1W42A

T. celer l30e r92a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
b'MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESAILALGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w42A00
1VQMF 3V7QA 3E1YA 3NK6A 2LBXA 1X7PA 4LCKA 1PXWA 3PAFA 1NJIH 3E20B 3VI6A 2BO1A 5GINC 2OTJF 3O85A 2WALA 1S72F 2CZWA 1KQSF 1KC8H 3CPWF 3SIVA 3HJWC 2I6DA 1IPAA 4X3MA 2HVYD 3NVKE 5DCVA 3CCVF 1M90H 3CCMF 1K73H 5GIPC 2QEXF 1T0KB 3OW2F 1YIJF 1VQLF 2LBWA 3LWPC 1Q7YH 5FLXM 1YJWF 4TZZA 1VQ4F 3HAXD 3G6EF 4C4WC 1K9MH 1E7KA 1KD1H 3LFOA 3LWRC 1YI2F 3OBWA 1K8AH 1CN7A 2OHWA 3CXCF 2OTLF 2QI2A 3J81M 3LWOC 5EO3A 3V7EA 1VQOF 3G4SF 2FC3A 1W42A 3WXMB 3GYQA 1W2BF 4BW0B 1XBIA 2AIFA 3CCRF 4BY9D 3CCJF 1YHQF 3IR9A 3NVIB 1X7OA 2KG4A 1VQ6F 1SDSA 1YJ9F 1VQ8F 2QA4F 1M1KH 4NUTA 3CCQF 1VQ9F 3N4ZA 3PLAC 3G71F 3MCAB 3SIUA 1YJNF 1Q86H 1VQNF 1GZ0A 5EWRA 5GIOC 1Q82H 4X3LA 1RLGA 3CC4F 3JAMM 2KTVA 3CPQA 1DT9A 3JCMM 1GO0A 1QVFF 3RA5A 1N8RH 3AGKA 3NMUC 5GANK 3LWVC 1VQ5F 3CCSF 3VMFB 1W41A 5IT9M 5A2QM 1GO1A 3CD6F 1CK2A 1ZWZA 3CG6A 3NK7A 5G4UC 3CMAF 3I56F 3CC7F 3I55F 2JNBA 3N4YA 1X52A 3RA6A 1NMUB 3J7AR 1W40A 2KTUA 3CC2F 3CCUF 2VGNA 1Q81H 1RA4A 3CCEF 3FFMA 1H7MA 3ON1A 3CCLF 2VGMA 3OBYA 5FJ4C 3CMEF 1YITF 2ALEA 1W3EX 5G4VC 1VQKF 1VQ7F 1VQPF 3LWQC 2OZBA 1QVGF 1JJ2F 3J80M 5GAPK
chains in the Genus database with same CATH superfamily
4F6RA 3TD3A 3KHNA 1Q8RA 2LBXA 3FBAA 1W581 2WALA 5AVMA 3N2GB 1KC8H 3C9RA 2ZVYA 2I6DA 4BVSA 3RYFA 3VOAA 5CA1A 2HVYD 2RB9A 4YJ2B 3NVKE 2HX0A 3CCVF 1M90H 1COMA 4O2BB 5GIPC 4NQ3A 2Z01A 3OW2F 1VQLF 5CB4B 5HXUA 3WGJA 1OAPA 3TD4A 3EORA 5C8YB 4C8GA 3HKEB 2CVLA 3BYQA 1TVKB 4TV8A 5HY4A 3I7TA 3RYHA 3JAKB 1X25A 3JASB 1W42A 4C82A 4X1IB 4BW0B 2OTMA 1XBIA 2AIZP 2H6LA 3K2XA 2GVIA 3C8LA 3IR9A 4I4TB 3HWUA 2BTUA 2F9ZC 2DYYA 5HXZA 4TUYB 1RLUA 5JCOA 1IV2A 2QA4F 4O4HB 1ODEA 2FGYA 3CCQF 2CSLA 5JQGB 2CWJA 1GZ0A 2L26A 1FSZA 5LOVA 1PF5A 4ZOLB 1RLGA 4O4LB 3CC4F 2B33A 3LYBA 4X20B 3E22B 4IIJB 3JARB 3RA5A 3F0FA 2LCAA 3LWVC 1VQ5F 4F6RB 3S06A 1SA0A 1R1MA 4FFBB 1IV1A 1GO1A 1TUBB 1U3LA 3N2KB 3NK7A 