1W42A

T. celer l30e r92a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESAILALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
molecule keywords 50S RIBOSOMAL PROTEIN L30E
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w42A00
3O85A 2LBXA 1W40A 2KG4A 3LWOC 3E20B 1KC8H 2I6DA 5FLXM 3OBYA 3V7EA 2KTUA 2QI2A 3JAMM 1H7MA 1GZ0A 1QVGF 4C4WC 3GYQA 1RLGA 3J80M 3G71F 1Q82H 1XBIA 3LWQC 3FFMA 3CCRF 2OHWA 3J7AR 3CMEF 3RA5A 1PXWA 3CD6F 1K73H 1VQ5F 3NVIB 5GAPK 3PLAC 3CXCF 1VQ9F 2LBWA 1X52A 3I56F 3WXMB 2WALA 1KD1H 3CC4F 1VQMF 1K9MH 3JCMM 3CCVF 3RA6A 4LCKA 1DT9A 3CPQA 1M90H 1GO0A 1X7PA 1YJWF 1YJ9F 1VQKF 1VQNF 4BW0B 5GANK 3CMAF 4X3MA 1X7OA 2QEXF 1T0KB 1W3EX 1YHQF 1VQLF 2KTVA 1YITF 3LWRC 1W41A 2VGMA 2CZWA 1YI2F 1E7KA 5DCVA 3G4SF 4NUTA 3PAFA 1GO1A 1KQSF 1QVFF 3VMFB 1S72F 5FJ4C 3NK6A 3OW2F 3CCMF 1CN7A 1Q86H 1VQ6F 3NMUC 3CCQF 5G4VC 3SIUA 5EO3A 1Q81H 3V7QA 2OTJF 3CCJF 1RA4A 2JNBA 5G4UC 3CG6A 2OTLF 3HAXD 5GIOC 3N4ZA 2BO1A 1VQ8F 4X3LA 3CC2F 1JJ2F 5EWRA 3CCUF 4BY9D 3SIVA 3J81M 3OBWA 3LFOA 1NMUB 5A2QM 3ON1A 3I55F 2VGNA 5GIPC 3HJWC 3E1YA 3CPWF 3IR9A 3CCEF 1CK2A 2AIFA 4TZZA 3CC7F 1ZWZA 2HVYD 3NK7A 2OZBA 1VQ4F 1NJIH 3CCLF 1Q7YH 5GINC 1N8RH 1IPAA 1YIJF 1YJNF 1W42A 2QA4F 3G6EF 5IT9M 3N4YA 3CCSF 1VQ7F 1SDSA 3LWPC 1M1KH 3MCAB 3LWVC 2ALEA 1VQPF 3VI6A 1K8AH 2FC3A 1W2BF 3AGKA 1VQOF 3NVKE
chains in the Genus database with same CATH superfamily
3C9TA 3O85A 4BT2A 5LA6B 4BT7A 2KG4A 3LWOC 1KC8H 5FLXM 4M8IA 2KTUA 3JAMM 2HS3A 3RYFA 1QVGF 2Z1TA 3UT5B 3C9RA 3HWUA 1W581 5BMVB 2PMPA 1Q82H 1XBIA 2RHOA 1CLIA 3K0TA 3GTZA 3I3FA 2G9IA 3Q8HA 1TUBB 3RA5A 1Z5VA 2ZVYA 3LYBA 1VQ5F 2Z1FA 4FFBA 3CXCF 3I56F 1VK3A 1VQMF 3VYTC 2VAMA 3CCVF 4G4YA 4LCKA 2VAPA 3CPQA 3IKFA 5KMGA 3N2GB 2HX0A 1GO0A 3FPIA 4BVTA 4BW0B 5IJ9A 5MN6A 3KE1A 4X3MA 1X7OA 5LP6C 3KJJA 3VCZA 1T0KB 4G4ZA 1YITF 3N2KB 1W55A 2VGMA 1PF5A 4TV8A 5LXTA 1YI2F 5JH7A 5DCVA 2DYYA 4ZOLA 5LOVB 4EI9A 1W59A 3D00A 3JAWB 4ERHA 1KQSF 4X1IA 3ZP4A 3VMFB 1XHOA 2YYEA 2HRYA 5EZYA 3NK6A 3F6MA 2Z1UA 3JASB 3RYFB 1NQ3A 5LYJA 5HY2A 4TV8B 3IKEA 5KX5A 4X1KB 