1W42A

T. celer l30e r92a variant
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
MVDFAFELRKAQDTGKIVMGARKSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIPVYEFEGTSVELGTLLGRPHTVSALAVVDPGESAILALGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S RIBOSOMAL PROTEIN L30E
publication title Electrostatic Interactions Contribute to Reduced Heat Capacity Change of Unfolding in a Thermophilic Ribosomal Protein L30E
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1w42A00
1CK2A 2FC3A 3J81M 3CXCF 2WALA 1X52A 2QEXF 1YHQF 1W42A 1T0KB 3NK7A 5GIOC 2JNBA 2HVYD 1H7MA 1VQNF 3ON1A 1YJNF 3CCUF 3CC2F 3N4ZA 2KTUA 1JJ2F 3E1YA 3NK6A 3I55F 3IR9A 3LFOA 1W40A 3CCLF 3G4SF 1VQ7F 3AGKA 3VI6A 1YIJF 4LCKA 1YJ9F 1NMUB 3MCAB 1VQ5F 1W41A 1VQMF 1GZ0A 3E20B 3O85A 2KTVA 1M90H 2CZWA 4NUTA 1W2BF 1E7KA 5FJ4C 3CCMF 3JAMM 4BY9D 1YI2F 1KQSF 3NVIB 3CCEF 1K73H 2OZBA 3CCJF 2OTLF 4TZZA 5DCVA 2QI2A 5GANK 4X3MA 1IPAA 1VQ8F 3CC7F 3J7AR 2OHWA 3FFMA 3RA6A 1ZWZA 1KC8H 5GIPC 1Q82H 2OTJF 3I56F 1NJIH 5GINC 2KG4A 5FLXM 1M1KH 3CPQA 2VGNA 3CG6A 1VQPF 1YJWF 1YITF 2I6DA 3OBWA 3CPWF 5G4VC 5GAPK 3G71F 1CN7A 3WXMB 1VQ6F 3CD6F 3SIVA 3HJWC 3GYQA 1K9MH 1Q81H 2QA4F 1PXWA 3NMUC 1KD1H 5G4UC 1X7PA 3J80M 1VQ9F 3JCMM 3LWRC 1S72F 3CC4F 3CMAF 3HAXD 3V7EA 5EO3A 3RA5A 3LWOC 4C4WC 1VQ4F 1SDSA 3LWQC 1RLGA 4X3LA 1XBIA 1DT9A 2LBWA 5EWRA 2ALEA 5A2QM 1K8AH 3PAFA 3VMFB 3OBYA 1VQKF 3CCRF 1GO1A 3LWVC 3CMEF 2BO1A 1VQLF 3PLAC 2VGMA 3N4YA 3CCVF 2AIFA 3LWPC 5IT9M 4BW0B 3V7QA 1W3EX 1Q86H 3CCQF 1RA4A 1N8RH 3G6EF 1QVFF 1X7OA 3SIUA 1VQOF 1GO0A 1Q7YH 2LBXA 3NVKE 1QVGF 3CCSF 3OW2F
chains in the Genus database with same CATH superfamily
5CB4B 3KJJA 4O4HA 4RHAA 2NMUA 4B46A 1T0KB 2DT4A 2AMTA 2F9ZC 4O2AB 4DRXB 4ZHYB 5GIOC 3JALB 3ON1A 5FNVB 4ZOLB 3CCUF 2UYPA 4WBNA 2KTUA 3BYQA 2ZF8A 3VOAA 4YJ3B 4F6RB 3C9RA 4X1IB 4ZHWA 3G4SF 3AGKA 1FFXA 1U3PA 3VI6A 1RQ2A 4TUYA 1OAPA 4C8EA 1VQ5F 1W41A 2AIZP 3WGJA 5KMGB 1RQ7A 1M90H 2CZWA 2HQSC 3JATB 5FJ4C 2HP3A 1YI2F 5BMVA 1KQSF 3C9SA 4BT4A 4EB6B 5J2UB 4C82A 1W55A 2H8CA 5GANK 4X3MA 3N2GB 3RYIA 2OHWA 2RHOA 5HY1A 5HXZA 3FFMA 3IEQA 