5G4UC 2MQEA 3CMAF 5HP8A 5EB1B 4BVRA 1H48A 5LXTA 3QTYA 1W5EA 3WGLA 3J7AR 4BT4A 1RQ2A 3CC2F 2VGNA 4YJ2A 2QTPA 3FFMA 5CB4A 3ON1A 5C8YA 3RE3A 3ZO8A 5FJ4C 1YITF 1DBFA 3HKEA 4R40B 5MN4A 2RHOA 3HKDB 1VQPF 1TVKA 3S0HA 4BVTA 1QVGF 3JAKA 3M84A 1JJ2F 3J80M 4X1IA 4BY9D 4G4ZA 1GX1A 3MBMA 3V7QA 4I50A 3E1YA 3K12A 1X7PA 4B45A 4TUYA 3IKFA 3O85A 3C9TA 1KQSF 4EI7A 3V4DA 3SIVA 3HJWC 5LA6B 1IPAA 4X3MA 2CW4A 4ZOLA 1NQ3A 5LOVB 4O4LA 3D01A 5J2TA 2NMUA 2ZOVA 5BMVB 4X20A 2ZAUA 2Z1TA 3E22A 1QU9A 3KIZA 2KGWA 4IIJA 3JARA 2VAWA 1U43A 5ITZB 1YJWF 1VQ4F 3G6EF 4C4WC 1K9MH 3ZP7A 3LWRC 1XRGA 1UFYA 5EAZA 1SA0B 1YI2F 1K8AH 4FFBA 3ESJA 2OHWA 3N2KA 1TUBA 4ZK7A 2H8CA 1KNJA 1W5FA 1Z5WA 2QI2A 3I3FA 3JVHA 3LWOC 5EO3A 3V7EA 2GZLA 3V3TA 3G4SF 4G4VA 2UYJA 3F6MA 4IHJA 5LXTB 4PWTA 5JCOC 1W57A 3WPXA 3CYPB 3ERNA 1YHQF 3NVIB 1X7OA 3P0ZA 3QHDA 4EI8A 1YJ9F 2IAFA 3GHZA 2CHSA 4NUTA 3N4ZA 3PLAC 3HTNA 1J7HA 2R751 2HQSC 2G9IA 5B8FA 3UT5A 5EWRA 4BT7A 5IYZA 1Q82H 2Z1UA 3HKDA 3JAMM 2YYEA 5KMGA 1QD9A 2K1SA 1GO0A 2Z1FA 1QVFF 1N8RH 3Q8HA 4ZI7B 1ONIA 3D00A 2VXYA 3JATB 2ZF8A 3MCQA 3U0OA 4M8IA 1W41A 3ZOPA 5MN5A 4I50B 4C8IA 2R6R1 1OFUA 1CK2A 5MN6A 3RYIB 1VH8A 3N4YA 2IG8A 1X52A 1IV3A 3FD5A 3RA6A 5LA6A 1JFFB 4O2AB 3CCUF 1H47A 5BMVA 5J2TB 3CB2A 1KNKA 1VQVA 3HKBB 3CCLF 2VGMA 5LYJA 5ITZA 3T80A 3CMEF 1UI9A 3VTIC 2W8BC 5G4VC 5HY2A 4ZHQB 5LP6B 2RHJA 5J2UA 1JN1A 3IKEA 2HS3A 3C9UA 5HY0A 1QAHA 2CHTA 3VCZA 1W55A 5GAPK 4IHJB 3IMPA 2Z1EA 3M4SA 3NK6A 4KWEA 3VOBA 4LCKA 1PXWA 3RYCA 3ZP4A 3WJRA 1NJIH 3E20B 3VI6A 5GINC 4G4WA 3WPWA 3D54A 4E6EA 4DRXB 3CPWF 3UT5B 5DCVA 3F0GA 2EWCA 1VHAA 5IYZB 3CCMF 5EB0A 3VO8A 5GONB 5KMGB 2LBWA 5LP6C 2P6YA 3WJPA 5FLXM 1Q7YH 3KJJA 4O4JB 3VYUC 4ZI7A 4TZZA 1W5AA 3HAXD 2HP0A 3JATA 3LFOA 1CN7A 3CXCF 1Z5VA 3M1XA 2RHLA 3J81M 4C81A 1VQOF 2FC3A 3RYIA 4ERHA 3WXMB 1W2BF 2AIFA 3CCRF 2LBTA 2UYPA 2ZVZA 3DC2A 1JFFA 1YQNA 4O2AA 5KX5B 1VQ6F 3S0YA 3CYQA 5FNVB 5CA0B 3S02A 3MDOA 3GTZA 3HKBA 1M1KH 5IJ0B 1VQ9F 3S03A 4YJ3A 4EI9A 5LYJB 3MCAB 5IJ9B 3SIUA 1YJNF 1Q86H 1VQNF 2BTQB 3JALA 4ZHQA 5LP6A 1CLIA 5JVDB 1DT9A 5J2UB 4BVQA 