  1V2E A;  4GE7 A;  3G0T A;  5I92 A;  1OHY A;  3BWN A;  3QN6 A;  3ZRP A;  2HP2 A;  1IAX A;  2YRR A;  3PDB B;  4O6Z A;  1D7V A;  2YKY A;  4JEZ A;  2EZ1 A;  2BIA A;  4Y0H A;  5HHY A;  2Z9W A;  3L8A A;  4IY7 A;  4AO9 A;  1GEX A;  2Z67 A;  4L0O A;  2BYL A;  4XAU A;  3FVU A;  4ZSW A;  4WP0 A;  2VMY A;  1GC4 A;  3DR4 A;  4RJY A;  4LNM A;  3G7Q A;  1AIB A;  3A9Y A;  2ZSM A;  2ZY4 A;  3D6K A;  3CQ5 A;  1AJR A;  4R2N A;  1KKP A;  1TAS A;  1CQ6 A;  1AY4 A;  1OXO A;  4ISY A;  3W1J A;  2GSA A;  4WB0 B;  2ZY5 A;  3HL2 A;  1DJU A;  5J8Q A;  3VK2 A;  2WK7 A;  1TPL A;  4KAM A;  5G2P A;  1MDX A;  3NU7 A;  4K2M A;  3ELE A;  1EQB A;  4WD2 A;  3WGC A;  3QHX A;  3FQ7 A;  1U08 A;  3DRD A;  3FZ8 A;  2DGK A;  2FNU A;  3QBO A;  5D95 A;  4Y0D A;  1H1C A;  2Z61 A;  5HDM A;  2W7E A;  1RVY A;  2VMS A;  4Q75 A;  3HQT A;  5DX5 A;  3A2B A;  1ARS A;  3E2Y A;  2R2N A;  2YKX A;  2AAT A;  2W7J A;  1FG7 A;  5EQC A;  3ASB A;  1GDE A;  2W7H A;  1LW5 A;  2DOU A;  1ZC9 A;  4W5K A;  2Z9V A;  4ADC A;  4AH3 A;  1ELQ A;  3LVK A;  4OYT A;  2HOY A;  4LW2 A;  3VAX A;  3PPL A;  2TPL A;  1AHX A;  4W1V A;  9AAT A;  4AO4 A;  2OQX A;  2CTZ A;  3BWO A;  3FVS A;  4J5U A;  4F5K A;  1OHV A;  1CS1 A;  1M0N A;  1DTY A;  3JW9 A;  2OKK A;  4GRX A;  4IX8 A;  2HUU A;  4OBV A;  2YOB A;  1XEY A;  4ZAS A;  2AY7 A;  1ARG A;  2VMQ A;  3BCX A;  3A9X A;  1X28 A;  2XBN A;  3TQX A;  3NUB A;  4A0G A;  2D7Z A;  3HT4 A;  2ZJG A;  3AEN B;  3MKJ A;  4KXK A;  5FT5 A;  5G09 A;  4B9B A;  4ZM3 A;  1GC2 A;  1XI9 A;  1YOO A;  2WK9 A;  2VMU A;  3LG0 A;  1D2F A;  2D66 A;  1WKH A;  3OP7 A;  3FZ7 A;  4ITG A;  2Q7W A;  3JWA A;  3PIU A;  1O61 A;  1ZOB A;  4M2M A;  1S0A A;  4WYC A;  5M4B A;  2W8J A;  2W7I A;  1D7U A;  3NTJ A;  1IX7 A;  2C44 A;  2EO5 A;  3ECD A;  3K40 A;  2YCN A;  3I4J A;  2DGL A;  1IAY A;  2QLR A;  3DR7 A;  2AY6 A;  2NMP A;  1LC5 A;  3ASA A;  1S08 A;  1T3I A;  3FVX A;  4CXR A;  2OGE A;  1C4K A;  1M7Y A;  1O62 A;  3H7F A;  3DOD A;  4WYD A;  4A6U A;  4F5J A;  1AHY A;  3HLM A;  3GSB A;  4ZDL A;  1Z3Z A;  1B5P A;  1GC3 A;  3TCM A;  1TOJ A;  1GD9 A;  2BYJ A;  2BI2 A;  2BWP A;  1RV3 A;  1VP4 A;  4XQ2 A;  1UKJ A;  4MY5 A;  1X29 A;  4GEB A;  2W8T A;  3AEM C;  4N0B A;  1SZU A;  3E6G A;  3EI8 A;  1JS6 A;  2AY1 A;  2VMZ A;  4K2I A;  1V2F A;  1I29 A;  4I8A A;  1GBN A;  4RJ0 A;  1AKA A;  2VMW A;  3T32 A;  3R4T A;  4LW4 A;  4M2K A;  5C6U A;  2GMU A;  3LV2 A;  5EIG B;  2JJF A;  3AEM A;  4DBC A;  3HDO A;  3ISL A;  4XJP A;  1AJS A;  1KL1 A;  2FYF A;  2BWO A;  3UE8 A;  3LVL B;  2ZY3 A;  3BS8 A;  1KMK A;  2F8J A;  1BQD A;  4F5I A;  3F9T A;  1Y4I A;  1H0C A;  2R0T A;  1B9H A;  3NNK A;  3WCN A;  1AHE A;  1IJI A;  3FFR A;  2X5F A;  2VMV A;  2W8U A;  3HBX A;  4M2J A;  1SZK A;  1DJE A;  3GZD C;  2W7M A;  4ZDP A;  2HUF A;  1W7M A;  4WXB A;  4GE9 A;  2E7I A;  3N5M A;  2HUI A;  1LW4 A;  4N0W A;  1O4S A;  4MGR A;  2X8U A;  4PFN A;  3RI6 A;  4CBS A;  3ZZK A;  1CJ0 A;  3BV0 A;  2ZSL A;  3G8M A;  1M6S A;  3ELP A;  4WYA A;  3MAU A;  4ZSY A;  4R5Z A;  3GZD A;  