4LNUB 5JQGA 5J2TA 3HKEB 3VYSC 4O4JA 5LA6A 4C81A 1J7HA 4RQOA 2HS0A 3CG6A 1YJWF 1YITF 4XCQA 1Z5WA 4IIJA 3G71F 2EWCA 1CN7A 1VQ6F 3KIZA 3IKEA 3SIVA 1YGYA 2PHNA 2QA4F 1CLIA 3HKCB 5G4UC 1X7PA 5EYPB 2KGWA 3CYPB 3HAXD 3V7EA 1XRGA 4B45A 4O4LB 3RA5A 2LBTA 4FFBA 3KHNA 1VQVA 3RYHA 1OFUA 1RLGA 3WJPA 4BVSA 5LP6C 3TD5A 1COMA 1NQ3A 4DXDA 3IKFA 3VMFB 4I4TA 4BVTA 4B62A 3PLAC 3GTZA 2VGMA 3WJRA 3LWPC 4G4WA 3JARA 4G4ZA 5JVDA 3CCQF 3JAKB 3G6EF 1QVFF 5LOVA 1TUBA 1CK2A 2FC3A 3N2KB 3J81M 5C8YA 2Z1TA 5IJ0A 3JAWA 2MQEA 5CA1A 5HP7A 5ITZA 2HVYD 3WGNA 5GONA 4IHJB 4TV9B 3D00A 4ZI7B 3JASA 3EORA 5CA0B 3I55F 3IR9A 2UYNB 2ZVZA 4HNAB 1VH8A 4BT3A 5IYZB 2IAFA 2HX0A 1ODEA 5HP8A 3CCLF 3TD4A 3E22A 1YIJF 4LCKA 1H48A 1NMUB 1SA0B 4X20B 5LP6A 4U3JB 5MN6A 1JFFB 3F0EA 2L26A 3E20B 3O85A 2KTVA 4G4XA 5EAZA 3I3FA 1W2BF 1E7KA 2HP0A 4I50A 4KWEA 3S0HA 3HKDA 3HTNA 3JAMM 3NVIB 3VTIC 2OZBA 3CCJF 2OTLF 4TZZA 3K14A 3FPIA 3RYCB 2HS3A 5LYJA 3J7AR 5IJ9B 3R0PA 2K1SA 4TV8B 3RA6A 2BTQB 3L7QA 1Q82H 5EZYA 3RE3A 5JH7A 1NJIH 4O4IB 5FLXM 2Z1FA 3HKBA 2I6DA 3CPWF 1TVKA 1XV2A 3LMEA 3HJWC 5LXTA 1KNJA 1KNKA 1PXWA 5AVMA 3P4EA 3NMUC 2I6RA 3CYQA 3P0ZA 4X1YA 4X1KB 4ZK7A 5EB1B 1GX1A 3VOBA 3T80A 1VQ4F 1SDSA 3LWQC 4YJ2A 1XHOA 2N48A 1XBIA 2R751 1Q8RA 3ELCA 1JD1A 3UT5B 1W59A 2LBWA 5HWEA 2ZODA 1IV4A 2ALEA 3RYFB 3ZP4A 4I55B 5HY2A 2H6LA 2YYEA 4O2BA 1VQLF 3KE1A 3K2XA 3CCVF 5B8FA 2CHTA 4ZHQA 1UI9A 1R1MA 5IT9M 3WGKA 2Z1EA 2RHHA 2ZOVA 4O4HB 2CWJA 1N8RH 4ZHVA 3SIUA 2LBXA 5HXUA 3DDNA 4EI9A 5KX5A 5JCOC 1T0AA 3MCQA 4PWTA 2LCAA 1UFYA 2WALA 1U43A 1X52A 2QEXF 1W42A 4WBNB 3IMPA 3NK7A 5CB4A 2JNBA 4NQ3A 3ERNA 1YJNF 2RHLA 3CC2F 2H8EA 2BTUA 4O2AA 4DRXA 2UYKA 1QU9A 1U3LA 2GZLA 1SZQA 1FFXB 2R6R1 3JALA 3NK6A 5FNVA 4ZOLA 3FD6A 4M8IA 4TUYB 2BTOA 1W40A 2GLZA 4G4VA 3MCAB 3V3TA 1W57A 3ZO8A 4YJ3A 4F6RA 1VQMF 4X1IA 5BMVB 3CCMF 5KMGA 2OTMA 3KJKA 3RYIB 3WPXA 3C9TA 3CCEF 2VAMA 3C9UA 1K73H 3JATA 1FNKA 5JQGB 5J2TB 3WGLA 4O4JB 5LA6B 4EB6A 2GVIA 5JCOA 3WPWA 5J2UA 1ZWZA 1KC8H 5GIPC 3N2GA 2Q1XA 3GHZA 3VYTC 2V9YA 4IIJB 3S0WA 4EI8A 2KG4A 3VO8A 1M1KH 2VGNA 4LNUA 3HKEA 3M4SA 4C8GA 1YQNA 5G4VC 2CSLA 4E6EA 