3HKCB 2Q1YA 1FFXB 4U3JB 3IEQA 1RQ7A 5GANK 3NMUC 3CCSF 3VMFB 1FNJA 2VAPA 4RHAA 2H8EA 2Q1XA 5A2QM 3RYCB 1ZWZA 3MQWA 3CC7F 3I55F 4O4IB 2JNBA 1W59A 2HP3A 4LNUB 4DRXA 4ZHWA 1W40A 2V9YA 2KTUA 4HNAB 5EIBC 2GLZA 3CCEF 5GONA 3KJKA 3VYTC 2I6RA 3WGNA 4O4JA 4BT3A 3OBYA 3K0TA 3LMEA 2HP0B 2ALEA 1W3EX 4G4YA 3L7QA 2OZBA 4ZHYB 3P4EA 3VYSC 1VQMF 4TV9A 4RQOA 5EIBD 5KX5A 3PAFA 5FNVA 5CA0A 5EYPB 2BO1A 2OTJF 2YXZA 5IJ0A 2CZWA 2UYNB 3K14A 4B62A 3F0EA 1S72F 1U3PA 4YJ3B 5IJ9A 2HS4A 2PMPA 3C9SA 4X1KA 3WGKA 2AMTA 3JALB 3WGMA 1K73H 1T0KB 2QEXF 5JVDA 3VIUA 5EZYB 1YIJF 4X1YA 2N48A 3HKCA 3IEWA 3LWPC 1FFXA 1VK3A 4U3JA 1E7KA 3DDNA 1KD1H 3QUWA 3OBWA 2PHNA 4I55A 4EB6B 5JH7B 2OTLF 2RHHA 3FPIA 4BT2A 3F0DA 3JAWA 4WBNB 4O4IA 2UYKA 3GYQA 4LNUA 3CCJF 2KG4A 4HNAA 1SDSA 1VQ8F 1FNKA 2HRUA 2IQQA 3N2GA 4NWOB 3G71F 1YGYA 3RYFB 5CA1B 4G4XA 5GIOC 4O2BA 4X3LA 4B46A 2KTVA 3CPQA 4BT6A 3JCMM 1U40A 1SZQA 4ZHVA 1XHOA 2ZODA 3LDTA 3WJQA 5HWEA 3AGKA 4BT5A 2DT4A 3FD6A 4TV9B 1T0AA 4XCQA 3KE1A 5HP7A 5HY1A 2BTOA 5IT9M 4TV8B 5EYPA 3CD6F 3CG6A 4G88A 3RYHB 3JASA 3I56F 1JD1A 3R0PA 4C8EA 2UYNA 4I4TA 1NMUB 3OONA 1Q81H 4X1KB 1RA4A 2HRYA 1IV4A 3TD5A 5EZYA 1H7MA 4O4HA 3P10A 4X1YB 1W5BA 1XV2A 4B5CA 5JQGA 2UZHA 4U39A 1JY8A 1VQKF 1VQ7F 4EB6A 3B6NA 4I55B 5JH7A 3LWQC 3ELCA 2HS0A 4DXDA 3JAWB 4WBNA 2VAMA 3S0WA
chains in the Genus database with same CATH topology
1VQMF 3V7QA 3E1YA 3NK6A 2LBXA 1X7PA 4LCKA 1PXWA 3PAFA 1NJIH 3E20B 3VI6A 2BO1A 5GINC 2OTJF 3O85A 2WALA 1S72F 2CZWA 1KQSF 4EI7A 1KC8H 3CPWF 3SIVA 3HJWC 2I6DA 4BVSA 1IPAA 4X3MA 2HVYD 3NVKE 5DCVA 3CCVF 1M90H 3CCMF 1K73H 5GIPC 2QEXF 1T0KB 4NQ3A 3OW2F 1YIJF 1VQLF 2LBWA 3LWPC 1Q7YH 5FLXM 5HXUA 1YJWF 4TZZA 1VQ4F 3HAXD 3G6EF 4C4WC 1K9MH 1E7KA 1KD1H 3LFOA 3LWRC 1YI2F 3OBWA 1K8AH 1CN7A 2OHWA 3CXCF 5HY4A 2OTLF 2QI2A 3J81M 3LWOC 5EO3A 3V7EA 1VQOF 3V3TA 3G4SF 2FC3A 1W42A 3WXMB 3GYQA 1W2BF 4BW0B 1XBIA 2AIFA 3CCRF 4BY9D 3CCJF 1YHQF 3IR9A 3NVIB 1X7OA 2KG4A 1VQ6F 2F9ZC 4EI8A 1SDSA 5HXZA 1YJ9F 1VQ8F 2QA4F 1M1KH 4NUTA 2FGYA 3CCQF 1VQ9F 3N4ZA 3PLAC 4EI9A 3G71F 3MCAB 3SIUA 1YJNF 1Q86H 