2FGYA 3S02A 4B46A 4F6RB 5G4VC 2HQSC 1X25A 2JNBA 4EI7A 4G4VA 2CHSA 3KHNA 3S0HA 3N4ZA 3HAXD 4X20A 4ZHWA 3L7QA 1VQ8F 4C8GA 3CC2F 3WJQA 3VTIC 2BTUA 1JJ2F 2OTMA 3S0YA 3LFOA 5CA0A 3ON1A 1XV2A 1DBFA 1W5BA 2VGNA 3HJWC 4O2AB 3M4SA 2AIZP 3HKCA 3VIUA 4I55A 3HKEB 2ZAUA 3P4EA 5ITZB 1U3LA 4IHJB 4ZHQA 3CYQA 3ESJA 2HVYD 1XRGA 2OZBA 1VH8A 3MDOA 1IV3A 1N8RH 3M1XA 1IPAA 3KIZA 4DRXB 3N4YA 4RQOA 1VQ7F 3LWVC 1FNJA 4I4TB 4O4JA 3S03A 4O4HB 1U3PA 5HY0A 1VQOF 5CA1A 2RHJA 2ZF8A 3E20B 3LMEA 5EB0A 3S06A 2I6RA 3HKEA 4I55B 2B33A 2QI2A 1H7MA 1R1MA 3F0FA 1IV1A 2ZVZA 3IEQA 1W5AA 4G4XA 5FNVB 5C8YB 4O4IB 3FFMA 4U39A 3LDTA 3CMEF 3WGNA 3RYHB 4O4HA 3F0DA 2UYNA 1K73H 4RHAA 1JY8A 5GAPK 3HKCB 3V3TA 2DT4A 3JATB 2H8EA 3T80A 1KD1H 3D01A 5B8FA 3CC4F 1K9MH 5GONA 4I4TA 1DT9A 4O4JB 3TD5A 4TV9A 2RHLA 1ODEA 5HY4A 5MN4A 5CB4A 3HKDA 1KNJA 4YJ2A 4EB6A 3CMAF 1JFFA 2Q1YA 2QEXF 5C8YA 5J2UA 3JVHA 3LWRC 3ZOPA 1E7KA 2P6YA 4NUTA 1QVFF 2GVIA 4IIJA 5BMVA 4BT5A 3ZP7A 4C8EA 5FJ4C 3OW2F 1CN7A 1VQ6F 1RLUA 5GONB 3NMUC 2Z1EA 3SIUA 3HKBB 3JASA 4B5CA 1VQVA 3CCJF 3MCQA 3RYIB 3P0ZA 5LP6A 3CG6A 3RYHA 5LYJB 5GIOC 4NQ3A 5EYPB 2PHNA 3VO8A 4ZOLB 5EYPA 2RHHA 5EWRA 3JAWA 3WGMA 5HP8A 3IMPA 1NMUB 1FSZA 5A2QM 3I55F 3E1YA 3IEWA 4YJ2B 4NWOB 2AIFA 4ZHYB 4TZZA 3K14A 3WGJA 4BT4A 3NK7A 1IV4A 3QUWA 1JFFB 1NJIH 1Q7YH 1T0AA 2ZOVA 5GINC 3N2GA 2HS4A 2H8CA 1W42A 3E22B 3RYIA 5LP6B 2VXYA 3FD5A 1SDSA 3LWPC 3HKBA 1M1KH 3WJPA 1IV2A 3OONA 5J2TA 3VI6A 3VOBA 1W2BF 2LBTA 3NVKE 5JVDB 1W40A 5ITZA 2BTQB 4G4WA 2F9ZC 2I6DA 3V7EA 2Q1XA 3UT5A 2EWCA 4HNAB 4C4WC 3GYQA 1RLGA 2V9YA 1W5FA 4YJ3B 5IYZB 4KWEA 5LA6A 3CCRF 3PLAC 1JD1A 2HP0A 1VQ9F 2LBWA 1X52A 3F0GA 4XCQA 4TUYB 4WBNB 1OAPA 4C82A 1UI9A 3RYCA 5KX5B 2BTOA 2HP3A 5MN5A 3VYSC 5IJ0A 3JATA 1X7PA 3HTNA 5JQGB 2Z01A 3C9SA 1VQNF 2IG8A 3DDNA 4BVSA 5EIBC 4IHJA 4ZHQB 2KTVA 5CA0B 3ZO8A 4C8IA 3WPXA 5JQGA 4EI8A 4TV9B 3JARA 3K12A 4PWTA 3JALB 2CW4A 1SZQA 4WBNA 2R751 2UYKA 1U43A 4BT6A 1S72F 4HNAA 2HP0B 3RE3A 2RB9A 2UYNB 1YQNA 4G88A 4I50A 3P10A 1Q81H 3V7QA 2OTJF 2UYPA 1H47A 5EAZA 1RA4A 4FFBB 5FNVA 5AVMA 1UFYA 2BO1A 1W57A 3C9UA 