3WXMB 3CD6F 3ZP7A 3V4DA 1RLUA 1W581 2UZHA 4BT5A 1VQ9F 1IV3A 4FFBB 4U39A 3JCMM 2FGYA 3F0GA 3RYHB 2UYJA 1S72F 3CC4F 3I7TA 3HKCA 3FBAA 5EYPA 2DYYA 1FSZA 3JVHA 3LWOC 4I4TB 4X3LA 3DC2A 4O4LA 5A2QM 2G9IA 1QAHA 3JARB 4G88A 5JVDB 1GO1A 5MN4A 3CMEF 2BO1A 2VAPA 3N4YA 1DBFA 1H47A 4BVRA 5LOVB 1TUBB 2AIFA 4BW0B 3S03A 1W3EX 3D54A 5C8YB 1X7OA 3QTYA 1VQOF 5IJ0B 3JAWB 3NVKE 2P6YA 5HY0A 3CCSF 3ZOPA 5CA1B 3QUWA 3OW2F 1QVGF 2CW4A 3JAKA 5ITZB 3CXCF 5GONB 1IV1A 3S02A 2PMPA 3Q8HA 1YHQF 3TD3A 2Z01A 1FNJA 3JASB 3N2KA 1H7MA 1VQNF 2B33A 4BT6A 4R40B 3F0DA 3N4ZA 1W5EA 3FD5A 3E22B 1JJ2F 3E1YA 1JN1A 1W5FA 3LFOA 4IHJA 5LP6B 4TV9A 3LYBA 3IEWA 4BT2A 4EI7A 4ZI7A 3C8LA 1VQ7F 5CA0A 3M84A 1YJ9F 2UYNA 3MDOA 4B5CA 4HNAA 5IYZA 3P10A 1VHAA 3F0FA 2HP0B 4I50B 1GZ0A 3HKDB 3OONA 3MQWA 4NUTA 2W8BC 4X20A 1SA0A 4U3JA 1JFFA 4BY9D 4NWOB 3K12A 2ZAUA 5LYJB 3HWUA 5DCVA 2HS4A 2QI2A 1IPAA 5EZYB 1VQ8F 3CC7F 5JH7B 1U40A 4BT7A 2VAWA 3RYCA 2RB9A 3HKBB 2OTJF 1ONIA 2CHSA 1VK3A 5EIBD 1TVKB 3VYUC 5IJ9A 3I56F 3S06A 5GINC 4TV8A 3M1XA 2QTPA 3CPQA 1VQPF 5EB0A 5LXTB 2ZVYA 3OBWA 5GAPK 3QHDA 3MBMA 4O4IA 2VXYA 5HY4A 3F6MA 1Z5VA 3GYQA 1K9MH 1Q81H 1KD1H 4X1YB 3J80M 3K0TA 2IQQA 2RHJA 3LWRC 4YJ2B 3CMAF 5EO3A 1X25A 3WGMA 4BVQA 4C4WC 2CVLA 3B6NA 3S0YA 1DT9A 2IG8A 4O2BB 3WJQA 5EWRA 4X1KA 2HRYA 2YXZA 3ESJA 2HRUA 3PAFA 1K8AH 4ZHQB 3D01A 3OBYA 1VQKF 1W5AA 3CCRF 3LWVC 5EIBC 1W5BA 3UT5A 1JY8A 3VCZA 3U0OA 3CB2A 3VIUA 1QD9A 3RYFA 5MN5A 5KX5B 4I55A 3V7QA 2Z1UA 1Q86H 1PF5A 1RA4A 4ERHA 3LDTA 4G4YA 1GO0A 2Q1YA 1IV2A 4C8IA 1Q7YH
chains in the Genus database with same CATH topology
1CK2A 2FC3A 3J81M 3CXCF 2WALA 1X52A 2QEXF 1YHQF 1W42A 1T0KB 2F9ZC 3NK7A 5GIOC 2JNBA 4NQ3A 2HVYD 1H7MA 1VQNF 3ON1A 1YJNF 3CCUF 3CC2F 3D00A 3N4ZA 2KTUA 1JJ2F 3E1YA 3NK6A 3I55F 3IR9A 3LFOA 4EI7A 1W40A 2GLZA 3CCLF 3G4SF 1VQ7F 3AGKA 3VI6A 1YIJF 4LCKA 1YJ9F 1NMUB 3MCAB 3V3TA 1VQ5F 1W41A 1VQMF 1GZ0A 3E20B 3O85A 2KTVA 1M90H 2CZWA 4NUTA 1W2BF 1E7KA 5FJ4C 3CCMF 3JAMM 4BY9D 1YI2F 1KQSF 3NVIB 3CCEF 1K73H 2OZBA 3CCJF 2OTLF 4TZZA 5DCVA 2QI2A 5GANK 4X3MA 1IPAA 1VQ8F 3CC7F 3J7AR 2OHWA 5HY1A 5HXZA 3FFMA 