1VQNF 1GZ0A 5EWRA 5GIOC 1Q82H 4X3LA 1RLGA 3CC4F 3JAMM 2KTVA 3CPQA 1DT9A 3JCMM 4BVQA 1GO0A 1QVFF 5HWEA 3RA5A 1N8RH 3AGKA 3NMUC 3D00A 5GANK 3LWVC 1VQ5F 3CCSF 3VMFB 1W41A 4XCQA 5IT9M 5HY1A 5A2QM 1GO1A 3CD6F 1CK2A 1ZWZA 3CG6A 3NK7A 5G4UC 3CMAF 3I56F 3CC7F 3I55F 2JNBA 4BVRA 3N4YA 1X52A 3RA6A 1NMUB 3J7AR 1W40A 2KTUA 3CC2F 3CCUF 2VGNA 1Q81H 2GLZA 1RA4A 3CCEF 3FFMA 1H7MA 3ON1A 3CCLF 2VGMA 3OBYA 5FJ4C 3CMEF 1YITF 2ALEA 1W3EX 5G4VC 5HY2A 1VQKF 1VQ7F 1VQPF 3LWQC 2OZBA 4BVTA 1QVGF 1JJ2F 5HY0A 3J80M 5GAPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQM F;  3V7Q A;  3E1Y A;  3NK6 A;  2LBX A;  1X7P A;  4LCK A;  1PXW A;  3PAF A;  1NJI H;  3E20 B;  3VI6 A;  2BO1 A;  5GIN C;  2OTJ F;  3O85 A;  2WAL A;  1S72 F;  2CZW A;  1KQS F;  1KC8 H;  3CPW F;  3SIV A;  3HJW C;  2I6D A;  1IPA A;  4X3M A;  2HVY D;  3NVK E;  5DCV A;  3CCV F;  1M90 H;  3CCM F;  1K73 H;  5GIP C;  2QEX F;  1T0K B;  3OW2 F;  1YIJ F;  1VQL F;  2LBW A;  3LWP C;  1Q7Y H;  5FLX M;  1YJW F;  4TZZ A;  1VQ4 F;  3HAX D;  3G6E F;  4C4W C;  1K9M H;  1E7K A;  1KD1 H;  3LFO A;  3LWR C;  1YI2 F;  3OBW A;  1K8A H;  1CN7 A;  2OHW A;  3CXC F;  2OTL F;  2QI2 A;  3J81 M;  3LWO C;  5EO3 A;  3V7E A;  1VQO F;  3G4S F;  2FC3 A;  1W42 A;  3WXM B;  3GYQ A;  1W2B F;  4BW0 B;  1XBI A;  2AIF A;  3CCR F;  4BY9 D;  3CCJ F;  1YHQ F;  3IR9 A;  3NVI B;  1X7O A;  2KG4 A;  1VQ6 F;  1SDS A;  1YJ9 F;  1VQ8 F;  2QA4 F;  1M1K H;  4NUT A;  3CCQ F;  1VQ9 F;  3N4Z A;  3PLA C;  3G71 F;  3MCA B;  3SIU A;  1YJN F;  1Q86 H;  1VQN F;  1GZ0 A;  5EWR A;  5GIO C;  1Q82 H;  4X3L A;  1RLG A;  3CC4 F;  3JAM M;  2KTV A;  3CPQ A;  1DT9 A;  3JCM M;  1GO0 A;  1QVF F;  3RA5 A;  1N8R H;  3AGK A;  3NMU C;  5GAN K;  3LWV C;  1VQ5 F;  3CCS F;  3VMF B;  1W41 A;  5IT9 M;  5A2Q M;  1GO1 A;  3CD6 F;  1CK2 A;  1ZWZ A;  3CG6 A;  3NK7 A;  5G4U C;  3CMA F;  3I56 F;  3CC7 F;  3I55 F;  2JNB A;  3N4Y A;  1X52 A;  3RA6 A;  1NMU B;  3J7A R;  1W40 A;  2KTU A;  3CC2 F;  3CCU F;  2VGN A;  1Q81 H;  1RA4 A;  3CCE F;  3FFM A;  1H7M A;  3ON1 A;  3CCL F;  2VGM A;  3OBY A;  5FJ4 C;  3CME F;  1YIT F;  2ALE A;  1W3E X;  5G4V C;  1VQK F;  1VQ7 F;  1VQP F;  3LWQ C;  2OZB A;  1QVG F;  1JJ2 F;  3J80 M;  5GAP K; 
