1W4MA

Structure of the human pleckstrin dep domain by multidimensional nmr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
DLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Dynamics of the Human Pleckstrin Dep Domain: Distinct Molecular Features of a Novel Dep Domain Subfamily
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signal transduction
molecule keywords PLECKSTRIN
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1w4mA00
4HDVA 3M8EA 2FBIA 1WRJA 3F8NA 3J81Z 2CO5A 2IT0A 3FXUA 4IHTA 3BJ6A 3DP7A 3MZHA 2JT1A 2JPBA 5LBQA 2KJCA 2E7WA 4U0WA 5HLIA 1SMTA 2D1HA 5JFRA 2J5OA 5LEJA 2XIGA 1R1UA 3W6JB 1O3QA 1FC3A 3DEUA 3MEXA 1D5VA 3VOEA 1LVAA 4RGXA 1ULYA 4AVPA 3CUQB 4ZZLA 2LSOA 2VT2A 5BQTA 1J7KA 3CO7C 4HZFA 1IXRC 1ZGJA 3RYRA 4HV6A 1Q1HA 1XB4A 4O6JA 3LAPA 4Q5SF 2HR3A 4KNYA 2MLKA 4G6QA 3GFLA 1G4DA 3WODF 1ZRFA 1SFEA 4QWQA 2Z99A 4L18B 2PFBA 1AOYA 1ONVA 2Q8KA 1T98A 2RQPA 2FEZA 2XV4S 2PI0A 2FE3A 4IRGA 4G94A 5D6FA 4LK1F 2P6SA 2L3DA 3WGIA 3FHZA 3H3ZA 3TO6A 4HX8A 4MGRA 3Q9VA 1TQMA 4KICA 3KP6A 2C6YA 5E8GA 3MCZA 1U5TA 3BOQA 4U7BA 1KYWA 4XLPF 1IXSB 1LQ1A 2PMHA 4PGHA 1KGSA 5HS7A 5JI6A 3GFJA 1R22A 2H6BA 3QPHA 5ILSA 4G8XA 3IWFA 4GYIA 2NYXA 2ETHA 1RUOA 2J5PA 4MTDA 5IT9K 3RKXA 3R0AA 2FU4A 3NRVA 3SZTA 1RI7A 5TJJA 2O61A 1KQ8A 5D5VB 3ZN1A 1P4WA 1F1ZA 3REOA 5D4SA 2VE9A 2BV6A 4U7DA 3RDIA 2EV0A 4A0XA 2TDXA 2GZWA 1SAXA 5LRRA 2KRFA 4KFCA 3PQJA 5L3BA 3SXYA 2FBKA 1FWZA 1USSA 3FXQA 1QQIA 3HOTA 1FSHA 4Y13A 1W7PA 5L3GA 4ASNA 5D8LB 3EUHA 3P9KA 4HF0A 1O7LA 3HRUA 4HQEA 1IN7A 3CUQC 1W5TA 4BXUA 2BEOA 3ZPLA 2D1VA 1HQCA 2XAFA 3HIFA 1R36A 2IA1A 1AWCA 5FD5A 3LSTA 3E5XA 4M74A 2P5LC 1KU7A 2ZNYA 2XKOA 1LDJA 1EH6A 3Q9SA 3CO6C 3ZQ7A 3CLOA 4WXDA 2P4WA 4MTEA 1TQIA 2QQ9A 1OYYA 3JAMZ 3ZN0A 4WXCA 2JPCA 4IJAA 4ZH4F 1VTNC 3L2CA 3KCCA 5LGTA 4U88A 2H6CA 2VC0A 2HTJA 1BIAA 2NRAC 2ZKZA 3I54A 4UHTA 1GXPA 3L00A 4KIGA 4M6YA 2ISZA 2JZYA 4Q4ZF 1ZGAA 2WV0A 1DDNA 3R0JA 1G3TA 3EYIA 1T2KA 3TQNA 1B1BA 1TTYA 3KFWX 1DP7P 4A6DA 1LDKB 1ZARA 3FWEA 1FBUA 2ZO4A 1JXSA 1XGNA 1P4XA 4ETSA 2FMYA 3WTSC 3LWFA 4Q47A 1MD0A 2ADUA 4LGWA 2V1DA 2F5CA 2R7FA 3PFIA 2DTRA 3GXOA 4M6XA 4HLYA 4LD5A 2DQLA 5KVRA 2OD5A 2E7XA 1F4KA 3QP6A 2QENA 5DCMB 4AIJA 3HRTA 5F6FA 4QLCU 3J81K 1HXDA 5DUIA 2EWNA 1G3YA 3T5XA 5CVRA 1K6OA 2VODA 1ZG5A 4L9JA 2STTA 2HYFA 3ULQB 2K86A 1LNWA 3HRSA 3BJAA 1Z6RA 4ZYHA 4HYEA 4L9VA 1BI2A 4IPAA 5LGNA 1PP7U 2HFHA 2ZXJA 4D0PA 2VBZA 3WGHA 4MEXF 2K4JA 2XAHA 2HKXA 5BS6A 1U6GA 1I5ZA 2OQRA 3U9GA 3FM5A 2DK8A 3N97A 5KK1A 3BZ6A 3DFGA 4IVNA 5FLXK 2P7CB 5E1ZB 3GUDA 5L3FA 4KT5C 2Q0OA 4PCQA 3K0LA 3GX4X 4FX0A 1YO5C 1L0OC 1YG2A 4G7ZF 4RGRA 3T1BA 2VBXA 4EMSA 1D8KA 3ZMTA 2MH2A 4R79A 2X4HA 1TLHB 3ABTA 1QPMA 3U2RA 4ZZDA 1UFMA 1TNSA 4YG2F 1U8RA 3FZVA 5CVJA 4KN7X 4KA4A 4I0AA 2OZUA 4KDPA 3GWZA 2CG4A 5FFZA 1S6LA 1PP8F 3I71A 1G3SA 3NEUA 2ZMEA 3M7GA 2XGXA 3RKWA 2EFWA 2GXGA 3CUOA 