3RA6A 1ZWZA 1KC8H 5GIPC 1Q82H 2OTJF 3I56F 1NJIH 4EI8A 5GINC 2KG4A 5FLXM 1M1KH 3CPQA 2VGNA 3CG6A 1VQPF 1YJWF 1YITF 2I6DA 3OBWA 3CPWF 4XCQA 5G4VC 5GAPK 3G71F 1CN7A 3WXMB 1VQ6F 3CD6F 3SIVA 5HY4A 3HJWC 3GYQA 1K9MH 1Q81H 2QA4F 1PXWA 3NMUC 1KD1H 5G4UC 1X7PA 3CCSF 3J80M 1VQ9F 3JCMM 2FGYA 3LWRC 1S72F 3CC4F 3CMAF 3HAXD 3V7EA 5EO3A 3RA5A 4BVQA 3LWOC 4C4WC 1VQ4F 1SDSA 3LWQC 1RLGA 4X3LA 1XBIA 4BVSA 1DT9A 2LBWA 5HWEA 5EWRA 2ALEA 5A2QM 1K8AH 3PAFA 3VMFB 5HY2A 3OBYA 1VQKF 4BVTA 3CCRF 1GO1A 3LWVC 3CMEF 2BO1A 1VQLF 3PLAC 2VGMA 3N4YA 3CCVF 4BVRA 2AIFA 3LWPC 5IT9M 4BW0B 3V7QA 1W3EX 1Q86H 3CCQF 1RA4A 1N8RH 3G6EF 1QVFF 1X7OA 3SIUA 1VQOF 1GO0A 1Q7YH 2LBXA 5HXUA 3NVKE 1QVGF 5HY0A 4EI9A 3OW2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK2 A;  2FC3 A;  3J81 M;  3CXC F;  2WAL A;  1X52 A;  2QEX F;  1YHQ F;  1W42 A;  1T0K B;  3NK7 A;  5GIO C;  2JNB A;  2HVY D;  1H7M A;  1VQN F;  3ON1 A;  1YJN F;  3CCU F;  3CC2 F;  3N4Z A;  2KTU A;  1JJ2 F;  3E1Y A;  3NK6 A;  3I55 F;  3IR9 A;  3LFO A;  1W40 A;  3CCL F;  3G4S F;  1VQ7 F;  3AGK A;  3VI6 A;  1YIJ F;  4LCK A;  1YJ9 F;  1NMU B;  3MCA B;  1VQ5 F;  1W41 A;  1VQM F;  1GZ0 A;  3E20 B;  3O85 A;  2KTV A;  1M90 H;  2CZW A;  4NUT A;  1W2B F;  1E7K A;  5FJ4 C;  3CCM F;  3JAM M;  4BY9 D;  1YI2 F;  1KQS F;  3NVI B;  3CCE F;  1K73 H;  2OZB A;  3CCJ F;  2OTL F;  4TZZ A;  5DCV A;  2QI2 A;  5GAN K;  4X3M A;  1IPA A;  1VQ8 F;  3CC7 F;  3J7A R;  2OHW A;  3FFM A;  3RA6 A;  1ZWZ A;  1KC8 H;  5GIP C;  1Q82 H;  2OTJ F;  3I56 F;  1NJI H;  5GIN C;  2KG4 A;  5FLX M;  1M1K H;  3CPQ A;  2VGN A;  3CG6 A;  1VQP F;  1YJW F;  1YIT F;  2I6D A;  3OBW A;  3CPW F;  5G4V C;  5GAP K;  3G71 F;  1CN7 A;  3WXM B;  1VQ6 F;  3CD6 F;  3SIV A;  3HJW C;  3GYQ A;  1K9M H;  1Q81 H;  2QA4 F;  1PXW A;  3NMU C;  1KD1 H;  5G4U C;  1X7P A;  3J80 M;  1VQ9 F;  3JCM M;  3LWR C;  1S72 F;  3CC4 F;  3CMA F;  3HAX D;  3V7E A;  5EO3 A;  3RA5 A;  3LWO C;  4C4W C;  1VQ4 F;  1SDS A;  3LWQ C;  1RLG A;  4X3L A;  1XBI A;  1DT9 A;  2LBW A;  5EWR A;  2ALE A;  5A2Q M;  1K8A H;  3PAF A;  3VMF B;  3OBY A;  1VQK F;  3CCR F;  1GO1 A;  3LWV C;  3CME F;  2BO1 A;  1VQL F;  3PLA C;  2VGM A;  3N4Y A;  3CCV F;  2AIF A;  3LWP C;  5IT9 M;  4BW0 B;  3V7Q A;  1W3E X;  1Q86 H;  3CCQ F;  1RA4 A;  1N8R H;  3G6E F;  1QVF F;  1X7O A;  3SIU A;  1VQO F;  1GO0 A;  1Q7Y H;  2LBX A;  3NVK E;  1QVG F;  3CCS F;  3OW2 F; 