#chains in the Genus database with same CATH topology
 4F6R A;  3TD3 A;  3KHN A;  1Q8R A;  2LBX A;  3FBA A;  1W58 1;  2WAL A;  5AVM A;  3N2G B;  1KC8 H;  3C9R A;  2ZVY A;  2I6D A;  4BVS A;  3RYF A;  3VOA A;  5CA1 A;  2HVY D;  2RB9 A;  4YJ2 B;  3NVK E;  2HX0 A;  3CCV F;  1M90 H;  1COM A;  4O2B B;  5GIP C;  4NQ3 A;  2Z01 A;  3OW2 F;  1VQL F;  5CB4 B;  5HXU A;  3WGJ A;  1OAP A;  3TD4 A;  3EOR A;  5C8Y B;  4C8G A;  3HKE B;  2CVL A;  3BYQ A;  1TVK B;  4TV8 A;  5HY4 A;  3I7T A;  3RYH A;  3JAK B;  1X25 A;  3JAS B;  1W42 A;  4C82 A;  4X1I B;  4BW0 B;  2OTM A;  1XBI A;  2AIZ P;  2H6L A;  3K2X A;  2GVI A;  3C8L A;  3IR9 A;  4I4T B;  3HWU A;  2BTU A;  2F9Z C;  2DYY A;  5HXZ A;  4TUY B;  1RLU A;  5JCO A;  1IV2 A;  2QA4 F;  4O4H B;  1ODE A;  2FGY A;  3CCQ F;  2CSL A;  5JQG B;  2CWJ A;  1GZ0 A;  2L26 A;  1FSZ A;  5LOV A;  1PF5 A;  4ZOL B;  1RLG A;  4O4L B;  3CC4 F;  2B33 A;  3LYB A;  4X20 B;  3E22 B;  4IIJ B;  3JAR B;  3RA5 A;  3F0F A;  2LCA A;  3LWV C;  1VQ5 F;  4F6R B;  3S06 A;  1SA0 A;  1R1M A;  4FFB B;  1IV1 A;  1GO1 A;  1TUB B;  1U3L A;  3N2K B;  3NK7 A;  5G4U C;  2MQE A;  3CMA F;  5HP8 A;  5EB1 B;  4BVR A;  1H48 A;  5LXT A;  3QTY A;  1W5E A;  3WGL A;  3J7A R;  4BT4 A;  1RQ2 A;  3CC2 F;  2VGN A;  4YJ2 A;  2QTP A;  3FFM A;  5CB4 A;  3ON1 A;  5C8Y A;  3RE3 A;  3ZO8 A;  5FJ4 C;  1YIT F;  1DBF A;  3HKE A;  4R40 B;  5MN4 A;  2RHO A;  3HKD B;  1VQP F;  1TVK A;  3S0H A;  4BVT A;  1QVG F;  3JAK A;  3M84 A;  1JJ2 F;  3J80 M;  4X1I A;  4BY9 D;  4G4Z A;  1GX1 A;  3MBM A;  3V7Q A;  4I50 A;  3E1Y A;  3K12 A;  1X7P A;  4B45 A;  4TUY A;  3IKF A;  3O85 A;  3C9T A;  1KQS F;  4EI7 A;  3V4D A;  3SIV A;  3HJW C;  5LA6 B;  1IPA A;  4X3M A;  2CW4 A;  4ZOL A;  1NQ3 A;  5LOV B;  4O4L A;  3D01 A;  5J2T A;  2NMU A;  2ZOV A;  5BMV B;  4X20 A;  2ZAU A;  2Z1T A;  3E22 A;  1QU9 A;  3KIZ A;  2KGW A;  4IIJ A;  3JAR A;  2VAW A;  1U43 A;  5ITZ B;  1YJW