4O4LA 5HY1A 5LOVA 5HP7A 4X20B 4BY9D 4B45A 3OBWA 3MBMA 5CA1B 5EB1B 1J7HA 5GIPC 2GZLA 1FNKA 2ZODA 3IR9A 2KGWA 3CCEF 3QTYA 4F6RA 1SA0B 1Q8RA 1VQ4F 1ONIA 5EZYB 3E22A 4X1YA 2W8BC 4IIJB 1YJNF 4R40B 5IT9M 4E6EA 3MCAB 2ALEA 2QTPA 1VQPF 1K8AH 1KNKA 5JVDA 3F0EA 3ERNA 1RQ2A 2LBXA 2CSLA 3CB2A 4ZI7A 3OBYA 3DC2A 5CB4B 3GHZA 1GZ0A 5JH7B 4BVRA 1TVKB 3V4DA 3FD6A 5JCOC 2CVLA 1TVKA 3J80M 3G71F 1COMA 2IQQA 4ZK7A 3C8LA 3LWQC 4BT3A 2OHWA 3J7AR 3B6NA 4ZI7B 5IJ9B 1PXWA 4X1KA 3CD6F 3NVIB 5J2UB 1TUBA 2WALA 3VOAA 3WXMB 5KMGB 3JCMM 1QAHA 3RA6A 5HWEA 1M90H 3WGLA 3WGKA 1YGYA 4C81A 4O4LB 4U3JA 1YJWF 2AMTA 1YJ9F 1VQKF 2CHTA 4X1YB 5GANK 3S0WA 4O2BA 1JN1A 1FFXB 1W3EX 4EB6B 1YHQF 1VQLF 3D54A 5JCOA 2UYJA 3ELCA 1W41A 2K1SA 2CZWA 1VHAA 2NMUA 3G4SF 2HS0A 5EIBD 3JALA 5HXZA 3PAFA 2YXZA 2IAFA 1GO1A 3TD4A 4DRXA 3JARB 2R6R1 4U3JB 3CCMF 1H48A 4DXDA 4I50B 2VAWA 3WJRA 1Q86H 3FBAA 3CCQF 5EO3A 3VYUC 1W5EA 2L26A 2MQEA 3R0PA 4O4IA 3JAKA 4LNUA 4B62A 3HKDB 3M84A 5G4UC 1U40A 3TD3A 5J2TB 2OTLF 3EORA 5IJ0B 1GX1A 1Z5WA 3K2XA 4X3LA 4YJ3A 5IYZA 2N48A 3CCUF 3SIVA 3J81M 1SA0A 2CWJA 2UZHA 3CYPB 3CPWF 4BVQA 2H6LA 1CK2A 3CC7F 1RQ7A 1ZWZA 5HXUA 4O2BB 3CCLF 1QD9A 3KJKA 4X1IB 1YIJF 3WPWA 2QA4F 3G6EF 3QHDA 4LNUB 2HRUA 3JAKB 3CCSF 3BYQA 3RYCB 5LXTB 2FC3A 2GLZA 3MQWA 4TUYA 3N2KA 3U0OA 1QU9A 4ZHVA 3I7TA 3AGKA 4O2AA 2LCAA 1FFXA 1OFUA
chains in the Genus database with same CATH topology
3O85A 2LBXA 1W40A 2KG4A 3LWOC 3E20B 1KC8H 2F9ZC 2I6DA 5FLXM 3OBYA 3V7EA 2KTUA 2QI2A 3JAMM 1H7MA 1GZ0A 1QVGF 4BVRA 4C4WC 3GYQA 1RLGA 3J80M 3G71F 1Q82H 1XBIA 3LWQC 3FFMA 3CCRF 2OHWA 3J7AR 3CMEF 3RA5A 1PXWA 3CD6F 1K73H 1VQ5F 3NVIB 5GAPK 3PLAC 3CXCF 3V3TA 1VQ9F 2LBWA 1X52A 4XCQA 3WXMB 2WALA 3I56F 1KD1H 1VQMF 3CC4F 1K9MH 3JCMM 3CCVF 3RA6A 4LCKA 1DT9A 3CPQA 5HWEA 1M90H 1GO0A 1X7PA 5HY4A 1YJWF 1YJ9F 4BVTA 1VQKF 1VQNF 4BW0B 5GANK 3CMAF 4X3MA 1X7OA 2QEXF 4BVSA 1W3EX 1T0KB 1YHQF 1VQLF 2KTVA 1YITF 3LWRC 1W41A 2VGMA 2CZWA 1YI2F 1E7KA 4EI8A 5DCVA 3G4SF 5HXZA 4NUTA 4EI9A 3PAFA 1GO1A 3D00A 1KQSF 1QVFF 3VMFB 1S72F 5FJ4C 3NK6A 5HY2A 3OW2F 3CCMF 1CN7A 1Q86H 