#chains in the Genus database with same CATH topology
 5CB4 B;  3KJJ A;  4O4H A;  4RHA A;  2NMU A;  4B46 A;  1T0K B;  2DT4 A;  2AMT A;  2F9Z C;  4O2A B;  4DRX B;  4ZHY B;  5GIO C;  3JAL B;  3ON1 A;  5FNV B;  4ZOL B;  3CCU F;  2UYP A;  4WBN A;  2KTU A;  3BYQ A;  2ZF8 A;  3VOA A;  4YJ3 B;  4F6R B;  3C9R A;  4X1I B;  4ZHW A;  3G4S F;  3AGK A;  1FFX A;  1U3P A;  3VI6 A;  1RQ2 A;  4TUY A;  1OAP A;  4C8E A;  1VQ5 F;  1W41 A;  2AIZ P;  3WGJ A;  5KMG B;  1RQ7 A;  1M90 H;  2CZW A;  2HQS C;  3JAT B;  5FJ4 C;  2HP3 A;  1YI2 F;  5BMV A;  1KQS F;  3C9S A;  4BT4 A;  4EB6 B;  5J2U B;  4C82 A;  1W55 A;  2H8C A;  5GAN K;  4X3M A;  3N2G B;  3RYI A;  2OHW A;  2RHO A;  5HY1 A;  5HXZ A;  3FFM A;  3IEQ A;  4LNU B;  5JQG A;  5J2T A;  3HKE B;  3VYS C;  4O4J A;  5LA6 A;  4C81 A;  1J7H A;  4RQO A;  2HS0 A;  3CG6 A;  1YJW F;  1YIT F;  4XCQ A;  1Z5W A;  4IIJ A;  3G71 F;  2EWC A;  1CN7 A;  1VQ6 F;  3KIZ A;  3IKE A;  3SIV A;  1YGY A;  2PHN A;  2QA4 F;  1CLI A;  3HKC B;  5G4U C;  1X7P A;  5EYP B;  2KGW A;  3CYP B;  3HAX D;  3V7E A;  1XRG A;  4B45 A;  4O4L B;  3RA5 A;  2LBT A;  4FFB A;  3KHN A;  1VQV A;  3RYH A;  1OFU A;  1RLG A;  3WJP A;  4BVS A;  5LP6 C;  3TD5 A;  1COM A;  1NQ3 A;  4DXD A;  3IKF A;  3VMF B;  4I4T A;  4BVT A;  4B62 A;  3PLA C;  3GTZ A;  2VGM A;  3WJR A;  3LWP C;  4G4W A;  3JAR A;  4G4Z A;  5JVD A;  3CCQ F;  3JAK B;  3G6E F;  1QVF F;  5LOV A;  1TUB A;  1CK2 A;  2FC3 A;  3N2K B;  3J81 M;  5C8Y A;  2Z1T A;  5IJ0 A;  3JAW A;  2MQE A;  5CA1 A;  5HP7 A;  5ITZ A;  2HVY D;  3WGN A;  5GON A;  4IHJ B;  4TV9 B;  3D00 A;  4ZI7 B;  3JAS A;  3EOR A;  5CA0 B;  3I55 F;  3IR9 A;  2UYN B;  2ZVZ A;  4HNA B;  1VH8 A;  4BT3 A;  5IYZ B;  2IAF A;  2HX0 A;  1ODE A;  5HP8 A;  3CCL F;  3TD4 A;  3E22 A;  1YIJ F;  4LCK A;  1H48 A;  1NMU B;  1SA0 