F;  1VQ4 F;  3G6E F;  4C4W C;  1K9M H;  3ZP7 A;  3LWR C;  1XRG A;  1UFY A;  5EAZ A;  1SA0 B;  1YI2 F;  1K8A H;  4FFB A;  3ESJ A;  2OHW A;  3N2K A;  1TUB A;  4ZK7 A;  2H8C A;  1KNJ A;  1W5F A;  1Z5W A;  2QI2 A;  3I3F A;  3JVH A;  3LWO C;  5EO3 A;  3V7E A;  2GZL A;  3V3T A;  3G4S F;  4G4V A;  2UYJ A;  3F6M A;  4IHJ A;  5LXT B;  4PWT A;  5JCO C;  1W57 A;  3WPX A;  3CYP B;  3ERN A;  1YHQ F;  3NVI B;  1X7O A;  3P0Z A;  3QHD A;  4EI8 A;  1YJ9 F;  2IAF A;  3GHZ A;  2CHS A;  4NUT A;  3N4Z A;  3PLA C;  3HTN A;  1J7H A;  2R75 1;  2HQS C;  2G9I A;  5B8F A;  3UT5 A;  5EWR A;  4BT7 A;  5IYZ A;  1Q82 H;  2Z1U A;  3HKD A;  3JAM M;  2YYE A;  5KMG A;  1QD9 A;  2K1S A;  1GO0 A;  2Z1F A;  1QVF F;  1N8R H;  3Q8H A;  4ZI7 B;  1ONI A;  3D00 A;  2VXY A;  3JAT B;  2ZF8 A;  3MCQ A;  3U0O A;  4M8I A;  1W41 A;  3ZOP A;  5MN5 A;  4I50 B;  4C8I A;  2R6R 1;  1OFU A;  1CK2 A;  5MN6 A;  3RYI B;  1VH8 A;  3N4Y A;  2IG8 A;  1X52 A;  1IV3 A;  3FD5 A;  3RA6 A;  5LA6 A;  1JFF B;  4O2A B;  3CCU F;  1H47 A;  5BMV A;  5J2T B;  3CB2 A;  1KNK A;  1VQV A;  3HKB B;  3CCL F;  2VGM A;  5LYJ A;  5ITZ A;  3T80 A;  3CME F;  1UI9 A;  3VTI C;  2W8B C;  5G4V C;  5HY2 A;  4ZHQ B;  5LP6 B;  2RHJ A;  5J2U A;  1JN1 A;  3IKE A;  2HS3 A;  3C9U A;  5HY0 A;  1QAH A;  2CHT A;  3VCZ A;  1W55 A;  5GAP K;  4IHJ B;  3IMP A;  2Z1E A;  3M4S A;  3NK6 A;  4KWE A;  3VOB A;  4LCK A;  1PXW A;  3RYC A;  3ZP4 A;  3WJR A;  1NJI H;  3E20 B;  3VI6 A;  5GIN C;  4G4W A;  3WPW A;  3D54 A;  4E6E A;  4DRX B;  3CPW F;  3UT5 B;  5DCV A;  3F0G A;  2EWC A;  1VHA A;  5IYZ B;  3CCM F;  5EB0 A;  3VO8 A;  5GON B;  5KMG B;  2LBW A;  5LP6 C;  2P6Y A;  3WJP A;  5FLX M;  1Q7Y H;  3KJJ A;  4O4J B;  3VYU C;  4ZI7 A;  4TZZ A;  1W5A A;  3HAX D;  2HP0 A;  3JAT A;  3LFO A;  1CN7 A;  3CXC F;  1Z5V A;  3M1X A;  2RHL A;  3J81 M;  4C81 A;  1VQO F;  2FC3 A;  3RYI A;  4ERH A;  3WXM B;  1W2B F;  2AIF A;  3CCR F;  2LBT A;  2UYP A;  2ZVZ A;  3DC2 A;  1JFF A;  1YQN A;  4O2A A;  5KX5 B;  1VQ6 F;  3S0Y A;  3CYQ A;  5FNV B;  5CA0 B;  3S02 A;  3MDO A;  3GTZ A;  3HKB A;  1M1K H;  5IJ0 B;  1VQ9 F;  3S03 A;  4YJ3 A;  4EI9 A;  5LYJ B;  3MCA B;  5IJ9 B;  3SIU A;  1YJN F;  1Q86 H;  1VQN F;  2BTQ B;  3JAL A;  4ZHQ A;  5LP6 A;  1CLI A;  5JVD B;  1DT9 A;  5J2U B;  4BVQ A;  3HKC B;  2Q1Y A;  1FFX B;  4U3J B;  3IEQ A;  1RQ7 A;  5GAN K;  3NMU C;  3CCS F;  3VMF B;  1FNJ A;  2VAP A;  4RHA A;  2H8E A;  2Q1X A;  5A2Q M;  3RYC B;  1ZWZ A;  3MQW A;  3CC7 F;  3I55 F;  4O4I B;  2JNB A;  1W59 A;  2HP3 A;  4LNU B;  4DRX A;  4ZHW A;  1W40 A;  2V9Y A;  2KTU A;  4HNA B;  5EIB C;  2GLZ A;  3CCE F;  5GON A;  3KJK A;  3VYT C;  2I6R A;  3WGN A;  4O4J A;  4BT3 A;  3OBY A;  3K0T A;  3LME A;  2HP0 B;  2ALE A;  1W3E X;  4G4Y A;  3L7Q A;  2OZB A;  4ZHY B;  3P4E A;  3VYS C;  1VQM F;  4TV9 A;  4RQO A;  5EIB D;  5KX5 A;  3PAF A;  5FNV A;  5CA0 A;  5EYP B;  2BO1 A;  2OTJ F;  2YXZ A;  5IJ0 A;  2CZW A;  2UYN B;  3K14 A;  4B62 A;  3F0E A;  1S72 F;  1U3P A;  4YJ3 B;  5IJ9 A;  2HS4 A;  2PMP A;  3C9S A;  4X1K A;  3WGK A;  2AMT A;  3JAL B;  3WGM A;  1K73 H;  1T0K B;  2QEX F;  5JVD A;  3VIU A;  5EZY B;  1YIJ F;  4X1Y A;  2N48 A;  3HKC A;  3IEW A;  3LWP C;  1FFX A;  1VK3 A;  4U3J A;  1E7K A;  3DDN A;  1KD1 H;  3QUW A;  3OBW A;  2PHN A;  4I55 A;  4EB6 B;  5JH7 B;  2OTL F;  2RHH A;  3FPI A;  4BT2 A;  3F0D A;  3JAW A;  4WBN B;  4O4I A;  2UYK A;  3GYQ A;  4LNU A;  3CCJ F;  2KG4 A;  4HNA A;  1SDS A;  1VQ8 F;  1FNK A;  2HRU A;  2IQQ A;  3N2G A;  4NWO B;  3G71 F;  1YGY A;  3RYF B;  5CA1 B;  4G4X A;  5GIO C;  4O2B A;  4X3L A;  4B46 A;  2KTV A;  3CPQ A;  4BT6 A;  3JCM M;  1U40 A;  1SZQ A;  4ZHV A;  1XHO A;  2ZOD A;  3LDT A;  3WJQ A;  5HWE A;  3AGK A;  4BT5 A;  2DT4 A;  3FD6 A;  4TV9 B;  1T0A A;  4XCQ A;  3KE1 A;  5HP7 A;  5HY1 A;  2BTO A;  5IT9 M;  4TV8 B;  5EYP A;  3CD6 F;  3CG6 A;  4G88 A;  3RYH B;  3JAS A;  3I56 F;  1JD1 A;  3R0P A;  4C8E A;  2UYN A;  4I4T A;  1NMU B;  3OON A;  1Q81 H;  4X1K B;  1RA4 A;  2HRY A;  1IV4 A;  3TD5 A;  5EZY A;  1H7M A;  4O4H A;  3P10 A;  4X1Y B;  1W5B A;  1XV2 A;  4B5C A;  5JQG A;  2UZH A;  4U39 A;  1JY8 A;  1VQK F;  1VQ7 F;  4EB6 A;  3B6N A;  4I55 B;  5JH7 A;  3LWQ C;  3ELC A;  2HS0 A;  4DXD A;  3JAW B;  4WBN A;  2VAM A;  3S0W A; 