4F7ZA 4U0YA 2NAZA 2VN2A 3ML6A 2YPRA 2E1NA 3LA7A 4CDGA 2L01A 3BPXA 4G6DA 4A5MA 4BH9A 4GXOA 2ISYA 1EH7A 4UVCA 4B8XA 3B02A 2PEXA 3SFZA 2HTSA 2H09A 3JTHA 2A61A 1HW2A 3E97A 2G7HA 4CXFA 1TNTA 3BP8A 3V8JA 2Q2EA 3HTSB 1YFHA 3F8FA 2QWWA 1D8JA 3I5UA 5HDKA 1R1VA 2DI3A 3DKWA 2HYGD 1YTYA 4Q48A 3ECHA 1CF7A 4HOBA 2XASA 2ZBKA 5LRSA 1OMIA 3O2PE 2QBYA 4A6EA 2GA2A 1T6SA 4LG0A 3C18A 3WTZA 1IN5A 2Y0MA 5TRDA 3RJPA 4KIFA 1ZLJA 1KYZA 1XSXA 3L7WA 1Y0UA 2ZFWA 3WE2A 3I58A 1DPRA 3E6CC 2LNBA 3RI4A 1MKMA 4I09A 5JHUA 2QVOA 3KZZA 1S8NA 4UVBA 1SD6A 1HW1A 1T38A 2EFPA 3ZMUA 4EJOA 3IRRA 3O3KA 1UB9A 4WK8F 3CJNA 3QPTA 4AIKA 4EQQA 2HGCA 1OYWA 2MC3A 1SD7A 1E17A 4LB6B 2A6HF 3KZYA 2HQRA 3LFKA 2YX7A 1FBSA 1ZREA 1JHFA 1IZ1A 3KP4A 5HLHA 5HDGA 3WG9A 4RAYA 5AONA 5ICGA 1R1TA 3K1PA 5D5WB 1P6RA 1ZN2A 3RYPA 5FD6A 3NQOA 2NS0A 3IC7A 1C0WA 4WX9A 1J0RA 2H94A 3HSEA 3MQ0A 5HS8A 5E20A 5ICEA 5CJ9A 3I64A 3OV8A 1KQ9A 3GF2A 1R7JA 4ESBA 1FSEA 3DQVC 2OZ6A 4WF2A 1QZZA 4HW0A 2O0YA 3H92A 2XAGA 4A0YA 1SD4A 2EFQA 3SHFA 5JR3A 1TBXA 5BOXA 2W85A 1XMKA 4CYDA 2L02A 3EETA 2WTEA 5A2QZ 4IHSA 3F3XA 2XAQA 5J8FA 1DPUA 1F9NA 2HQNA 3F8CA 4N0BA 3KP3A 3LA2A 4EV0A 4BHCA 2M45A 3FMSA 3F6VA 4RGSA 2Z3YA 2OA4A 3TOBA 2JTVA 2VBYA 5D5UB 3WGGA 4LK0F 3FF5A 3I59B 3ELKA 2IPQX 4L5JA 3TO7A 1Z05A 3LQQA 2K4BA 3KLOA 3TGNA 2HEOA 3ZMSA 5D8KB 2GQQA 3FXRA 1ZAOA 5CVIA 3F8MA 4CZZA 4BHBA 2XRNA 1BBYA 2D45A 2EA4A 3WU1B 4EM0B 5FLXZ 1WKMA 1O7FA 5D5XB 5HS9A 3M8FA 1XSVA 1UHWA 4DNCA 2YR2A 1FNNA 4HQMA 2F5DA 3OOPA 1B6AA 1J9IA 2A68F 2M5WA 1CF7B 1QNTA 2FRHA 5E1XA 2WC2A 2ZNZA 2CSOA 1IXCA 4OOIA 1EV7A 2QBYB 1P92A 2RGVA 3R60A 3RPUA 3ERED 2FXAA 4NHJA 2MH9A 2DPDA 2LDUA 1B9NA 2IRFG 4LG0B 5ED4A 2KKOA 2VOOA 2FSWA 1Z91A 2K27A 1H9GA 1KU3A 4KYWA 3F23A 5LHGA 3IKVA 4LLLA 3GO5A 1HKQA 1MJ9A 4S04A 4ENKA 1REPC 4KIBA 3LAJA 2ZJ2A 2Z5UA 5CLSA 2QYOA 3F22A 2BE5F 2G7UA 2P5VA 3WTUC 4U0VA 3L09A 1BC8C 1G3WA 2OBPA 1BM9A 1KA8A 1W5SA 1YW9A 2VONA 5H6RA 3C1DA 1FPQA 3WTTC 2F5EA 2DW4A 3P9CA 5DD4A 1SFXA 3HSFA 2JRTA 4PGGA 3V4GA 4M73A 4HX4A 4G9YA 1KU2A 1FZPB 3TOAA 5LHHA 4HV5A 2A6EF 1RZ4A 4NQWA 2GXBA 4EM2A 1BJAA 5AIQA 5L3CA 2IA0A 1ZHFA 5FFXA 1B59A 3ZMZA 5LLQA 3KE2A 4I0BA 2ZCWA 4BQAA 4RB2C 2QZ8A 2V6CA 3EYYA 3T8RA 4Y17A 1SD5A 2E1CA 1QZYA 5BPDA 3E6DA 3WTVC 3F72A 4EVIA 4EJTA 2PG4A 2V9VA 4XSXF 1YW8A 1IUYA 5DCFA 1QBJA 3QRFF 3IHUA 3IWZA 5DD8A 2EJRA 4MEYF 2W84A 1IN6A 2MA3A 2PN6A 3QP5A 4HDUA 4HBLA 2DFIA 4IRIA 4WCGA 3MZYA 5A2QK 5HDNA 4A2UA 2B0LA 4ZYGA 4ENNA 1FYKA 4YFNF 3I0TA 4A5NA 1LEBA 1A04A 2CQKA 2PJPA 4BYYA 5LGUA 5ICCA 3JTGA 4M9SA 4NB5A 3I59A 3IKTA 3J7AO 3T8TA 3L9FA 3LQRA 1W7PB 1CGPA 4EJWA 3R6SA 3QU3A 3AAFA 1QO0D 1XGOA 1FYLA 2FQ3A 1BOAA 2HKOA 1KQ0A 2QM3A 4EM1A 2V1UA 2RN7A 1U78A 5H20A 1YQAA 1IAWA 3KP7A 1JGSA 3MAJA 5FB2A 4WWCA 2IVMA 5E17F 2FMLA 5H6QA 4GO1A 5CYVA 2FBHA 4MQ9F 3DXJF 4XLNF 1J75A 4M72A 1QGPA 3BROA 3HYIA 4L9TA 2EA2A 1MDMA 1YIOA 3S2WA 4AWXB 