B;  4X20 B;  5LP6 A;  4U3J B;  5MN6 A;  1JFF B;  3F0E A;  2L26 A;  3E20 B;  3O85 A;  2KTV A;  4G4X A;  5EAZ A;  3I3F A;  1W2B F;  1E7K A;  2HP0 A;  4I50 A;  4KWE A;  3S0H A;  3HKD A;  3HTN A;  3JAM M;  3NVI B;  3VTI C;  2OZB A;  3CCJ F;  2OTL F;  4TZZ A;  3K14 A;  3FPI A;  3RYC B;  2HS3 A;  5LYJ A;  3J7A R;  5IJ9 B;  3R0P A;  2K1S A;  4TV8 B;  3RA6 A;  2BTQ B;  3L7Q A;  1Q82 H;  5EZY A;  3RE3 A;  5JH7 A;  1NJI H;  4O4I B;  5FLX M;  2Z1F A;  3HKB A;  2I6D A;  3CPW F;  1TVK A;  1XV2 A;  3LME A;  3HJW C;  5LXT A;  1KNJ A;  1KNK A;  1PXW A;  5AVM A;  3P4E A;  3NMU C;  2I6R A;  3CYQ A;  3P0Z A;  4X1Y A;  4X1K B;  4ZK7 A;  5EB1 B;  1GX1 A;  3VOB A;  3T80 A;  1VQ4 F;  1SDS A;  3LWQ C;  4YJ2 A;  1XHO A;  2N48 A;  1XBI A;  2R75 1;  1Q8R A;  3ELC A;  1JD1 A;  3UT5 B;  1W59 A;  2LBW A;  5HWE A;  2ZOD A;  1IV4 A;  2ALE A;  3RYF B;  3ZP4 A;  4I55 B;  5HY2 A;  2H6L A;  2YYE A;  4O2B A;  1VQL F;  3KE1 A;  3K2X A;  3CCV F;  5B8F A;  2CHT A;  4ZHQ A;  1UI9 A;  1R1M A;  5IT9 M;  3WGK A;  2Z1E A;  2RHH A;  2ZOV A;  4O4H B;  2CWJ A;  1N8R H;  4ZHV A;  3SIU A;  2LBX A;  5HXU A;  3DDN A;  4EI9 A;  5KX5 A;  5JCO C;  1T0A A;  3MCQ A;  4PWT A;  2LCA A;  1UFY A;  2WAL A;  1U43 A;  1X52 A;  2QEX F;  1W42 A;  4WBN B;  3IMP A;  3NK7 A;  5CB4 A;  2JNB A;  4NQ3 A;  3ERN A;  1YJN F;  2RHL A;  3CC2 F;  2H8E A;  2BTU A;  4O2A A;  4DRX A;  2UYK A;  1QU9 A;  1U3L A;  2GZL A;  1SZQ A;  1FFX B;  2R6R 1;  3JAL A;  3NK6 A;  5FNV A;  4ZOL A;  3FD6 A;  4M8I A;  4TUY B;  2BTO A;  1W40 A;  2GLZ A;  4G4V A;  3MCA B;  3V3T A;  1W57 A;  3ZO8 A;  4YJ3 A;  4F6R A;  1VQM F;  4X1I A;  5BMV B;  3CCM F;  5KMG A;  2OTM A;  3KJK A;  3RYI B;  3WPX A;  3C9T A;  3CCE F;  2VAM A;  3C9U A;  1K73 H;  3JAT A;  1FNK A;  5JQG B;  5J2T B;  3WGL A;  4O4J B;  5LA6 B;  4EB6 A;  2GVI A;  5JCO A;  3WPW A;  5J2U A;  1ZWZ A;  1KC8 H;  5GIP C;  3N2G A;  2Q1X A;  3GHZ A;  3VYT C;  2V9Y A;  4IIJ B;  3S0W A;  4EI8 A;  2KG4 A;  3VO8 A;  1M1K H;  2VGN A;  4LNU A;  3HKE A;  3M4S A;  4C8G A;  1YQN A;  5G4V C;  2CSL A;  4E6E A;  3WXM B;  3CD6 F;  3ZP7 A;  3V4D