#chains in the Genus database with same CATH homology
 1VQM F;  3V7Q A;  3E1Y A;  3NK6 A;  2LBX A;  1X7P A;  4LCK A;  1PXW A;  3PAF A;  1NJI H;  3E20 B;  3VI6 A;  2BO1 A;  5GIN C;  2OTJ F;  3O85 A;  2WAL A;  1S72 F;  2CZW A;  1KQS F;  4EI7 A;  1KC8 H;  3CPW F;  3SIV A;  3HJW C;  2I6D A;  4BVS A;  1IPA A;  4X3M A;  2HVY D;  3NVK E;  5DCV A;  3CCV F;  1M90 H;  3CCM F;  1K73 H;  5GIP C;  2QEX F;  1T0K B;  4NQ3 A;  3OW2 F;  1YIJ F;  1VQL F;  2LBW A;  3LWP C;  1Q7Y H;  5FLX M;  5HXU A;  1YJW F;  4TZZ A;  1VQ4 F;  3HAX D;  3G6E F;  4C4W C;  1K9M H;  1E7K A;  1KD1 H;  3LFO A;  3LWR C;  1YI2 F;  3OBW A;  1K8A H;  1CN7 A;  2OHW A;  3CXC F;  5HY4 A;  2OTL F;  2QI2 A;  3J81 M;  3LWO C;  5EO3 A;  3V7E A;  1VQO F;  3V3T A;  3G4S F;  2FC3 A;  1W42 A;  3WXM B;  3GYQ A;  1W2B F;  4BW0 B;  1XBI A;  2AIF A;  3CCR F;  4BY9 D;  3CCJ F;  1YHQ F;  3IR9 A;  3NVI B;  1X7O A;  2KG4 A;  1VQ6 F;  2F9Z C;  4EI8 A;  1SDS A;  5HXZ A;  1YJ9 F;  1VQ8 F;  2QA4 F;  1M1K H;  4NUT A;  2FGY A;  3CCQ F;  1VQ9 F;  3N4Z A;  3PLA C;  4EI9 A;  3G71 F;  3MCA B;  3SIU A;  1YJN F;  1Q86 H;  1VQN F;  1GZ0 A;  5EWR A;  5GIO C;  1Q82 H;  4X3L A;  1RLG A;  3CC4 F;  3JAM M;  2KTV A;  3CPQ A;  1DT9 A;  3JCM M;  4BVQ A;  1GO0 A;  1QVF F;  5HWE A;  3RA5 A;  1N8R H;  3AGK A;  3NMU C;  3D00 A;  5GAN K;  3LWV C;  1VQ5 F;  3CCS F;  3VMF B;  1W41 A;  4XCQ A;  5IT9 M;  5HY1 A;  5A2Q M;  1GO1 A;  3CD6 F;  1CK2 A;  1ZWZ A;  3CG6 A;  3NK7 A;  5G4U C;  3CMA F;  3I56 F;  3CC7 F;  3I55 F;  2JNB A;  4BVR A;  3N4Y A;  1X52 A;  3RA6 A;  1NMU B;  3J7A R;  1W40 A;  2KTU A;  3CC2 F;  3CCU F;  2VGN A;  1Q81 H;  2GLZ A;  1RA4 A;  3CCE F;  3FFM A;  1H7M A;  3ON1 A;  3CCL F;  2VGM A;  3OBY A;  5FJ4 C;  3CME F;  1YIT F;  2ALE A;  1W3E X;  5G4V C;  5HY2 A;  1VQK F;  1VQ7 F;  1VQP F;  3LWQ C;  2OZB A;  4BVT A;  1QVG F;  1JJ2 F;  5HY0 A;  3J80 M;  5GAP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...