1BI1A 1B4AA 1HSTA 1PDNC 2NNNA 2L54A 1X3UA 1OPCA 1STZA 2VE8A 3D5LA 5D6EA 2WWYA 2QUFA 1OR7A 5BPIA 4LJZF 2H27A 2PLYA 1I6XA 3J80Z 1TQPA 4TV7A 2HDCA 1I1SA 5CVVA 1BI3A 2GA1A 4UV8A 2DO7A 4LLGF 1U3EM 4ZYEA 4FT8A 2FNAA 4OINF 3ROUA 3FMRA 3H3UA 3ABUA 3E5QA 5L3DA 3HSRA 2ELHA 4RAZA 4L9NA 2A3SA 3RKYA 3SQNA 4GYGA 1I1GA 3HHGA 4MQVA 1E2XA 2JSCA 5D4RA 1HBXG 4BAYA 2HZTA 4P96A 3K1NA 3DV8A 3VODA 3FMQA 4BHPA 2O6GE 2ESHA 1I27A 1PUEE 1ZH5A 4MHGA 3GLXA 3K1MA 2F2EA 1D3YA 2RNJA 5DV5A 4UVAA 2L4MA 4BNCA 2A07F 4KMFA 2AS5F 3JAMK 4IRHA 1S7AA 3E6MA 3I53A 2VOPA 1HW5A 1YS6A 1XCBA 3DPLC 3MFKA 3M9AA 1GXQA 1J59A 4UV9A 3R4KA 2RVCA 1ZG1A 1P2FA 3G3ZA 4I01A 2QQBA 4EJVA 2STWA 1IW7F 3SZPA 4I2OA 1S3JA 3D0SA 2L4AA 4FX4A 3QU6A 4IF4A 5HLGA 1O57A 4FHTA 2GIVA 1FOKA 4I02A 3CTAA 2BGCA 1U2WA 2CYYA 3WU0A 1IF1A 3N4MA 1MJBA 2A5YB 3KETA 1S29A 2K02A 1RUNA 4XRFA 2DU9A 4OU0A 1LB2A 2O03A 3BWGA 5DYMA 1K79A 3U1DA 1FY7A 3V8LA 2R3SA 3BDDA 4A12A 2DK5A 3TDUC 2CWEA 1IN8A 4L0YB 2R7DA 2PMUA 4O3MA 5LHIA 4OMZA 1R23A 3E5UA 3JW4A 1WI9A 2IA2A 4AD9A 2DLLA 5L3EA 5F1RA 5HOOA 4YIIA 1ZLKA 2W25A 2DBBA 5E8IA 4CICA 1USTA 3VEPA 1LEAA 1H0MA 3VFZA 3C7JA 3GYHX 2RDPA 1LJ9A 2X0LA 1DUXC 3K69A 1WSUA 2VXZA 4XSZF 4EJUA 3KP2A 3TKYA 3K9TA 2ZMEB 2FF4A 2HWVA 4JK1X 3WTWC 4P9FA 2Y48A 3I4PA 3ZMDA 1MDMB 4JBAA 4DQ2A 4R1HA 2DQRA 4PDKA 2M30A 2KIFA 1ODDA 3DF8A 2KIMA 1Z1DA 3V8KA 1YLFA 2QLZA 4CO8A 1T0FA 4A0ZA 1RNLA 1Z9CA 5FGMA 3WE3A 3HRMA 1SFUA 2Z9OA 3IL2A 5EEGA 3MWMA 2DT5A 3GW2A 2W24A 3QAHA 3KP5A 2EK5A 2IW5A 4OIPF 1FT9A 2RC4A 4B09A 3GFIA 2KJBA 4S05A 2LKPA 2PBIA 1O3RA 3LA3A 2EFNA 5ERIA 2M8EA 4L5IA 2EV6A 4HLXA 1XGMA 4AIHA 5F64A 1IRGA 2COMA 1K78A 1BC7C 2P5KA 2IP2A 2AXLA 5IT9Z 3RIRA 4K2EA 4KN4X 4P5OA 3COAC 1BN5A 2MBFA 2K7LA 5ICFA 2V79A 1EH8A 2O3FA 4CGZA 2VC1A 3B73A 1R58A 3TO9A 1HSJA 4HF1A 3G73A 1XD7A 4OMYA 2FNPA 5DDGA 5DUKA 4N9HA 1HKTA 1GHCA 4YIFA 2O8XA 3F8BA 1IRFA 3RTRA 4EGZA 1R00A 2PQ8A 1JHHA 3FX3A 1L3LA 1HKSA 2P6TA 4OIQF 1W4MA 3JSPA 3ZP5A 1IN4A 4M9ZA 6PAXA 1SMYF 4RB1A 4EGYA 4YFXF 4Y15A 4P9UA 4KUMA 4Z2YA 2LF7A 4OIOF 1GVJA 3ISPA 2YX4A 2Z33A 1J5YA 1UHMA 4GCVA 1OKRA 2FOKA 3C3WA 2UXNA 3R61A 1K7AA 3V7SA 2HOEA 1G6NA 3O6BB 3HTUA 2HS5A 3GZ5A 1H9TA 5AIPA 4LFUA 2XROA 1MJAA 4N9IA 4R8HA 3VB2A 1ZRCA 2A69F 3F6OA 1ON2A 2ESNA 4P55A 3RPQA 2DAOA 2EB7A 3TDZC 2V1XA 1UCRA 4YFKF 1XCVA 3WTYC 1XN7A 4I7HA 1FYMA 4RB3C 2EV5A 2UXXA 2XKPA 3W6KB 2W57A 1ON1A 1KU9A 5ILVA 3GEZA 4LLNA 2G9WA 1JE8A 1RIOH 1V3FA 1R5HA 1FX7A 3CDHA 3GVAA 4E70A 1XSDA 1XMAA 1MZBA 5ILUA 4XBFA 4HF2A 2YSRA 4M71A 2LF8A 3HOSA 4HAMA 3T0YA 4ENMA 5LEKA 2EFOA 1ZRDA 2CGPA 2VBWA 4OIRF 4RB0A 3BPVA 4GGGA 4L0ZB 1FP1D 2OAZA 4ESFA 4CHUA 3M1EA 1XDUA 1FLIA 2OQGA 2RKHA 2UZKA 1ZYRF 3BJOA 3JSOA 2XAJA 1Z6TA 2FA5A 1XGSA 2MLGA 5BMZA 1OYIA 3E6BA 3P7NA 2Y75A 1K78B 4WXHA 1YYVA 1U5TC 3KLNA 1YS7A 1F5TA 1J2XA 1P4AA 4LB5A 3CUQA 3E3VA 2M1BA 1LDDA 4MNUA 4JQFA 4ENJA 4PZJA 3GFMA 2MD5A 