1ART A;  2YCT A;  1AAW A;  1ASL A;  1TAT A;  3E2F A;  3FD0 A;  4RKD A;  2V0Y A;  3H14 A;  3KGW A;  2V1P A;  1V2D A;  1G7X A;  3COG A;  4LNL A;  2AEV A;  3PDX A;  1YJS A;  2C81 A;  4JEV A;  5LH9 A;  1LKC A;  4EB5 A;  5TF5 A;  1BS0 A;  4BMK A;  2EPJ A;  4H51 A;  4PVF A;  2VLF A;  3WKR A;  2HOZ A;  1G4X A;  1G7W A;  2AY9 A;  3FKD A;  4MKJ A;  1AY8 A;  4CBR A;  4OTL A;  4BQ0 A;  4XEW A;  5DJ1 A;  4EFF A;  2JIS A;  1ORD A;  3CQ6 A;  3F6T A;  1C7O A;  3B1E A;  2AY5 A;  2BHX A;  2BI3 A;  4OMA A;  1P3W A;  3GBX A;  1QGN A;  4WLH A;  4F4E A;  2HZP A;  1TOG A;  2BKW A;  2AEU A;  3KE3 A;  2VLH A;  2VYC A;  4ZWM A;  1AMR A;  1FC4 A;  3NYT A;  1BJO A;  2JJE A;  1AJS B;  5EUN A;  4TV7 A;  2D61 A;  3TAT A;  4UQV A;  3P6K A;  4IXS A;  3AEP A;  4J8L A;  4XJL A;  1Z7D A;  2WK8 A;  1IX8 A;  2Z20 A;  4Q76 A;  1OAT A;  1QIT A;  1QIS A;  4OC9 A;  4W1X A;  4CXQ A;  1DJ9 A;  4LC3 A;  4Q6R A;  3WX9 A;  4IXZ A;  2D65 A;  2R5E A;  3PD6 A;  3AAT A;  3USF A;  3LWS A;  2R5C A;  1LK9 A;  2VGZ A;  2VGU A;  1TOI A;  4E1O A;  4W8I A;  1MAP A;  1MGV A;  1E5F A;  2FM1 A;  3E2Z A;  3EI9 A;  2DGM A;  4LNJ A;  1ASM A;  1W7N A;  1YAA A;  4U2H A;  3ZZJ A;  2VI8 A;  2CFB A;  3PA9 A;  5K8B A;  4DQ6 A;  1AMQ A;  3B1D A;  3FRK A;  3P1T A;  3FSL A;  3NU8 A;  4UHN A;  2E54 A;  4E77 A;  4JE5 A;  3RUY A;  1C9C A;  1YIY A;  2GQN A;  2PB2 A;  5BJ3 A;  1ARH A;  1EG5 A;  2D63 A;  3TFU A;  2O1B A;  4P7Y A;  1E5E A;  3AOW A;  4R5F A;  1YNU A;  2QB2 A;  4TN4 A;  1WYV A;  1X2A A;  3HVY A;  2W8V A;  1WST A;  4F5F A;  1DKA A;  1C7N A;  3RBF A;  1ASC A;  1YIZ A;  2QB3 A;  3MAF A;  3M5U A;  4W91 A;  1M0O A;  3EIB A;  2QMA A;  4WYG A;  3BCB A;  4ADE A;  2G6W A;  3WLX A;  3EI6 A;  3K28 A;  1M0Q A;  3KKI A;  1IX6 A;  3QPG A;  2CIN A;  2QA3 A;  1BJO B;  3FQA A;  3OKS A;  4ADD A;  4ADB A;  1AX4 A;  3TFT A;  2GB3 A;  5EAA A;  1B4X A;  4E3Q A;  4FL0 A;  2BIG A;  5F8V A;  1UU1 A;  5E5I A;  1GEW A;  4CVQ A;  1ASN A;  3MEB A;  4A00 A;  3NYS A;  3CAI A;  4FFC A;  3WCO A;  2YKU A;  1SZS A;  4MQQ A;  2CST A;  1AHF A;  4BA5 A;  3MAD A;  3FFH A;  1J32 A;  4UOY A;  3GZC A;  2YKV A;  1ELU A;  2ZUK A;  1CQ8 A;  3DZZ A;  3DXW A;  3EI5 A;  4E3R A;  5IWQ A;  4WB0 A;  2FNI A;  4ATP A;  3PD6 B;  1TOE A;  2WKA A;  2R5C B;  3DXV A;  4QGR A;  2W7L A;  4RLG A;  1VJO A;  3W1I A;  7AAT A;  2E7U A;  3DYD A;  4A6R A;  4ATQ A;  3WKS A;  5G4J A;  4ZDO A;  4PFF A;  4U1T A;  5HXX A;  3E2Z B;  5D5S A;  2VMO A;  4BA4 A;  1LC8 A;  1M4N A;  2AY4 A;  2VIB A;  3AOV A;  3RCH A;  4JF0 A;  3GJU A;  1VEF A;  4WXG A;  4F5G A;  3II0 A;  3N0L A;  4Q31 A;  2YCP A;  5EFS A;  1N31 A;  4DGT A;  3MC6 C;  1AY5 A;  3EI7 A;  3PGY A; 
#chains in the Genus database with same CATH topology