A;  1RLU A;  1W58 1;  2UZH A;  4BT5 A;  1VQ9 F;  1IV3 A;  4FFB B;  4U39 A;  3JCM M;  2FGY A;  3F0G A;  3RYH B;  2UYJ A;  1S72 F;  3CC4 F;  3I7T A;  3HKC A;  3FBA A;  5EYP A;  2DYY A;  1FSZ A;  3JVH A;  3LWO C;  4I4T B;  4X3L A;  3DC2 A;  4O4L A;  5A2Q M;  2G9I A;  1QAH A;  3JAR B;  4G88 A;  5JVD B;  1GO1 A;  5MN4 A;  3CME F;  2BO1 A;  2VAP A;  3N4Y A;  1DBF A;  1H47 A;  4BVR A;  5LOV B;  1TUB B;  2AIF A;  4BW0 B;  3S03 A;  1W3E X;  3D54 A;  5C8Y B;  1X7O A;  3QTY A;  1VQO F;  5IJ0 B;  3JAW B;  3NVK E;  2P6Y A;  5HY0 A;  3CCS F;  3ZOP A;  5CA1 B;  3QUW A;  3OW2 F;  1QVG F;  2CW4 A;  3JAK A;  5ITZ B;  3CXC F;  5GON B;  1IV1 A;  3S02 A;  2PMP A;  3Q8H A;  1YHQ F;  3TD3 A;  2Z01 A;  1FNJ A;  3JAS B;  3N2K A;  1H7M A;  1VQN F;  2B33 A;  4BT6 A;  4R40 B;  3F0D A;  3N4Z A;  1W5E A;  3FD5 A;  3E22 B;  1JJ2 F;  3E1Y A;  1JN1 A;  1W5F A;  3LFO A;  4IHJ A;  5LP6 B;  4TV9 A;  3LYB A;  3IEW A;  4BT2 A;  4EI7 A;  4ZI7 A;  3C8L A;  1VQ7 F;  5CA0 A;  3M84 A;  1YJ9 F;  2UYN A;  3MDO A;  4B5C A;  4HNA A;  5IYZ A;  3P10 A;  1VHA A;  3F0F A;  2HP0 B;  4I50 B;  1GZ0 A;  3HKD B;  3OON A;  3MQW A;  4NUT A;  2W8B C;  4X20 A;  1SA0 A;  4U3J A;  1JFF A;  4BY9 D;  4NWO B;  3K12 A;  2ZAU A;  5LYJ B;  3HWU A;  5DCV A;  2HS4 A;  2QI2 A;  1IPA A;  5EZY B;  1VQ8 F;  3CC7 F;  5JH7 B;  1U40 A;  4BT7 A;  2VAW A;  3RYC A;  2RB9 A;  3HKB B;  2OTJ F;  1ONI A;  2CHS A;  1VK3 A;  5EIB D;  1TVK B;  3VYU C;  5IJ9 A;  3I56 F;  3S06 A;  5GIN C;  4TV8 A;  3M1X A;  2QTP A;  3CPQ A;  1VQP F;  5EB0 A;  5LXT B;  2ZVY A;  3OBW A;  5GAP K;  3QHD A;  3MBM A;  4O4I A;  2VXY A;  5HY4 A;  3F6M A;  1Z5V A;  3GYQ A;  1K9M H;  1Q81 H;  1KD1 H;  4X1Y B;  3J80 M;  3K0T A;  2IQQ A;  2RHJ A;  3LWR C;  4YJ2 B;  3CMA F;  5EO3 A;  1X25 A;  3WGM A;  4BVQ A;  4C4W C;  2CVL A;  3B6N A;  3S0Y A;  1DT9 A;  2IG8 A;  4O2B B;  3WJQ A;  5EWR A;  4X1K A;  2HRY A;  2YXZ A;  3ESJ A;  2HRU A;  3PAF A;  1K8A H;  4ZHQ B;  3D01 A;  3OBY A;  1VQK F;  1W5A A;  3CCR F;  3LWV C;  5EIB C;  1W5B A;  3UT5 A;  1JY8 A;  3VCZ A;  3U0O A;  3CB2 A;  3VIU A;  1QD9 A;  3RYF A;  5MN5 A;  5KX5 B;  4I55 A;  3V7Q A;  2Z1U A;  1Q86 H;  1PF5 A;  1RA4 A;  4ERH A;  3LDT A;  4G4Y A;  1GO0 A;  2Q1Y A;  1IV2 A;  4C8I A;  1Q7Y H; 