3P9IA 1O3TA 3GZ6A 2UWMA 1U5TB 1T39A 5DCMA 3QOPA 1TW3A 5CVUA 3EQLF 2ACJA 5K5OA 3ZMVA 1ZG3A 3KEOA 1Z7UA 2BBYA 1TW2A 2XVCA 4M9XA 4HX7A 5EEHA 5JVTA 3F21A 2YU3A 4G7OF 3BY6A 1O3SA 1YW7A 4KMUX 1NHAA 3ECOA 4UUVA 2NNYA 5HVQC 3V7RA 5K5RA 4UNOA 1FBQA 3KEQA 2DPUA 1V4RA 1BI0A 2GAUA 3IRQA 4G7HF 1FP2A 3Q5FA 1MGTA 2VT3A 2GWRA 4O5VA 5K5QA 4ZYDA 4RGUA 5K1YA 4I98B 4ON0A 1WQ2A 3HUGA 3EDPA 2P7VB 3WTXC 1W7PD 1WWXA 3J80K 5J8CA 2CFXA 5DEQA 1BIBA 1R5GA 5E1WA 1S7OA 2KIUA 3PQKA 4LMYA 2XUBA 5J6XA 5IT3A 2BYVE 5FO5A 1XDSA 2XHKA 3DPTA 3V7CA 2P8TA 2OU2A 3HHHA 2QQAA 3FM3A 2CW0F 3K2ZA 4IXAA 4H0EA 4UXNA 4ESJA 2IJLA 2RV8A 2M87A 4HA8A 2D2WA 4RS8A 1B9MA 5E18F 2F5FA
chains in the Genus database with same CATH superfamily
4HDVA 3M8EA 2FBIA 2VQHA 1WRJA 3F8NA 1IUFA 4DZJA 2F5VA 2X1CA 2BHZA 1TWGJ 1GT0C 3J81Z 4RBOA 2CO5A 4F93B 2ZJPF 2IT0A 3FXUA 4IHTA 4UUSB 2QQ8A 3BJ6A 3DP7A 3MZHA 1VZ0A 1MSEC 2JT1A 2JPBA 4S0HB 5LBQA 2KJCA 1K6YA 3LSRA 2E7WA 3LMMA 4U0WA 2O5RA 5HLIA 1SMTA 2D1HA 2FJ1A 3K4LA 5TISC 5JFRA 2J5OA 2IS1A 3VSKA 5LEJA 1OISA 2XIGA 1R1UA 3BTLA 3LSGA 3SEQA 3W6JB 3ZRGA 1O3QA 4BU2A 2KDZA 1FC3A 2A05A 2KL4A 3DEUA 3MEXA 4BGDA 3IV5A 1R4NB 1D5VA 5EG0A 3VOEA 3OSFA 1LVAA 2ZC2A 4RGXA 1ULYA 2BXZA 4AVPA 3CUQB 4ZZLA 2LSOA 2VT2A 4LITA 5BQTA 2DOFA 2HVRA 1J7KA 3I3LA 3PUFA 3K4BA 2AO9A 2UUZA 1IDZA 3CO7C 3PO2J 5F0CA 4HZFA 2E60A 1IXRC 3OYGA 1ZGJA 3RYRA 4HV6A 4MLOA 1Q1HA 2PJRA 1XB4A 1G2HA 1D1CA 4O6JA 3DCFA 3LAPA 4Q5SF 2HR3A 4RLQA 4KNYA 5FRMA 1H8AC 2MLKA 1X4PA 2EQRA 2VIXA 3H5RA 4G6QA 1SFKA 4XQFA 2V1NA 3GFLA 1G4DA 3WODF 3X2QH 1G8XA 4N4OB 4QPOA 3E7LA 1SFEA 2R7OA 2Z99A 4QWQA 1ZRFA 3OYKA 1MNEA 4L18B 2PFBA 2F4OB 5M3MJ 1IG7A 1D0ZA 3OMYA 1AOYA 3FHNA 1MW7A 1ONVA 2L9NA 4W97A 3L2WA 2Q8KA 1T98A 2RQPA 4D7NA 1ZK8A 1XPXA 2FEZA 2XV4S 2PI0A 3DTIA 2FE3A 4IRGA 3HOWJ 2ELKA 2DT7B 4G94A 5D6FA 1T33A 5EZGA 2HQ5A 3PM1A 3L2VA 4LK1F 2P6SA 2L3DA 4XRSA 3WGIA 2E1MC 3FHZA 4BJ6C 3H3ZA 3TO6A 4HX8A 3DKXA 2XF6A 4MGRA 3Q9VA 1NG6A 1TQMA 3KIOA 3M1CA 2CUEA 3CCJI 3CCQI 3H9GA 4KICA 3TW6A 4FISA 2L9SA 3KP6A 4CA0A 2C6YA 5FKOA 5E8GA 3TP0A 4PJJA 1X19A 1U5TA 3MCZA 3BOQA 3FISA 3W2WA 3A01B 4U7BA 2KP6A 1KYWA 1Y8RB 5GAEJ 4XLPF 1IXSB 1LQ1A 2PMHA 4PGHA 1FOWA 1KGSA 5HS7A 2X1EA 5JI6A 3BT9A 3GFJA 3CMAI 2IEKA 1R22A 2H6BA 3ZQCA 3QPHA 3JRIA 1VF9A 5ILSA 4Y52J 4G8XA 3IWFA 1K4TA 4GYIA 3CCSI 2NYXA 2ETHA 4BXFA 3DU5A 3DLLF 2VI6A 2J5PA 1RUOA 4MTDA 3DTEA 1YJWI 2H8WA 5IT9K 3EUHC 1UG0A 3OR2C 3RKXA 3R0AA 4NUBA 4U87A 2FU4A 1TC3C 3NRVA 2L5QA 3SZTA 4CCNA 4BKXA 1RI7A 2V9PA 3F0CA 1A5JA 4LG3A 5TJJA 4YRVA 2O61A 3IAS2 2WAQN 1KQ8A 1R6RA 5D5VB 1MH3A 3RQ4A 4BQQA 2OV7A 3ZN1A 4BQOA 1P4WA 1F1ZA 2QSFX 4M3FA 1Y8QB 3REOA 5D4SA 2VE9A 2BV6A 4U7DA 1YRNB 3RDIA 2EV0A 4A0XA 3DBLB 2TDXA 2R7RA 2GZWA 1SAXA 1QRYA 4HSTA 5LRRA 2KRFA 2X9DA 3L2RA 4KFCA 4KISA 2NXNB 2E2HJ 3PQJA 2LK2A 1TWCJ 1ZKGA 5L3BA 4CCJA 3VDXA 3KX2A 2IGOA 3SXYA 2FBKA 1FWZA 1USSA 3FXQA 