1VQ6F 2FGYA 3NMUC 3CCQF 5G4VC 3SIUA 5EO3A 1Q81H 3V7QA 2OTJF 3CCJF 1RA4A 2JNBA 5G4UC 4EI7A 3CG6A 2OTLF 3HAXD 5GIOC 3N4ZA 2BO1A 4NQ3A 1VQ8F 5HY1A 4X3LA 3CC2F 1JJ2F 5EWRA 3CCUF 4BY9D 3SIVA 3J81M 3OBWA 3LFOA 1NMUB 5A2QM 3ON1A 3I55F 2VGNA 5GIPC 3HJWC 3E1YA 3CPWF 4BVQA 3IR9A 3CCEF 1CK2A 2AIFA 4TZZA 3CC7F 1ZWZA 5HXUA 3NK7A 2HVYD 1VQ4F 2OZBA 1NJIH 3CCLF 1Q7YH 5GINC 1N8RH 1IPAA 1YIJF 1YJNF 1W42A 2QA4F 3G6EF 5IT9M 3N4YA 3CCSF 1VQ7F 1SDSA 3LWPC 1M1KH 3MCAB 3LWVC 2ALEA 1VQPF 3VI6A 1K8AH 2FC3A 2GLZA 1W2BF 3AGKA 5HY0A 1VQOF 3NVKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O85 A;  2LBX A;  1W40 A;  2KG4 A;  3LWO C;  3E20 B;  1KC8 H;  2I6D A;  5FLX M;  3OBY A;  3V7E A;  2KTU A;  2QI2 A;  3JAM M;  1H7M A;  1GZ0 A;  1QVG F;  4C4W C;  3GYQ A;  1RLG A;  3J80 M;  3G71 F;  1Q82 H;  1XBI A;  3LWQ C;  3FFM A;  3CCR F;  2OHW A;  3J7A R;  3CME F;  3RA5 A;  1PXW A;  3CD6 F;  1K73 H;  1VQ5 F;  3NVI B;  5GAP K;  3PLA C;  3CXC F;  1VQ9 F;  2LBW A;  1X52 A;  3I56 F;  3WXM B;  2WAL A;  1KD1 H;  3CC4 F;  1VQM F;  1K9M H;  3JCM M;  3CCV F;  3RA6 A;  4LCK A;  1DT9 A;  3CPQ A;  1M90 H;  1GO0 A;  1X7P A;  1YJW F;  1YJ9 F;  1VQK F;  1VQN F;  4BW0 B;  5GAN K;  3CMA F;  4X3M A;  1X7O A;  2QEX F;  1T0K B;  1W3E X;  1YHQ F;  1VQL F;  2KTV A;  1YIT F;  3LWR C;  1W41 A;  2VGM A;  2CZW A;  1YI2 F;  1E7K A;  5DCV A;  3G4S F;  4NUT A;  3PAF A;  1GO1 A;  1KQS F;  1QVF F;  3VMF B;  1S72 F;  5FJ4 C;  3NK6 A;  3OW2 F;  3CCM F;  1CN7 A;  1Q86 H;  1VQ6 F;  3NMU C;  3CCQ F;  5G4V C;  3SIU A;  5EO3 A;  1Q81 H;  3V7Q A;  2OTJ F;  3CCJ F;  1RA4 A;  2JNB A;  5G4U C;  3CG6 A;  2OTL F;  3HAX D;  5GIO C;  3N4Z A;  2BO1 A;  1VQ8 F;  4X3L A;  3CC2 F;  1JJ2 F;  5EWR A;  3CCU F;  4BY9 D;  3SIV A;  3J81 M;  3OBW A;  3LFO A;  1NMU B;  5A2Q M;  3ON1 A;  3I55 F;  2VGN A;  5GIP C;  3HJW C;  3E1Y A;  3CPW F;  3IR9 A;  3CCE F;  1CK2 A;  2AIF A;  4TZZ A;  3CC7 F;  1ZWZ A;  2HVY D;  3NK7 A;  2OZB A;  1VQ4 F;  1NJI H;  3CCL F;  1Q7Y H;  5GIN C;  1N8R H;  1IPA A;  1YIJ F;  1YJN F;  1W42 A;  2QA4 F;  3G6E F;  5IT9 M;  3N4Y A;  3CCS F;  1VQ7 F;  1SDS A;  3LWP C;  1M1K H;  3MCA B;  3LWV C;  2ALE A;  1VQP F;  3VI6 A;  1K8A H;  2FC3 A;  1W2B F;  3AGK A;  1VQO F;  3NVK E; 