 2Z1Z A;  3N4S A;  2EGY A;  5EUE A;  4HVK A;  1QJ3 A;  1CQ7 A;  3WGB A;  1WYV B;  5FT8 A;  4OT8 A;  2CJH A;  1AMA A;  4JEX A;  1MDZ A;  3GET A;  3MBB A;  5F9S A;  1YJY A;  4Y0I A;  1BQA A;  2VGT A;  1TOK A;  3MC6 A;  2YHK A;  2D7Y A;  3JWB A;  1QIR A;  3L44 A;  3MAF B;  1M32 A;  3NYU A;  1MDO A;  1QZ9 A;  4JE5 D;  1PG8 A;  1AHG A;  3VP6 A;  3WZF A;  4ZM4 A;  1J04 A;  4ZWV A;  2VMT A;  2AY8 A;  1IVR A;  1IBJ A;  1M0P A;  4IYO A;  4XJO A;  1WYU A;  3EUC A;  3GWP A;  5EAV A;  3I5T A;  4MKK A;  5M46 A;  1GC0 A;  3KGX A;  3Q8N A;  1I41 A;  1SVV A;  3LY1 A;  3HMU A;  1LS3 A;  1KKJ A;  1V72 A;  5BJ4 A;  3DU4 A;  3AEN A;  8AAT A;  2OGA A;  3B8X A;  2DR1 A;  3K7Y A;  2FQ6 A;  3EZS A;  2C7T A;  1JS3 A;  1D7R A;  1LC7 A;  1D7S A;  2VIA A;  1N2T A;  2BWN A;  2DKJ A;  1WYT A;  2BIE A;  2HP1 A;  1C0N A;  2HOR A;  4TMR A;  4XJM A;  3FDD A;  1ASG A;  1B8G A;  5EUD A;  5G0A A;  1PFF A;  1S06 A;  2BI1 A;  1SPA A;  3PAA A;  5DJ9 A;  5E3K A;  5FT6 A;  4A6T A;  2CJG A;  1PMM A;  3EZ1 A;  1CZE A;  1G4V A;  2HOX A;  1CL1 A;  1ASB A;  1BJ4 A;  2JGT A;  3N75 A;  3NDN A;  3BN1 A;  3RCH B;  3LVM A;  3VK4 A;  4PIW A;  1W7L A;  4EMY A;  2PO3 A;  4WXF A;  2YRI A;  2O0R A;  3FDB A;  4R8D A;  1ARI A;  2E7J A;  3JU7 A;  3B1C A;  1RVU A;  2G7J A;  2AY3 A;  3FZ6 A;  4MQR A;  1X0M A;  3IF2 A;  2Z9X A;  1ASE A;  3UWC A;  2ZYJ A;  4A0H A;  1KL2 A;  3W1H A;  3WY7 A;  1WKG A;  2O7C A;  2JJG A;  2W8W A;  2W7F A;  4OBU A;  3JZL A;  1MLY A;  3I16 A;  1TAR A;  4AOA A;  2ZC0 A;  5E4Z A;  2CH1 A;  2EH6 A;  2Z1Y A;  4HF8 A;  1ASF A;  1EJI A;  2C0R A;  2CAN A;  3E77 A;  4XK1 A;  4AZK A;  4B98 A;  1IUG A;  2D5Y A;  1C7G A;  3F0H A;  4F5H A;  3N4X A;  3N7N A;  4WLJ A;  4WBT A;  3GR9 A;  2JJH A;  4IYO B;  5EIG A;  4AZJ A;  1WYU B;  2CB1 A;  1AKC A;  2CH2 A;  1GCK A;  1FG3 A;  3BCA A;  3PJ0 A;  2VGV A;  4OCA A;  4UHO A;  1MLZ A;  1AIC A;  1S07 A;  3VK3 A;  5AX8 A;  4EB7 A;  2XH1 A;  4IXO A;  5G4I A;  4RKC A;  3IHJ A;  1AIA A;  3ACZ A;  4GDY A;  1UU2 A;  2Z9U A;  2VGW A;  3QM2 A;  4WYF A;  2D64 A;  4GE4 A;  1S09 A;  1PMO A;  4A0R A;  1AAM A;  5JAY A;  1GEY A;  2X5D A;  2EZ2 A;  1W23 A;  1WYT B;  2W7D A;  3PDB A;  4F5L A;  2GMS A;  1CZC A;  5M4D A;  3CBF A;  1B5O A;  2W7G A;  3A9Z A;  4GSA A;  3EIA A;  1OXP A;  3R9A A;  1BKG A;  1SF2 A;  3A8U X;  4MSO A;  5G2Q A;  3UAK A;  2VMR A;  5DB5 A;  2X3L A;  1DGE A;  2QBT A;  3FCR A;  3ZRQ A;  2VMX A;  3RBL A;  4JEW A;  5LHA A;  3FQ8 A;  1W3U A;  3ATH A;  2CY8 A;  2FN6 A;  3AEO A;  5FT4 A;  4MQP A;  3CQ4 A;  1OHW A;  4ITX A;  1SFF A;  3AEJ C;  5M49 A;  1BJN A;  2AY2 A;  2ZY2 A;  1MAQ A;  1JF9 A;  3NRA A;  1BW0 A;  3LVJ A;  2BI9 A;  2OKJ A;  4RIT A;  4H63 Q;  1KMJ A;  2PB0 A;  2VMN A;  3AV7 A;  2KFP A;  3E9K A;  1RV4 A;  3DC1 A;  1O69 A;  2DKB A;  3AEJ A;  2W7K A;  3JTX A;  4P3M A;  4W1W A;  1AMS A;  2CJD A;  2VMP A;  3B46 A;  4NOG A;  1DGD A;  1BT4 A;  2OAT A;  1CL2 A;  1QJ5 A;  1UU0 A;  3FTB A;  3AEL A;  3QI6 A;  3RQ1 A;  1I48 A;  1DFO A;  1ZOD A;  4BHD A;  2ORD A;  3BB8 A;  1ECX A;  4EU1 A;  3BC8 A;  2VI9 A;  1YJZ A;  4RIZ A;  2JG2 A;  1AKB A;  1I43 A;  4KYO A;  4ZLV A;  3VOM A;  3BWN C;  3QGU A;  4WYE A;  1JG8 A;  3ZRR A;  1B9I A;  2VGS A;  4JEY A;  4RM1 A;  1BJW A;  2BI5 A;  2RFV A;  4A0F A;  1ASD A;  1ASA A;  2ZP7 A;  4JF1 A;  4A72 A;  4ZAH A;  1N8P A;  