#chains in the Genus database with same CATH homology
 1CK2 A;  2FC3 A;  3J81 M;  3CXC F;  2WAL A;  1X52 A;  2QEX F;  1YHQ F;  1W42 A;  1T0K B;  2F9Z C;  3NK7 A;  5GIO C;  2JNB A;  4NQ3 A;  2HVY D;  1H7M A;  1VQN F;  3ON1 A;  1YJN F;  3CCU F;  3CC2 F;  3D00 A;  3N4Z A;  2KTU A;  1JJ2 F;  3E1Y A;  3NK6 A;  3I55 F;  3IR9 A;  3LFO A;  4EI7 A;  1W40 A;  2GLZ A;  3CCL F;  3G4S F;  1VQ7 F;  3AGK A;  3VI6 A;  1YIJ F;  4LCK A;  1YJ9 F;  1NMU B;  3MCA B;  3V3T A;  1VQ5 F;  1W41 A;  1VQM F;  1GZ0 A;  3E20 B;  3O85 A;  2KTV A;  1M90 H;  2CZW A;  4NUT A;  1W2B F;  1E7K A;  5FJ4 C;  3CCM F;  3JAM M;  4BY9 D;  1YI2 F;  1KQS F;  3NVI B;  3CCE F;  1K73 H;  2OZB A;  3CCJ F;  2OTL F;  4TZZ A;  5DCV A;  2QI2 A;  5GAN K;  4X3M A;  1IPA A;  1VQ8 F;  3CC7 F;  3J7A R;  2OHW A;  5HY1 A;  5HXZ A;  3FFM A;  3RA6 A;  1ZWZ A;  1KC8 H;  5GIP C;  1Q82 H;  2OTJ F;  3I56 F;  1NJI H;  4EI8 A;  5GIN C;  2KG4 A;  5FLX M;  1M1K H;  3CPQ A;  2VGN A;  3CG6 A;  1VQP F;  1YJW F;  1YIT F;  2I6D A;  3OBW A;  3CPW F;  4XCQ A;  5G4V C;  5GAP K;  3G71 F;  1CN7 A;  3WXM B;  1VQ6 F;  3CD6 F;  3SIV A;  5HY4 A;  3HJW C;  3GYQ A;  1K9M H;  1Q81 H;  2QA4 F;  1PXW A;  3NMU C;  1KD1 H;  5G4U C;  1X7P A;  3CCS F;  3J80 M;  1VQ9 F;  3JCM M;  2FGY A;  3LWR C;  1S72 F;  3CC4 F;  3CMA F;  3HAX D;  3V7E A;  5EO3 A;  3RA5 A;  4BVQ A;  3LWO C;  4C4W C;  1VQ4 F;  1SDS A;  3LWQ C;  1RLG A;  4X3L A;  1XBI A;  4BVS A;  1DT9 A;  2LBW A;  5HWE A;  5EWR A;  2ALE A;  5A2Q M;  1K8A H;  3PAF A;  3VMF B;  5HY2 A;  3OBY A;  1VQK F;  4BVT A;  3CCR F;  1GO1 A;  3LWV C;  3CME F;  2BO1 A;  1VQL F;  3PLA C;  2VGM A;  3N4Y A;  3CCV F;  4BVR A;  2AIF A;  3LWP C;  5IT9 M;  4BW0 B;  3V7Q A;  1W3E X;  1Q86 H;  3CCQ F;  1RA4 A;  1N8R H;  3G6E F;  1QVF F;  1X7O A;  3SIU A;  1VQO F;  1GO0 A;  1Q7Y H;  2LBX A;  5HXU A;  3NVK E;  1QVG F;  5HY0 A;  4EI9 A;  3OW2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...