3Q0VA 1WJBA 1QQIA 3LOCA 4C3HJ 1JKRC 3GLLA 3S8PA 3HOTA 4HRIA 1VQNI 1FSHA 4Y13A 1WPKA 2DA1A 1W7PA 5L3GA 4ASNA 1FOYA 4CUGA 2ZB9A 3ZQIA 3FXMA 5D8LB 4D1QA 3EUHA 3OS1A 3P9KA 2VQLA 1QVTA 1PVEA 5GAHJ 4HF0A 4ZYAA 1O7LA 4E7LA 3OYAA 3A0HC 3HRUA 4PFPA 4HQEA 1IN7A 2W1OA 3CUQC 1W5TA 4BXUA 3H9JA 2BEOA 3ZPLA 3HL2A 2KPMA 1X4OA 2DJIA 1GVDA 2D1VA 1HQCA 2RQQA 2XAFA 3HIFA 3ZCOA 1Z3YA 1R36A 3DTKA 3QYFA 2IA1A 1AWCA 5JLXA 5FD5A 3HKZA 5IY5H 3H0DA 2HZDA 3B6AA 3LSTA 3E5XA 1TT5B 3FDYA 4M74A 2P5LC 1KU7A 2ZNYA 2MW8A 2LKSA 2XKOA 1LDJA 5GPCA 3W6VA 3H0GJ 3PUBA 1ZQ3P 4FCYA 1NK3P 2CJJA 1EH6A 2F48A 3Q9SA 3J7AY 3CO6C 1MMGA 3ZQ7A 3SDBA 3K4NA 2JA6J 1VNDA 2X6XA 3CLOA 1OCOH 2WAEA 3PSFA 1VQ4I 4M3EA 4WXDA 3SDGA 1RR8C 1YJ9I 4B48A 1G59A 2P4WA 4MTEA 2CV1A 1CQTA 2BXYA 1X1CA 1TQIA 3A02A 5FLMJ 2QQ9A 1OYYA 3S17J 3JAMZ 3ZN0A 2DCEA 3RPUD 2CS3A 4WXCA 2JPCA 2L7ZA 4XKBA 1IDYA 4IJAA 4ZH4F 2BHYA 1VTNC 3L2CA 3CMEI 3KCCA 5LGTA 1A36A 4U88A 4LIVA 2H6CA 2VC0A 3LSIA 3IUOA 2HTJA 1BIAA 2NRAC 2ZKZA 3I54A 2LTPA 2PMZN 4UHTA 1GXPA 3BTJA 3L00A 4KIGA 2LH9A 4M6YA 3CCYA 2ISZA 2JZYA 4Q4ZF 4CYCA 1ZGAA 2DTZA 2WV0A 1FEXA 1DDNA 3R0JA 1LFBA 1G3TA 4UB8C 3EYIA 2M9HA 2Y30A 1T2KA 2VKEA 2E71A 2OCEA 1B1BA 3TQNA 1TTYA 3KFWX 1DP7P 2DN0A 4A6DA 2VQGA 2CV2A 1BW6A 1RESA 2KISA 1LDKB 1ZARA 2M0CA 3GTMJ 3FWEA 2OUMA 4DYCA 1FBUA 2ZO4A 1JXSA 2KMUA 4BACA 1XGNA 1OFCX 3A03A 3MKZA 1P4XA 2WAQA 5FROA 4ETSA 4I6ZA 2FMYA 3WTSC 3JRFA 3LWFA 2NS8A 4Q47A 1OJLA 1MD0A 2ECBA 3KZIC 2ADUA 4LGWA 2V1DA 2F5CA 2X6OA 2R7FA 3M8JA 3K4KA 3PFIA 2DTRA 3FK7A 3GXOA 4M6XA 4HLYA 1UJ8A 4A3BJ 1YI2I 4LD5A 2DQLA 5KVRA 3A0BC 2BW3B 4ITVA 3K4MA 1Z21A 2ECCA 2LY9A 2MD0A 2OD5A 1JJ6C 4HPQA 2E7XA 1F4KA 3KYCB 3QP6A 2YUSA 4OAYA 2P0WA 1YRNA 3ZXSA 2QENA 1Y39A 3CC4I 5DCMB 4AIJA 3HRTA 5F6FA 4RM2A 2CH0A 1S7EA 3FXLA 4QLCU 5F0HA 3J81K 2R5ZB 4PJMA 1HXDA 3JRGA 2M0MA 3BR0A 2HI3A 1TWHJ 5DUIA 2EWNA 2Y31A 1AU7A 4AYBA 1G3YA 1HDDC 1I6HJ 2CFOA 3HGYA 3T5XA 3AKZA 4CCLA 5CVRA 5E3NA 1K6OA 2VODA 1JJ8C 1ZG5A 5CQEA 4L9JA 2STTA 2HYFA 3HM5A 3ULQB 2K86A 4ZC3A 2XGEA 3QQAA 1LNWA 5IP7J 3HRSA 3VYUB 3BJAA 1V5FA 1Z6RA 4ZYHA 4HYEA 4L9VA 2VQCA 1BI2A 1APLC 4IPAA 2LBFB 2VJIA 3TMOA 5LGNA 1PP7U 2HFHA 2ZXJA 1ETWA 2LOOA 4D0PA 2VBZA 4DBQA 1UELB 3WGHA 3KYLA 3G2BA 3UNGC 4MEXF 2K4JA 2XAHA 3CJTB 3Q0WA 5KAIC 4CSWA 4D7MA 2HKXA 5BS6A 1U6GA 1I5ZA 2OQRA 1J09A 1JT0A 3U9GA 3FM5A 2DK8A 2JSPA 4E7HA 2ZSHB 3N97A 5KK1A 4PJ0C 5DTDA 3HBLA 2K3FA 3N05A 2NVXJ 1K4SA 3BZ6A 3DFGA 4LIUA 2WA0A 4IZZA 2Z16A 4IVNA 3MKWB 5FLXK 4D5CA 3K2AA 4G12A 2P7CB 4ZDPA 3HUGB 3GUDA 3IP4B 5E1ZB 5L3FA 3GTGJ 3FXKA 2Q0OA 4KT5C 3C2HA 1TL8A 2K5CA 4PCQA 3K0LA 3GX4X 1HF0A 4A93J 4ANJA 2LKXA 4FX0A 1YO5C 4BDYA 1L0OC 5F27A 4J19A 1YG2A 3MMYB 3TW7A 3JREA 3FBNB 2G0EA 1QVUA 4G7ZF 4RGRA 3K10A 5HNHA 1YJNI 5IP9J 4OWRB 3OOUA 2L2OA 3T1BA 2V6EA 2VBXA 9ANTA 2DYRH 4XOPA 1T56A 2FD5A 1X1PA 4EMSA 1D8KA 1ETXA 2DXIA 3ZMTA 5B1BH 2MH2A 1XMXA 