3NUI A;  4K2B A;  4F5M A;  3NX3 A;  4RAE A;  4UHM A;  4IW7 A;  1V2E A;  4GE7 A;  3G0T A;  5I92 A;  1OHY A;  3BWN A;  3QN6 A;  3ZRP A;  2HP2 A;  1IAX A;  2YRR A;  3PDB B;  4O6Z A;  1D7V A;  2YKY A;  4JEZ A;  1KAF A;  2EZ1 A;  2BIA A;  4Y0H A;  5HHY A;  2Z9W A;  3L8A A;  4IY7 A;  4AO9 A;  1GEX A;  2Z67 A;  4L0O A;  2BYL A;  4XAU A;  3FVU A;  4ZSW A;  4WP0 A;  2VMY A;  1GC4 A;  3DR4 A;  4RJY A;  4LNM A;  3G7Q A;  1AIB A;  3A9Y A;  2ZSM A;  2ZY4 A;  3D6K A;  3CQ5 A;  1AJR A;  4R2N A;  1KKP A;  1TAS A;  1CQ6 A;  1AY4 A;  1OXO A;  4ISY A;  2FKI A;  3W1J A;  2GSA A;  4WB0 B;  2ZY5 A;  3HL2 A;  1DJU A;  5J8Q A;  3VK2 A;  2WK7 A;  1TPL A;  4KAM A;  5G2P A;  1MDX A;  3NU7 A;  4K2M A;  3ELE A;  1EQB A;  4WD2 A;  3WGC A;  3QHX A;  3FQ7 A;  1U08 A;  3DRD A;  3FZ8 A;  2DGK A;  2FNU A;  3QBO A;  5D95 A;  4Y0D A;  1H1C A;  2Z61 A;  5HDM A;  2W7E A;  1RVY A;  2VMS A;  4Q75 A;  2EYQ A;  3HQT A;  5DX5 A;  3A2B A;  1ARS A;  3E2Y A;  2R2N A;  2YKX A;  2AAT A;  2W7J A;  1FG7 A;  5EQC A;  3ASB A;  1GDE A;  2W7H A;  1LW5 A;  2DOU A;  1ZC9 A;  4W5K A;  2Z9V A;  4ADC A;  4AH3 A;  1ELQ A;  3LVK A;  4OYT A;  2HOY A;  4LW2 A;  3VAX A;  3PPL A;  2TPL A;  1AHX A;  4W1V A;  9AAT A;  4AO4 A;  2OQX A;  2CTZ A;  3BWO A;  3FVS A;  4J5U A;  4F5K A;  1OHV A;  1CS1 A;  1M0N A;  1DTY A;  3JW9 A;  2OKK A;  4GRX A;  4IX8 A;  2HUU A;  4OBV A;  2YOB A;  1XEY A;  4ZAS A;  2AY7 A;  1ARG A;  2VMQ A;  3BCX A;  3A9X A;  1X28 A;  2XBN A;  3TQX A;  3NUB A;  4A0G A;  2D7Z A;  3HT4 A;  2ZJG A;  3AEN B;  3MKJ A;  4KXK A;  5FT5 A;  5G09 A;  4B9B A;  4ZM3 A;  1GC2 A;  1XI9 A;  1YOO A;  2WK9 A;  2VMU A;  3LG0 A;  1D2F A;  2D66 A;  1WKH A;  3OP7 A;  3FZ7 A;  4ITG A;  2Q7W A;  3JWA A;  3PIU A;  1O61 A;  1ZOB A;  4M2M A;  1S0A A;  4WYC A;  5M4B A;  2W8J A;  2W7I A;  1D7U A;  3NTJ A;  1IX7 A;  2C44 A;  2EO5 A;  3ECD A;  3K40 A;  2YCN A;  3I4J A;  2DGL A;  1IAY A;  2QLR A;  3DR7 A;  2AY6 A;  2NMP A;  1LC5 A;  3ASA A;  1S08 A;  1T3I A;  3FVX A;  4CXR A;  2OGE A;  1C4K A;  1M7Y A;  1O62 A;  3H7F A;  3DOD A;  4WYD A;  4A6U A;  4F5J A;  1AHY A;  5KTB A;  3HLM A;  3GSB A;  4ZDL A;  1Z3Z A;  1B5P A;  1GC3 A;  3TCM A;  1TOJ A;  1GD9 A;  2BYJ A;  2BI2 A;  2BWP A;  1RV3 A;  1VP4 A;  4XQ2 A;  1UKJ A;  4MY5 A;  1X29 A;  4GEB A;  2W8T A;  3AEM C;  4N0B A;  1SZU A;  3E6G A;  3EI8 A;  1JS6 A;  2AY1 A;  2VMZ A;  4K2I A;  1V2F A;  1I29 A;  4I8A A;  1GBN A;  4RJ0 A;  1AKA A;  2VMW A;  3T32 A;  3R4T A;  4LW4 A;  4M2K A;  5C6U A;  2GMU A;  3LV2 A;  5EIG B;  2JJF A;  3AEM A;  4DBC A;  3HDO A;  3ISL A;  4XJP A;  1AJS A;  1KL1 A;  2FYF A;  2BWO A;  3UE8 A;  3LVL B;  2ZY3 A;  3BS8 A;  1KMK A;  2F8J A;  1BQD A;  4F5I A;  3F9T A;  1Y4I A;  1H0C A;  2R0T A;  1B9H A;  3NNK A;  3WCN A;  1AHE A;  1IJI A;  3FFR A;  2X5F A;  3H9X A;  2VMV A;  2W8U A;  3HBX A;  4M2J A;  1SZK A;  1DJE A;  3GZD C;  2W7M A;  4ZDP A;  2HUF A;  1W7M A;  4WXB A;  4GE9 A;  2E7I A;  3N5M A;  2HUI A;  1LW4 A;  4N0W A;  1O4S A;  4MGR A;  2X8U A;  4PFN A;  3RI6 A;  4CBS A;  