#chains in the Genus database with same CATH topology
 3C9T A;  3O85 A;  4BT2 A;  5LA6 B;  4BT7 A;  2KG4 A;  3LWO C;  1KC8 H;  5FLX M;  4M8I A;  2KTU A;  3JAM M;  2HS3 A;  3RYF A;  1QVG F;  2Z1T A;  3UT5 B;  3C9R A;  3HWU A;  1W58 1;  5BMV B;  2PMP A;  1Q82 H;  1XBI A;  2RHO A;  1CLI A;  3K0T A;  3GTZ A;  3I3F A;  2G9I A;  3Q8H A;  1TUB B;  3RA5 A;  1Z5V A;  2ZVY A;  3LYB A;  1VQ5 F;  2Z1F A;  4FFB A;  3CXC F;  3I56 F;  1VK3 A;  1VQM F;  3VYT C;  2VAM A;  3CCV F;  4G4Y A;  4LCK A;  2VAP A;  3CPQ A;  3IKF A;  5KMG A;  3N2G B;  2HX0 A;  1GO0 A;  3FPI A;  4BVT A;  4BW0 B;  5IJ9 A;  5MN6 A;  3KE1 A;  4X3M A;  1X7O A;  5LP6 C;  3KJJ A;  3VCZ A;  1T0K B;  4G4Z A;  1YIT F;  3N2K B;  1W55 A;  2VGM A;  1PF5 A;  4TV8 A;  5LXT A;  1YI2 F;  5JH7 A;  5DCV A;  2DYY A;  4ZOL A;  5LOV B;  4EI9 A;  1W59 A;  3D00 A;  3JAW B;  4ERH A;  1KQS F;  4X1I A;  3ZP4 A;  3VMF B;  1XHO A;  2YYE A;  2HRY A;  5EZY A;  3NK6 A;  3F6M A;  2Z1U A;  3JAS B;  3RYF B;  1NQ3 A;  5LYJ A;  5HY2 A;  4TV8 B;  3IKE A;  5KX5 A;  4X1K B;  2FGY A;  3S02 A;  4B46 A;  4F6R B;  5G4V C;  2HQS C;  1X25 A;  2JNB A;  4EI7 A;  4G4V A;  2CHS A;  3KHN A;  3S0H A;  3N4Z A;  3HAX D;  4X20 A;  4ZHW A;  3L7Q A;  1VQ8 F;  4C8G A;  3CC2 F;  3WJQ A;  3VTI C;  2BTU A;  1JJ2 F;  2OTM A;  3S0Y A;  3LFO A;  5CA0 A;  3ON1 A;  1XV2 A;  1DBF A;  1W5B A;  2VGN A;  3HJW C;  4O2A B;  3M4S A;  2AIZ P;  3HKC A;  3VIU A;  4I55 A;  3HKE B;  2ZAU A;  3P4E A;  5ITZ B;  1U3L A;  4IHJ B;  4ZHQ A;  3CYQ A;  3ESJ A;  2HVY D;  1XRG A;  2OZB A;  1VH8 A;  3MDO A;  1IV3 A;  1N8R H;  3M1X A;  1IPA A;  3KIZ A;  4DRX B;  3N4Y A;  4RQO A;  1VQ7 F;  3LWV C;  1FNJ A;  4I4T B;  4O4J A;  3S03 A;  4O4H B;  1U3P A;  5HY0 A;  1VQO F;  5CA1 A;  2RHJ A;  2ZF8 A;  3E20 B;  3LME A;  5EB0 A;  3S06 A;  2I6R A;  3HKE A;  4I55 B;  2B33 A;  2QI2 A;  1H7M A;  1R1M A;  3F0F A;  1IV1 A;  2ZVZ A;  3IEQ A;  1W5A A;  4G4X A;  5FNV B;  5C8Y B;  4O4I B;  3FFM A;  4U39 A;  3LDT A;  3CME F;  3WGN A;  3RYH B;  4O4H A;  3F0D A;  2UYN A;  1K73 H;  4RHA A;  1JY8 A;  5GAP K;  3HKC B;  3V3T A;  2DT4 A;  3JAT B;  2H8E A;  3T80 A;  1KD1 H;  3D01 A;  5B8F A;  3CC4 F;  1K9M H;  5GON A;  4I4T A;  1DT9 A;  4O4J B;  3TD5 A;  4TV9 A;  2RHL A;  1ODE A;  5HY4 A;  5MN4 A;  5CB4 A;  3HKD A;  1KNJ A;  4YJ2 A;  4EB6 A;  3CMA F;  1JFF A;  2Q1Y A;  2QEX F;  5C8Y A;  5J2U A;  3JVH A;  3LWR C;  3ZOP A;  1E7K A;  2P6Y A;  4NUT A;  1QVF F;  2GVI A;  4IIJ A;  5BMV A;  4BT5 A;  3ZP7 A;  4C8E A;  5FJ4 C;  3OW2 F;  1CN7 A;  1VQ6 F;  1RLU A;  5GON B;  3NMU C;  2Z1E A;  3SIU A;  3HKB B;  3JAS A;  4B5C A;  1VQV A;  3CCJ F;  3MCQ A;  3RYI B;  3P0Z A;  5LP6 A;  3CG6 A;  3RYH A;  5LYJ B;  5GIO C;  4NQ3 A;  5EYP B;  2PHN A;  3VO8 A;  4ZOL B;  5EYP A;  2RHH A;  5EWR A;  3JAW A;  3WGM A;  5HP8 A;  3IMP A;  1NMU B;  1FSZ A;  5A2Q M;  3I55 F;  3E1Y A;  3IEW A;  4YJ2 B;  4NWO B;  2AIF A;  4ZHY B;  4TZZ A;  3K14 A;  3WGJ A;  4BT4 A;  3NK7 A;  1IV4 A;  3QUW A;  1JFF B;  1NJI H;  1Q7Y H;  1T0A A;  2ZOV A;  5GIN C;  3N2G A;  2HS4 A;  2H8C A;  1W42 A;  3E22 B;  3RYI A;  5LP6 B;  2VXY A;  3FD5 A;  1SDS A;  3LWP C;  3HKB A;  1M1K H;  3WJP A;  1IV2 A;  3OON A;  5J2T A;  3VI6 A;  3VOB A;  1W2B F;  2LBT A;  3NVK E;  5JVD B;  1W40 A;  5ITZ A;  2BTQ B;  4G4W A;  2F9Z C;  2I6D A;  3V7E A;  2Q1X A;  3UT5 A;  2EWC A;  4HNA B;  4C4W C;  3GYQ A;  1RLG A;  2V9Y A;  1W5F A;  4YJ3 B;  5IYZ B;  4KWE A;  5LA6 A;  3CCR F;  3PLA C;  1JD1 A;  2HP0 A;  1VQ9 F;  2LBW A;  1X52 A;  3F0G A;  4XCQ A;  4TUY B;  4WBN B;  1OAP A;  4C82 A;  1UI9 A;  3RYC A;  5KX5 B;  2BTO A;  2HP3 A;  5MN5 A;  3VYS C;  5IJ0 A;  3JAT A;  1X7P A;  3HTN A;  5JQG B;  2Z01 A;  3C9S A;  1VQN F;  2IG8 A;  3DDN A;  4BVS A;  5EIB C;  4IHJ A;  4ZHQ B;  2KTV A;  5CA0 B;  3ZO8 A;  4C8I A;  3WPX A;  5JQG A;  4EI8 A;  4TV9 B;  3JAR A;  3K12 A;  4PWT A;  3JAL B;  2CW4 A;  1SZQ A;  4WBN A;  2R75 1;  2UYK A;  1U43 A;  4BT6 A;  1S72 F;  4HNA A;  2HP0 B;  3RE3 A;  