2IGNA 3W2AA 1OCTC 4R79A 5M3FJ 2X4HA 1TLHB 3RKQA 2X48A 3S1NJ 3ABTA 2I8DA 1Y1WJ 1QPMA 3U2RA 4ZZDA 1UFMA 1VQKI 1TNSA 2E2JJ 4YG2F 1U8RA 1JKPC 3OYNA 3FZVA 5KNLA 2NVYJ 2W00A 5CVJA 4KN7X 1SANA 4KA4A 3FKIJ 5M5XJ 4E7SA 4I0AA 2OZUA 4KDPA 1R71A 3K4CA 3GWZA 2W48A 2EZKA 5HNFA 4XRMA 3NAUA 1RKWA 1T8IA 2CG4A 5FFZA 1S6LA 2PMZA 2CMPA 1PP8F 3CJQB 4G6TB 4KT6A 3I71A 4XLAA 2IS4A 4UB6C 1G3SA 3NEUA 3ZQHA 2ZMEA 3M7GA 2XGXA 3RKWA 1JUMA 2EFWA 3MKLA 2O7OA 2AQFA 2GXGA 1Y0NA 2JQ7A 3CUOA 4F7ZA 4U0YA 2NAZA 3BR3A 2VN2A 3ML6A 3OYMA 2YPRA 2A5WA 1MMNA 3SJMA 4AM3A 4YELA 2ME6A 2DA5A 2E1NA 3LA7A 3FXJA 1TWAJ 3CCVI 1WGXA 3SYTA 4CDGA 2L01A 3BPXA 2YU9J 2HPMA 4G6DA 4MFEA 4A5MA 1F36A 3ONQA 4BH9A 4GXOA 2ISYA 2HDDA 1EH7A 1MMDA 2RNGA 4UVCA 4B8XA 2MG4A 3B02A 2PEXA 3SFZA 2HTSA 2H1KA 2H09A 3JTHA 1WJCA 2A61A 3RZOJ 2DMUA 3CMYA 1VQ9I 2KQRA 1HW2A 1M1EB 1HC8A 3VPRA 2XB0X 3E97A 2G7HA 1YHQI 4ZJZA 4CXFA 3HOXJ 1TNTA 4AYBN 4FETA 2EIKH 3BP8A 3V8JA 2Q2EA 3HTSB 2KRCA 1YFHA 3F8FA 2QWWA 4IOAF 3KEYA 3HDDA 2F4MB 1D8JA 3I5UA 5HDKA 1R1VA 2DI3A 1YIJI 2WBMA 3DKWA 2HYGD 1YTYA 4Q48A 3ECHA 3VWBA 3M4OJ 2BOLA 1CF7A 2XSJC 4HOBA 2XASA 2ZBKA 1VQ8I 2WB1A 2DJNA 3H9QA 5LRSA 3OYCA 2R92J 4CCKA 2CUFA 4BL0B 2R93J 1OMIA 2WAFA 1V5EA 3O2PE 2X85A 4XKWA 1MH4A 2QBYA 4XM3A 4BEHA 4A6EA 2DOEA 2GA2A 2XGDA 3ASNH 3GTOJ 1T6SA 2CW8A 3OYHA 2JUCA 4LG0A 3C18A 3WTZA 4RA2A 1R49A 4AVZA 3HPHA 1IN5A 2E34A 2Y0MA 2HXIA 5TRDA 1P7IA 1MBKA 3RJPA 4C2UA 4KIFA 1WJ5A 2KFDA 3H5NA 3A01A 1ZLJA 1KYZA 3G71I 1XSXA 4CCMA 4L5EA 2EZHA 3L7WA 2ZJRF 1Y0UA 2ZFWA 3WE2A 3I58A 1T08B 1Y6IA 1DPRA 4I99C 3E6CC 2LNBA 2N8GA 3RI4A 3OSGA 1MKMA 4I09A 5IOZA 5JHUA 2QVOA 4QPQA 2XGCA 3KZZA 1S8NA 4A3JJ 1I39A 3S15J 2CRGA 4UVBA 1SD6A 2ZJQF 1HW1A 3G4SI 1T38A 1U9OA 4JX5A 2Z1DA 2LREA 2EFPA 3ZMUA 1N25A 4P1WA 5F0FA 4EJOA 3IRRA 3O3KA 1UB9A 1XS9A 3S14J 4A3IJ 2HQAA 1X1AA 3S3MA 4WK8F 3CJNA 3PNTA 3QPTA 3PFYA 4AIKA 5IOYA 5IP6A 4EQQA 1ZTRA 5DM7F 2HGCA 4OAZA 5J1UA 1OYWA 2MC3A 4JYKA 1SD7A 1E17A 4LB6B 2A6HF 3KZYA 2HQRA 3LFKA 2YX7A 1SAUA 1FBSA 1ZREA 1JHFA 1IZ1A 2XDVA 3KP4A 1ORKA 4Y33A 2E19A 4F55A 5HLHA 2RAEA 5HDGA 3WG9A 4RAYA 4GFBA 5AONA 5H2FC 5J3LA 5ICGA 3JRCA 1R1TA 3K1PA 5D5WB 1IC8A 1P6RA 1ZN2A 4LOCA 3RYPA 4MIMA 5FD6A 5EJCA 3NQOA 2NS0A 2W4SA 4GDFA 3IC7A 1C0WA 4DJAA 3ZQQA 4BJTA 2BY2A 4WX9A 1J0RA 2H94A 3BTCA 3HSEA 2DA3A 4XONA 3MQ0A 5HS8A 5E20A 4ABZA 5ICEA 5CJ9A 3I64A 3OV8A 1Z77A 1KQ9A 3GF2A 4AC0A 1R7JA 1QA6A 4ESBA 2JRMA 2JA8J 1N78A 1FSEA 3DQVC 2OZ6A 4WF2A 1P9QC 2EPFA 1QZZA 2HYJA 4HW0A 4FE4A 4XNFA 2Y9YA 2ZXWH 4QTRA 3S3OA 2O0YA 4XKVA 1BA5A 2EZLA 2I10A 3H92A 3U1KA 4B44A 2XAGA 4PSXA 4A0YA 1ERDA 1SD4A 2EFQA 3SHFA 4M3DA 5JR3A 2LMDA 2AXTC 2K85A 1TBXA 2RREA 4E6KG 5BOXA 2NVTJ 5LD2C 4M3BA 3BQZA 1EJ9A 2W85A 2MC4A 4YEJA 1XMKA 4CYDA 2L02A 1I50J 1FOXA 1WHUA 3EETA 3EUKL 4BE1A 2WY8Q 2FQ4A 1KONA 2WTEA 3BG3A 3IH4A 2HNHA 3HZJA 5A2QZ 4IHSA 3F3XA 3CF5F 2Y9ZA 2XAQA 2LYCA 