3ZZK A;  1CJ0 A;  3BV0 A;  2ZSL A;  3G8M A;  1M6S A;  3ELP A;  4WYA A;  3MAU A;  4ZSY A;  4R5Z A;  3GZD A;  1ART A;  2YCT A;  1AAW A;  1ASL A;  1TAT A;  3E2F A;  3FD0 A;  4RKD A;  2V0Y A;  3H14 A;  3KGW A;  2V1P A;  1V2D A;  1G7X A;  3COG A;  4LNL A;  2AEV A;  3PDX A;  1YJS A;  2C81 A;  4JEV A;  5LH9 A;  1LKC A;  4EB5 A;  5TF5 A;  1BS0 A;  4BMK A;  2EPJ A;  4H51 A;  4PVF A;  2VLF A;  3WKR A;  2HOZ A;  1G4X A;  1G7W A;  2AY9 A;  3FKD A;  4MKJ A;  1AY8 A;  4CBR A;  4OTL A;  4BQ0 A;  4XEW A;  5DJ1 A;  4EFF A;  2JIS A;  1ORD A;  3CQ6 A;  3F6T A;  1C7O A;  3B1E A;  2AY5 A;  2BHX A;  2BI3 A;  4OMA A;  1P3W A;  3GBX A;  1QGN A;  4WLH A;  4F4E A;  2HZP A;  1TOG A;  2BKW A;  2AEU A;  3KE3 A;  2VLH A;  2VYC A;  4ZWM A;  1AMR A;  1FC4 A;  3NYT A;  1BJO A;  2JJE A;  1AJS B;  5EUN A;  4TV7 A;  2D61 A;  3TAT A;  4UQV A;  4K05 A;  3P6K A;  4IXS A;  3AEP A;  4J8L A;  4XJL A;  1Z7D A;  2WK8 A;  1IX8 A;  2Z20 A;  4Q76 A;  1OAT A;  1QIT A;  1QIS A;  4OC9 A;  2WB6 A;  4W1X A;  4CXQ A;  1DJ9 A;  4LC3 A;  4Q6R A;  3WX9 A;  4IXZ A;  2D65 A;  2R5E A;  3PD6 A;  3AAT A;  3USF A;  3LWS A;  2R5C A;  1LK9 A;  2VGZ A;  2VGU A;  1TOI A;  4E1O A;  4W8I A;  1MAP A;  1MGV A;  1E5F A;  2FM1 A;  3E2Z A;  3EI9 A;  2DGM A;  4LNJ A;  1ASM A;  1W7N A;  1YAA A;  4U2H A;  3ZZJ A;  2VI8 A;  2CFB A;  3PA9 A;  5K8B A;  4DQ6 A;  1AMQ A;  3B1D A;  3FRK A;  3P1T A;  3FSL A;  3NU8 A;  4UHN A;  2E54 A;  4E77 A;  4JE5 A;  3RUY A;  1C9C A;  1YIY A;  2GQN A;  2PB2 A;  5BJ3 A;  1ARH A;  1EG5 A;  2D63 A;  3TFU A;  2O1B A;  4P7Y A;  1E5E A;  3AOW A;  4R5F A;  1YNU A;  2QB2 A;  4TN4 A;  1WYV A;  1X2A A;  3HVY A;  2W8V A;  1WST A;  4F5F A;  1DKA A;  1C7N A;  3RBF A;  1ASC A;  1YIZ A;  2QB3 A;  3MAF A;  3M5U A;  4W91 A;  1M0O A;  3EIB A;  2QMA A;  4WYG A;  3BCB A;  4ADE A;  2G6W A;  3WLX A;  3EI6 A;  3K28 A;  1M0Q A;  3KKI A;  1IX6 A;  3QPG A;  2CIN A;  2QA3 A;  1BJO B;  3FQA A;  3OKS A;  4ADD A;  4ADB A;  1AX4 A;  3TFT A;  2GB3 A;  5EAA A;  1B4X A;  4E3Q A;  4FL0 A;  2BIG A;  5F8V A;  1UU1 A;  5E5I A;  1GEW A;  4CVQ A;  1ASN A;  3MEB A;  4A00 A;  3NYS A;  3CAI A;  4FFC A;  3WCO A;  2YKU A;  1SZS A;  4MQQ A;  3N4R A;  2CST A;  1AHF A;  4BA5 A;  3MAD A;  3FFH A;  1J32 A;  4UOY A;  3GZC A;  2YKV A;  1ELU A;  2ZUK A;  1CQ8 A;  3DZZ A;  3DXW A;  3EI5 A;  4E3R A;  5IWQ A;  4WB0 A;  2A1V A;  2FNI A;  4ATP A;  3PD6 B;  1TOE A;  2WKA A;  2R5C B;  3DXV A;  4QGR A;  2W7L A;  4RLG A;  1VJO A;  3W1I A;  7AAT A;  2E7U A;  3DYD A;  4A6R A;  4ATQ A;  3WKS A;  5G4J A;  4ZDO A;  4PFF A;  4U1T A;  5HXX A;  3E2Z B;  5D5S A;  2VMO A;  4BA4 A;  1LC8 A;  1M4N A;  2AY4 A;  2VIB A;  3AOV A;  3RCH A;  4JF0 A;  3GJU A;  1VEF A;  4WXG A;  4F5G A;  2QSR A;  3II0 A;  3N0L A;  4Q31 A;  2YCP A;  5EFS A;  1N31 A;  4DGT A;  3MC6 C;  1AY5 A;  3EI7 A;  3PGY A; 
#chains in the Genus database with same CATH homology