2RB9 A;  2UYN B;  1YQN A;  4G88 A;  4I50 A;  3P10 A;  1Q81 H;  3V7Q A;  2OTJ F;  2UYP A;  1H47 A;  5EAZ A;  1RA4 A;  4FFB B;  5FNV A;  5AVM A;  1UFY A;  2BO1 A;  1W57 A;  3C9U A;  4O4L A;  5HY1 A;  5LOV A;  5HP7 A;  4X20 B;  4BY9 D;  4B45 A;  3OBW A;  3MBM A;  5CA1 B;  5EB1 B;  1J7H A;  5GIP C;  2GZL A;  1FNK A;  2ZOD A;  3IR9 A;  2KGW A;  3CCE F;  3QTY A;  4F6R A;  1SA0 B;  1Q8R A;  1VQ4 F;  1ONI A;  5EZY B;  3E22 A;  4X1Y A;  2W8B C;  4IIJ B;  1YJN F;  4R40 B;  5IT9 M;  4E6E A;  3MCA B;  2ALE A;  2QTP A;  1VQP F;  1K8A H;  1KNK A;  5JVD A;  3F0E A;  3ERN A;  1RQ2 A;  2LBX A;  2CSL A;  3CB2 A;  4ZI7 A;  3OBY A;  3DC2 A;  5CB4 B;  3GHZ A;  1GZ0 A;  5JH7 B;  4BVR A;  1TVK B;  3V4D A;  3FD6 A;  5JCO C;  2CVL A;  1TVK A;  3J80 M;  3G71 F;  1COM A;  2IQQ A;  4ZK7 A;  3C8L A;  3LWQ C;  4BT3 A;  2OHW A;  3J7A R;  3B6N A;  4ZI7 B;  5IJ9 B;  1PXW A;  4X1K A;  3CD6 F;  3NVI B;  5J2U B;  1TUB A;  2WAL A;  3VOA A;  3WXM B;  5KMG B;  3JCM M;  1QAH A;  3RA6 A;  5HWE A;  1M90 H;  3WGL A;  3WGK A;  1YGY A;  4C81 A;  4O4L B;  4U3J A;  1YJW F;  2AMT A;  1YJ9 F;  1VQK F;  2CHT A;  4X1Y B;  5GAN K;  3S0W A;  4O2B A;  1JN1 A;  1FFX B;  1W3E X;  4EB6 B;  1YHQ F;  1VQL F;  3D54 A;  5JCO A;  2UYJ A;  3ELC A;  1W41 A;  2K1S A;  2CZW A;  1VHA A;  2NMU A;  3G4S F;  2HS0 A;  5EIB D;  3JAL A;  5HXZ A;  3PAF A;  2YXZ A;  2IAF A;  1GO1 A;  3TD4 A;  4DRX A;  3JAR B;  2R6R 1;  4U3J B;  3CCM F;  1H48 A;  4DXD A;  4I50 B;  2VAW A;  3WJR A;  1Q86 H;  3FBA A;  3CCQ F;  5EO3 A;  3VYU C;  1W5E A;  2L26 A;  2MQE A;  3R0P A;  4O4I A;  3JAK A;  4LNU A;  4B62 A;  3HKD B;  3M84 A;  5G4U C;  1U40 A;  3TD3 A;  5J2T B;  2OTL F;  3EOR A;  5IJ0 B;  1GX1 A;  1Z5W A;  3K2X A;  4X3L A;  4YJ3 A;  5IYZ A;  2N48 A;  3CCU F;  3SIV A;  3J81 M;  1SA0 A;  2CWJ A;  2UZH A;  3CYP B;  3CPW F;  4BVQ A;  2H6L A;  1CK2 A;  3CC7 F;  1RQ7 A;  1ZWZ A;  5HXU A;  4O2B B;  3CCL F;  1QD9 A;  3KJK A;  4X1I B;  1YIJ F;  3WPW A;  2QA4 F;  3G6E F;  3QHD A;  4LNU B;  2HRU A;  3JAK B;  3CCS F;  3BYQ A;  3RYC B;  5LXT B;  2FC3 A;  2GLZ A;  3MQW A;  4TUY A;  3N2K A;  3U0O A;  1QU9 A;  4ZHV A;  3I7T A;  3AGK A;  4O2A A;  2LCA A;  1FFX A;  1OFU A; 