4CCOA 4DW6A 5J8FA 4DGWB 1DPUA 4C3IJ 3QPSA 2W7NA 3QWLA 1F9NA 1Z7LA 2R7WA 1U8BA 2HQNA 3F8CA 4NC6A 3CD6I 3ZQFA 4N0BA 4XIDA 4A3CJ 3KP3A 3LA2A 1X3WB 4CH7A 1GLNA 3JRHA 4EV0A 4BHCA 2M45A 3FMSA 5J4VA 1IRXA 3H3VK 1SFOJ 3F6VA 4RGSA 2Z3YA 3K70C 3JRAA 3P5JA 2OA4A 2ID6A 3TOBA 2JTVA 3IAM2 2VBYA 4HNUA 2XRLA 5D5UB 4XK4A 3WGGA 2DFEA 4LK0F 3FF5A 3BR5A 4JP0A 1GV5A 5GPAA 1QPIA 3I59B 3ELKA 2MGQA 2IPQX 4V2GA 3HJEA 4L5JA 3TO7A 1Z05A 3ZGKA 4XN0A 5E3MA 1MBGA 2E1OA 4CYCB 3LFUA 4RAFA 1VI0A 3LQQA 2K4BA 3KLOA 3TGNA 2HEOA 3CP2A 2DFFA 3ZMSA 5D8KB 1PYVA 2GQQA 1OCRH 3FXRA 1ZAOA 5CVIA 3F8MA 4CZZA 1MNMC 4GRIA 4BBSJ 1R5ID 3CCRI 1TT0A 2ZXHA 2XRNA 4BHBA 4IKFA 1QHHD 1BBYA 2D45A 2EA4A 1H88C 4PK4A 2XPWA 3WU1B 4EM0B 5FLXZ 1WKMA 1BJZA 5FKKA 1O7FA 5D5XB 5HS9A 3CZ6A 4XLEA 1TZLA 4DYQA 1ZR2A 3M8FA 2QCOA 1XSVA 1UHWA 3AG3H 4DNCA 3S3NA 5FLVA 2DA4A 3GTPJ 2YR2A 1FNNA 4HQMA 2F5DA 3OOPA 2NS7A 4E7JA 1B6AA 3ZQLA 1J9IA 2A68F 2M5WA 4NC7A 4UUSA 3JR9A 4DIQA 1CF7B 3HOYJ 2YS9A 1ZELA 1QNTA 2FRHA 5E1XA 3MVPA 2TCTA 2WC2A 2ZNZA 2XB5A 2CSOA 1IXCA 4OOIA 1EV7A 2QBYB 1P92A 1NK2P 2L7MP 2RGVA 3R60A 1P7JA 3RPUA 2FXAA 3ERED 4IL6C 4NHJA 2MH9A 3CLQA 3LSHA 2DPDA 2LDUA 1B9NA 2IRFG 4LG0B 1Y1VJ 5ED4A 2HVSA 2KKOA 2EH3A 4AU7A 1W0UA 2VOOA 3GCMA 5JHFA 1RPWA 3IH2A 2FSWA 5FJ8J 3CCUI 1Z91A 2JA5J 2K27A 2R5ZA 1H9GA 3VSLA 1KU3A 4KYWA 3F23A 3HEFA 4RM3A 5GADJ 5LHGA 3IKVA 1ETOA 3VYTB 2LD5A 2X51A 4LLLA 3S2HJ 2EINH 3GO5A 1HKQA 5E3OA 1MJ9A 4QSHA 4S04A 4ENKA 1REPC 4KIBA 3UKGA 3LAJA 3I4NJ 2ZJ2A 2Z5UA 5CLSA 2QYOA 4QIWN 3F22A 2BE5F 2G7UA 1B72B 1S72I 4C3JJ 2P5VA 3WTUC 2KIQA 3K7AJ 4U0VA 3L09A 2A6TA 1BC8C 5CPRB 2CQ7A 1G3WA 1HDPA 2OBPA 1W36D 1BR1A 1BM9A 1KA8A 1W5SA 1YW9A 3AG4H 2VONA 5H6RA 3C1DA 1FPQA 5BNGA 2TRTA 3WTTC 3OYIA 2F5EA 3M3YJ 2DW4A 1B8IA 3P9CA 5DD4A 1SFXA 3CQZJ 3HSFA 1VQ7I 2M4KA 2JRTA 2HU9A 2M3AA 5EGOB 4PGGA 3V4GA 3CCEI 4A69C 4M73A 2DMQA 3A2KA 4HX4A 4RAGA 4HNVA 3NWTA 4G9YA 1KU2A 1FZPB 3TOAA 2ICWG 3RZDJ 5LHHA 4HV5A 5EEAA 4X6AJ 2A6EF 1RZ4A 2NOJB 4NQWA 2GXBA 3FBIB 3L1PA 3MZ8A 4IX7A 1BR4A 2DYSH 3TBIA 3AG2H 3BZCA 4F3QA 4EM2A 4XL9A 1BJAA 1BW5A 4A3GJ 5AIQA 5L3CA 2IA0A 1ZHFA 2COBA 5FFXA 1B59A 3ZMZA 5LLQA 3H1CA 3KE2A 4I0BA 4BY1J 2ZCWA 3PL8A 4BQAA 4RB2C 2LLKA 2QZ8A 2V6CA 3EYYA 3T8RA 3D1NI 2LFBA 1VQ5I 4Y17A 2JA2A 2DA6A 4HG2A 1SD5A 1R9TJ 2E1CA 1QZYA 1NH3A 5BPDA 3E6DA 3WTVC 1RKTA 3F72A 4EVIA 4EJTA 2PG4A 2EBIA 2X6YA 2V9VA 4XSXF 1YW8A 1TP4A 3PIOF 1H89C 1IUYA 5DCFA 3OS2A 1QBJA 1S5LC 3QRFF 5J47A 3HKZN 2HPIA 3IHUA 2JA7J 2IXSA 1XC5A 1Z67A 3IWZA 2EJRA 5DD8A 2GOMA 1MNDA 4MEYF 1FTZA 5JVGF 2W84A 1IN6A 2M4GA 2O8KA 2MA3A 4W1UA 2PN6A 2V4JC 2QKLB 1XX5A 4XR6A 1UZCA 3QP5A 4HDUA 5EDNA 2JK3A 1SVMA 4HBLA 2IS2A 3TL4X 2DFIA 1I3QJ 2WADA 3FK6A 4E7ZA 4IRIA 2MABA 2EIMH 4WCGA 5EYRA 1A31A 1E3HA 3MZYA 5A2QK 5J4YA 5HDNA 2IAIA 4A2UA 2BY3A 3LL7A 1O4XA 2B0LA 2GIZA 3GZNB 4C2TA 2JWTA 4A3MJ 4ZYGA 4ENNA 1FYKA 4YFNF 3I0TA 1QZEA 