 2Z1Z A;  3N4S A;  2EGY A;  5EUE A;  4HVK A;  1QJ3 A;  1CQ7 A;  3WGB A;  1WYV B;  5FT8 A;  4OT8 A;  2CJH A;  1AMA A;  4JEX A;  1MDZ A;  3GET A;  3MBB A;  5F9S A;  1YJY A;  4Y0I A;  1BQA A;  2VGT A;  1TOK A;  3MC6 A;  2YHK A;  2D7Y A;  3JWB A;  1QIR A;  3L44 A;  3MAF B;  1M32 A;  3NYU A;  1MDO A;  1QZ9 A;  4JE5 D;  1PG8 A;  1AHG A;  3VP6 A;  3WZF A;  4ZM4 A;  1J04 A;  4ZWV A;  2VMT A;  2AY8 A;  1IVR A;  1IBJ A;  1M0P A;  4IYO A;  4XJO A;  1WYU A;  3EUC A;  3GWP A;  5EAV A;  3I5T A;  4MKK A;  5M46 A;  1GC0 A;  3KGX A;  3Q8N A;  1I41 A;  1SVV A;  3LY1 A;  3HMU A;  1LS3 A;  1KKJ A;  1V72 A;  5BJ4 A;  3DU4 A;  3AEN A;  8AAT A;  2OGA A;  3B8X A;  2DR1 A;  3K7Y A;  2FQ6 A;  3EZS A;  2C7T A;  1JS3 A;  1D7R A;  1LC7 A;  1D7S A;  2VIA A;  1N2T A;  2BWN A;  2DKJ A;  1WYT A;  2BIE A;  2HP1 A;  1C0N A;  2HOR A;  4TMR A;  4XJM A;  3FDD A;  1ASG A;  1B8G A;  5EUD A;  5G0A A;  1PFF A;  1S06 A;  2BI1 A;  1SPA A;  3PAA A;  5DJ9 A;  5E3K A;  5FT6 A;  4A6T A;  2CJG A;  1PMM A;  3EZ1 A;  1CZE A;  1G4V A;  2HOX A;  1CL1 A;  1ASB A;  1BJ4 A;  2JGT A;  3N75 A;  3NDN A;  3BN1 A;  3RCH B;  3LVM A;  3VK4 A;  4PIW A;  1W7L A;  4EMY A;  2PO3 A;  4WXF A;  2YRI A;  2O0R A;  3FDB A;  4R8D A;  1ARI A;  2E7J A;  3JU7 A;  3B1C A;  1RVU A;  2G7J A;  2AY3 A;  3FZ6 A;  4MQR A;  1X0M A;  3IF2 A;  2Z9X A;  1ASE A;  3UWC A;  2ZYJ A;  4A0H A;  1KL2 A;  3W1H A;  3WY7 A;  1WKG A;  2O7C A;  2JJG A;  2W8W A;  2W7F A;  4OBU A;  3JZL A;  1MLY A;  3I16 A;  1TAR A;  4AOA A;  2ZC0 A;  5E4Z A;  2CH1 A;  2EH6 A;  2Z1Y A;  4HF8 A;  1ASF A;  1EJI A;  2C0R A;  2CAN A;  3E77 A;  4XK1 A;  4AZK A;  4B98 A;  1IUG A;  2D5Y A;  1C7G A;  3F0H A;  4F5H A;  3N4X A;  3N7N A;  4WLJ A;  4WBT A;  3GR9 A;  2JJH A;  4IYO B;  5EIG A;  4AZJ A;  1WYU B;  2CB1 A;  1AKC A;  2CH2 A;  1GCK A;  1FG3 A;  3BCA A;  3PJ0 A;  2VGV A;  4OCA A;  4UHO A;  1MLZ A;  1AIC A;  1S07 A;  3VK3 A;  5AX8 A;  4EB7 A;  2XH1 A;  4IXO A;  5G4I A;  4RKC A;  3IHJ A;  1AIA A;  3ACZ A;  4GDY A;  1UU2 A;  2Z9U A;  2VGW A;  3QM2 A;  4WYF A;  2D64 A;  4GE4 A;  1S09 A;  1PMO A;  4A0R A;  1AAM A;  5JAY A;  1GEY A;  2X5D A;  2EZ2 A;  1W23 A;  1WYT B;  2W7D A;  3PDB A;  4F5L A;  2GMS A;  1CZC A;  5M4D A;  3CBF A;  1B5O A;  2W7G A;  3A9Z A;  4GSA A;  3EIA A;  1OXP A;  3R9A A;  1BKG A;  1SF2 A;  3A8U X;  4MSO A;  5G2Q A;  3UAK A;  2VMR A;  5DB5 A;  2X3L A;  1DGE A;  2QBT A;  3FCR A;  3ZRQ A;  2VMX A;  3RBL A;  4JEW A;  5LHA A;  3FQ8 A;  1W3U A;  3ATH A;  2CY8 A;  2FN6 A;  3AEO A;  5FT4 A;  4MQP A;  3CQ4 A;  1OHW A;  4ITX A;  1SFF A;  3AEJ C;  5M49 A;  1BJN A;  2AY2 A;  2ZY2 A;  1MAQ A;  1JF9 A;  3NRA A;  1BW0 A;  3LVJ A;  2BI9 A;  2OKJ A;  4RIT A;  4H63 Q;  1KMJ A;  2PB0 A;  2VMN A;  3AV7 A;  2KFP A;  3E9K A;  1RV4 A;  3DC1 A;  1O69 A;  2DKB A;  3AEJ A;  2W7K A;  3JTX A;  4P3M A;  4W1W A;  1AMS A;  2CJD A;  2VMP A;  3B46 A;  4NOG A;  1DGD A;  1BT4 A;  2OAT A;  1CL2 A;  1QJ5 A;  1UU0 A;  3FTB A;  3AEL A;  3QI6 A;  3RQ1 A;  1I48 A;  1DFO A;  1ZOD A;  4BHD A;  2ORD A;  3BB8 A;  1ECX A;  4EU1 A;  3BC8 A;  2VI9 A;  1YJZ A;  4RIZ A;  2JG2 A;  1AKB A;  1I43 A;  4KYO A;  4ZLV A;  3VOM A;  3BWN C;  3QGU A;  4WYE A;  