#chains in the Genus database with same CATH homology
 3O85 A;  2LBX A;  1W40 A;  2KG4 A;  3LWO C;  3E20 B;  1KC8 H;  2F9Z C;  2I6D A;  5FLX M;  3OBY A;  3V7E A;  2KTU A;  2QI2 A;  3JAM M;  1H7M A;  1GZ0 A;  1QVG F;  4BVR A;  4C4W C;  3GYQ A;  1RLG A;  3J80 M;  3G71 F;  1Q82 H;  1XBI A;  3LWQ C;  3FFM A;  3CCR F;  2OHW A;  3J7A R;  3CME F;  3RA5 A;  1PXW A;  3CD6 F;  1K73 H;  1VQ5 F;  3NVI B;  5GAP K;  3PLA C;  3CXC F;  3V3T A;  1VQ9 F;  2LBW A;  1X52 A;  4XCQ A;  3WXM B;  2WAL A;  3I56 F;  1KD1 H;  1VQM F;  3CC4 F;  1K9M H;  3JCM M;  3CCV F;  3RA6 A;  4LCK A;  1DT9 A;  3CPQ A;  5HWE A;  1M90 H;  1GO0 A;  1X7P A;  5HY4 A;  1YJW F;  1YJ9 F;  4BVT A;  1VQK F;  1VQN F;  4BW0 B;  5GAN K;  3CMA F;  4X3M A;  1X7O A;  2QEX F;  4BVS A;  1W3E X;  1T0K B;  1YHQ F;  1VQL F;  2KTV A;  1YIT F;  3LWR C;  1W41 A;  2VGM A;  2CZW A;  1YI2 F;  1E7K A;  4EI8 A;  5DCV A;  3G4S F;  5HXZ A;  4NUT A;  4EI9 A;  3PAF A;  1GO1 A;  3D00 A;  1KQS F;  1QVF F;  3VMF B;  1S72 F;  5FJ4 C;  3NK6 A;  5HY2 A;  3OW2 F;  3CCM F;  1CN7 A;  1Q86 H;  1VQ6 F;  2FGY A;  3NMU C;  3CCQ F;  5G4V C;  3SIU A;  5EO3 A;  1Q81 H;  3V7Q A;  2OTJ F;  3CCJ F;  1RA4 A;  2JNB A;  5G4U C;  4EI7 A;  3CG6 A;  2OTL F;  3HAX D;  5GIO C;  3N4Z A;  2BO1 A;  4NQ3 A;  1VQ8 F;  5HY1 A;  4X3L A;  3CC2 F;  1JJ2 F;  5EWR A;  3CCU F;  4BY9 D;  3SIV A;  3J81 M;  3OBW A;  3LFO A;  1NMU B;  5A2Q M;  3ON1 A;  3I55 F;  2VGN A;  5GIP C;  3HJW C;  3E1Y A;  3CPW F;  4BVQ A;  3IR9 A;  3CCE F;  1CK2 A;  2AIF A;  4TZZ A;  3CC7 F;  1ZWZ A;  5HXU A;  3NK7 A;  2HVY D;  1VQ4 F;  2OZB A;  1NJI H;  3CCL F;  1Q7Y H;  5GIN C;  1N8R H;  1IPA A;  1YIJ F;  1YJN F;  1W42 A;  2QA4 F;  3G6E F;  5IT9 M;  3N4Y A;  3CCS F;  1VQ7 F;  1SDS A;  3LWP C;  1M1K H;  3MCA B;  3LWV C;  2ALE A;  1VQP F;  3VI6 A;  1K8A H;  2FC3 A;  2GLZ A;  1W2B F;  3AGK A;  5HY0 A;  1VQO F;  3NVK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...