1JG8 A;  3ZRR A;  1B9I A;  2VGS A;  4JEY A;  4RM1 A;  1BJW A;  2BI5 A;  2RFV A;  4A0F A;  1ASD A;  1ASA A;  2ZP7 A;  4JF1 A;  4A72 A;  4ZAH A;  1N8P A;  3NUI A;  4K2B A;  4F5M A;  3NX3 A;  4RAE A;  4UHM A;  4IW7 A;  1V2E A;  4GE7 A;  3G0T A;  5I92 A;  1OHY A;  3BWN A;  3QN6 A;  3ZRP A;  2HP2 A;  1IAX A;  2YRR A;  3PDB B;  4O6Z A;  1D7V A;  2YKY A;  4JEZ A;  2EZ1 A;  2BIA A;  4Y0H A;  5HHY A;  2Z9W A;  3L8A A;  4IY7 A;  4AO9 A;  1GEX A;  2Z67 A;  4L0O A;  2BYL A;  4XAU A;  3FVU A;  4ZSW A;  4WP0 A;  2VMY A;  1GC4 A;  3DR4 A;  4RJY A;  4LNM A;  3G7Q A;  1AIB A;  3A9Y A;  2ZSM A;  2ZY4 A;  3D6K A;  3CQ5 A;  1AJR A;  4R2N A;  1KKP A;  1TAS A;  1CQ6 A;  1AY4 A;  1OXO A;  4ISY A;  2FKI A;  3W1J A;  2GSA A;  4WB0 B;  2ZY5 A;  3HL2 A;  1DJU A;  5J8Q A;  3VK2 A;  2WK7 A;  1TPL A;  4KAM A;  5G2P A;  1MDX A;  3NU7 A;  4K2M A;  3ELE A;  1EQB A;  4WD2 A;  3WGC A;  3QHX A;  3FQ7 A;  1U08 A;  3DRD A;  3FZ8 A;  2DGK A;  2FNU A;  3QBO A;  5D95 A;  4Y0D A;  1H1C A;  2Z61 A;  5HDM A;  2W7E A;  1RVY A;  2VMS A;  4Q75 A;  2EYQ A;  3HQT A;  5DX5 A;  3A2B A;  1ARS A;  3E2Y A;  2R2N A;  2YKX A;  2AAT A;  2W7J A;  1FG7 A;  5EQC A;  3ASB A;  1GDE A;  2W7H A;  1LW5 A;  2DOU A;  1ZC9 A;  4W5K A;  2Z9V A;  4ADC A;  4AH3 A;  1ELQ A;  3LVK A;  4OYT A;  2HOY A;  4LW2 A;  3VAX A;  3PPL A;  2TPL A;  1AHX A;  4W1V A;  9AAT A;  4AO4 A;  2OQX A;  2CTZ A;  3BWO A;  3FVS A;  4J5U A;  4F5K A;  1OHV A;  1CS1 A;  1M0N A;  1DTY A;  3JW9 A;  2OKK A;  4GRX A;  4IX8 A;  2HUU A;  4OBV A;  2YOB A;  1XEY A;  4ZAS A;  2AY7 A;  1ARG A;  2VMQ A;  3BCX A;  3A9X A;  1X28 A;  2XBN A;  3TQX A;  3NUB A;  4A0G A;  2D7Z A;  3HT4 A;  2ZJG A;  3AEN B;  3MKJ A;  4KXK A;  5FT5 A;  5G09 A;  4B9B A;  4ZM3 A;  1GC2 A;  1XI9 A;  1YOO A;  2WK9 A;  2VMU A;  3LG0 A;  1D2F A;  2D66 A;  1WKH A;  3OP7 A;  3FZ7 A;  4ITG A;  2Q7W A;  3JWA A;  3PIU A;  1O61 A;  1ZOB A;  4M2M A;  1S0A A;  4WYC A;  5M4B A;  2W8J A;  2W7I A;  1D7U A;  3NTJ A;  1IX7 A;  2C44 A;  2EO5 A;  3ECD A;  3K40 A;  2YCN A;  3I4J A;  2DGL A;  1IAY A;  2QLR A;  3DR7 A;  2AY6 A;  2NMP A;  1LC5 A;  3ASA A;  1S08 A;  1T3I A;  3FVX A;  4CXR A;  2OGE A;  1C4K A;  1M7Y A;  1O62 A;  3H7F A;  3DOD A;  4WYD A;  4A6U A;  4F5J A;  1AHY A;  5KTB A;  3HLM A;  3GSB A;  4ZDL A;  1Z3Z A;  1B5P A;  1GC3 A;  3TCM A;  1TOJ A;  1GD9 A;  2BYJ A;  2BI2 A;  2BWP A;  1RV3 A;  1VP4 A;  4XQ2 A;  1UKJ A;  4MY5 A;  1X29 A;  4GEB A;  2W8T A;  3AEM C;  4N0B A;  1SZU A;  3E6G A;  3EI8 A;  1JS6 A;  2AY1 A;  2VMZ A;  4K2I A;  1V2F A;  1I29 A;  4I8A A;  1GBN A;  4RJ0 A;  1AKA A;  2VMW A;  3T32 A;  3R4T A;  4LW4 A;  4M2K A;  5C6U A;  2GMU A;  3LV2 A;  5EIG B;  2JJF A;  3AEM A;  4DBC A;  3HDO A;  3ISL A;  4XJP A;  1AJS A;  1KL1 A;  2FYF A;  2BWO A;  3UE8 A;  3LVL B;  2ZY3 A;  3BS8 A;  1KMK A;  2F8J A;  1BQD A;  4F5I A;  3F9T A;  1Y4I A;  1H0C A;  2R0T A;  1B9H A;  3NNK A;  3WCN A;  1AHE A;  1IJI A;  3FFR A;  2X5F A;  3H9X A;  2VMV A;  2W8U A;  3HBX A;  4M2J A;  1SZK A;  1DJE A;  3GZD C;  2W7M A;  4ZDP A;  2HUF A;  1W7M A;  4WXB A;  4GE9 A;  2E7I A;  3N5M A;  2HUI A;  1LW4 A;  4N0W A;  1O4S A;  4MGR A;  2X8U A;  4PFN A;  3RI6 A;  4CBS A;  3ZZK A;  1CJ0 A;  3BV0 A;  2ZSL A;  3G8M A;  1M6S A;  3ELP A;  4WYA A;  3MAU A;  4ZSY A;  4R5Z A;  3GZD A;  1ART A;  2YCT A;  1AAW A;  1ASL A;  1TAT A;  3E2F A;  3FD0 A;  4RKD A;  2V0Y A;  3H14 A;  3KGW A;  2V1P A;  1V2D A;  1G7X A;  3COG A;  4LNL A;  2AEV A;  3PDX A;  1YJS A;  2C81 A;  4JEV A;  5LH9 A;  1LKC A;  4EB5 A;  5TF5 A;  1BS0 A;  4BMK A;  2EPJ A;  4H51 A;  4PVF A;  2VLF A;  3WKR A;  2HOZ A;  1G4X A;  1G7W A;  2AY9 A;  3FKD A;  4MKJ A;  1AY8 A;  4CBR A;  4OTL A;  4BQ0 A;  4XEW A;  5DJ1 A;  4EFF A;  2JIS A;  1ORD A;  3CQ6 A;  3F6T A;  1C7O A;  3B1E A;  2AY5 A;  2BHX A;  2BI3 A;  4OMA A;  1P3W A;  3GBX A;  1QGN A;  4WLH A;  4F4E A;  2HZP A;  1TOG A;  2BKW A;  2AEU A;  3KE3 A;  2VLH A;  2VYC A;  4ZWM A;  1AMR A;  1FC4 A;  3NYT A;  1BJO A;  2JJE A;  1AJS B;  5EUN A;  4TV7 A;  2D61 A;  3TAT A;  4UQV A;  4K05 A;  3P6K A;  4IXS A;  3AEP A;  4J8L A;  4XJL A;  1Z7D A;  2WK8 A;  1IX8 A;  2Z20 A;  4Q76 A;  1OAT A;  1QIT A;  1QIS A;  4OC9 A;  2WB6 A;  4W1X A;  4CXQ A;  1DJ9 A;  4LC3 A;  4Q6R A;  3WX9 A;  4IXZ A;  2D65 A;  2R5E A;  3PD6 A;  3AAT A;  3USF A;  3LWS A;  2R5C A;  1LK9 A;  2VGZ A;  2VGU A;  1TOI A;  4E1O A;  4W8I A;  1MAP A;  1MGV A;  1E5F A;  2FM1 A;  3E2Z A;  3EI9 A;  2DGM A;  4LNJ A;  1ASM A;  1W7N A;  1YAA A;  4U2H A;  3ZZJ A;  2VI8 A;  2CFB A;  3PA9 A;  5K8B A;  4DQ6 A;  1AMQ A;  3B1D A;  3FRK A;  3P1T A;  3FSL A;  3NU8 A;  4UHN A;  2E54 A;  4E77 A;  4JE5 A;  3RUY A;  1C9C A;  1YIY A;  2GQN A;  2PB2 A;  5BJ3 A;  1ARH A;  1EG5 A;  2D63 A;  3TFU A;  2O1B A;  4P7Y A;  1E5E A;  3AOW A;  4R5F A;  1YNU A;  2QB2 A;  4TN4 A;  1WYV A;  1X2A A;  3HVY A;  2W8V A;  1WST A;  4F5F A;  1DKA A;  1C7N A;  3RBF A;  1ASC A;  1YIZ A;  2QB3 A;  3MAF A;  3M5U A;  4W91 A;  1M0O A;  3EIB A;  2QMA A;  4WYG A;  3BCB A;  4ADE A;  2G6W A;  3WLX A;  3EI6 A;  3K28 A;  1M0Q A;  3KKI A;  1IX6 A;  3QPG A;  2CIN A;  2QA3 A;  1BJO B;  3FQA A;  3OKS A;  4ADD A;  4ADB A;  1AX4 A;  3TFT A;  2GB3 A;  5EAA A;  1B4X A;  4E3Q A;  4FL0 A;  2BIG A;  5F8V A;  1UU1 A;  5E5I A;  1GEW A;  4CVQ A;  1ASN A;  3MEB A;  4A00 A;  3NYS A;  3CAI A;  4FFC A;  3WCO A;  2YKU A;  1SZS A;  4MQQ A;  3N4R A;  2CST A;  1AHF A;  4BA5 A;  3MAD A;  3FFH A;  1J32 A;  4UOY A;  3GZC A;  2YKV A;  1ELU A;  2ZUK A;  1CQ8 A;  3DZZ A;  3DXW A;  3EI5 A;  4E3R A;  5IWQ A;  4WB0 A;  2A1V A;  2FNI A;  4ATP A;  3PD6 B;  1TOE A;  2WKA A;  2R5C B;  3DXV A;  4QGR A;  2W7L A;  4RLG A;  1VJO A;  3W1I A;  7AAT A;  2E7U A;  3DYD A;  4A6R A;  4ATQ A;  3WKS A;  5G4J A;  4ZDO A;  4PFF A;  4U1T A;  5HXX A;  3E2Z B;  5D5S A;  2VMO A;  4BA4 A;  1LC8 A;  1M4N A;  2AY4 A;  2VIB A;  3AOV A;  3RCH A;  4JF0 A;  3GJU A;  1VEF A;  4WXG A;  4F5G A;  2QSR A;  3II0 A;  3N0L A;  4Q31 A;  2YCP A;  5EFS A;  1N31 A;  4DGT A;  3MC6 C;  1AY5 A;  3EI7 A;  3PGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...