2H1LA 4A5NA 4B1RA 1A04A 2CU7A 2CQKA 4BQNA 1LEBA 3KYDB 2FUG2 2PJPA 3D5SC 4BYYA 2XAUA 5LGUA 5ICCA 5HODA 2IGMA 4XOTA 3JTGA 4M9SA 2CQXA 4PFOA 4NB5A 3I59A 3IKTA 3J7AO 4ZTFA 3T8TA 3L9FA 3E1SA 3LQRA 3LSPA 1MBFA 4RDUA 1W7PB 1AHDP 2NVQJ 1NTCA 1YITI 1CGPA 2QGUA 1IGNA 4EJWA 3M07A 3R6SA 3QU3A 3AAFA 3Q3SA 3JRDA 1QO0D 1XGOA 5M5WJ 1FYLA 2FQ3A 1A6QA 2DODA 1GV2A 1BOAA 2HKOA 2Q1ZB 1KQ0A 1DGRM 3AG1H 2JMWA 2QM3A 4EM1A 1AKHA 2IBDA 2ELJA 3NARA 3KPHA 1RRJA 2MSYA 2QSHX 4H4KC 2V1UA 2RN7A 1U78A 5H20A 2XF7A 4IHXA 1YE9A 1YQAA 1IAWA 3GTLJ 3KP7A 1LVKA 2EZIA 2E5NA 2OF7A 5TGTA 1Y56A 3SFIA 3DBHB 3VYRB 1JGSA 2CUZA 3HOVJ 3MAJA 2K3PA 3FXOA 3CDIA 5FB2A 2PX9A 4II3A 2E1MB 2MYSA 4BDZA 1ETQA 4HSRA 4WWCA 2LY1A 2IVMA 3GMEA 1DQUA 5E17F 2FMLA 5H6QA 4GO1A 3WHBA 1DGWY 1WJFA 5CYVA 2FBHA 4MQ9F 3DXJF 3OIPA 4XLNF 1J75A 5E3LA 4A3KJ 4M72A 1QGPA 3BROA 3OS0A 3HYIA 4L9TA 2EA2A 1SVOA 2V7FA 3G6EI 5GTIC 1MDMA 1YIOA 3S2WA 2XPVA 2CUJA 1FMVA 4Z6YA 2R7ZJ 4JX4A 4AWXB 4JOMA 2LVSA 3DKYA 2R7SA 1BI1A 2JUGA 3OYJA 1B4AA 1HSTA 2E2IJ 1PDNC 2NNNA 2L54A 1A6IA 4NQWB 1X3UA 1OPCA 3OYLA 1STZA 4A3DJ 2VE8A 1Z3XA 3D5LA 5D6EA 1GDTA 4UY8I 2WWYA 1A35A 2DA7A 2QKMB 2QUFA 1OR7A 3GTKJ 2XSDC 2VXDA 1V54H 4F91B 1D1BA 5BPIA 4LJZF 2H27A 2PLYA 1I6XA 3OL3A 2L9VA 3H36A 4J01A 3J80Z 1TQPA 3VYSB 4TV7A 2HDCA 3CJRB 1I1SA 5CVVA 1BI3A 2GA1A 4UV8A 2OC6A 2L7FP 2DO7A 4FTHA 4LLGF 1U3EM 2R5YB 4NBQA 4ZYEA 4FT8A 2FNAA 4OINF 3ROUA 3H3UA 3FMRA 1ETYA 2WV1A 3ABUA 3E5QA 5L3DA 3HSRA 2ELHA 4PJNA 2JN6A 4RAZA 4L9NA 1W36C 3BG5A 2A3SA 2LY2A 5CQGA 3RKYA 3S1MJ 3SQNA 4GYGA 1I1GA 2ZSIB 3I56I 3HHGA 4MQVA 5J1RA 4IHVA 1WI3A 1T95A 1E2XA 2JSCA 5D4RA 1HBXG 4BAYA 1X1DA 3LSJA 3DWLE 2HZTA 4P96A 3K1NA 3DV8A 3VODA 4DOZA 2R4GA 3H35A 3FMQA 4BHPA 2O6GE 2ESHA 1I27A 1PUEE 1MBJA 1ZH5A 4MHGA 3GLXA 3K1MA 2QEXI 1VQMI 1LFUP 4XLFA 2F2EA 2VLAA 1D3YA 2RNJA 5DV5A 4DBRA 4UVAA 2L4MA 4BNCA 2A07F 4KMFA 2AS5F 1OCCH 3JAMK 1R4MB 1LKXA 4IRHA 1LUJB 2L9RA 3TEDA 4BJ5C 1S7AA 3E6MA 3HC7A 3I53A 3GTQJ 2VOPA 1HW5A 1YS6A 3CMMA 4X0GA 3PJRA 2AHQA 1XCBA 1IV8A 3DPLC 1MSFC 1ACIA 3MFKA 2M2EA 3M9AA 3W2VA 1JTXA 1GXQA 1MBEA 1J59A 2KRHA 4UV9A 3R4KA 1WJEA 3JRBA 4NC8A 2RVCA 1F43A 2OTJI 1ZG1A 4XN3A 4B47A 3L2UA 2LBFA 5FKNA 1P2FA 3G3ZA 4I01A 4YIRX 2QQBA 4EJVA 3A4CA 2STWA 1IW7F 2EILH 2ZXIA 3SZPA 3S1QJ 4I2OA 1EKEA 5IYCJ 1S3JA 3D0SA 1AKHB 2L4AA 2DA2A 4FX4A 3QU6A 4C2MJ 1QU3A 2VKVA 3QPLA 1ETKA 4IF4A 5HLGA 1O57A 4FHTA 2GIVA 2HOAA 1FOKA 4I02A 1LFPA 3CTAA 1K83J 2BGCA 3HGGA 4B3AA 1U2WA 1Q1VA 2DFHA 2CYYA 3WU0A 3BCBA 1IF1A 4X1EA 3N4MA 1MJBA 2A5YB 3KETA 2LC2A 5GP9A 1ITYA 5F04A 1S29A 3OL4A 1PUFA 2JJ7A 2K02A 5KCMA 4A3FJ 1RUNA 3J7YJ 4XRFA 2BW3A 3BC8A 2DU9A 2V26A 4OU0A 1LB2A 2O03A 3BZKA 3BWGA 5DYMA 1K79A 3U1DA 1FY7A 3G1LA 3V8LA 3C2GA 4XORA 2R3SA 3BDDA 4A12A 2DK5A 3TDUC 2K9NA 2CWEA 2KT0A 1IN8A 3UR3C 3K70D 4L0YB 2R7DA 4PJLA 3I4MJ 2PMUA 4O3MA 4KITB 2LR8A 5C4XJ 5LHIA 4OMZA 1R23A 3E5UA 5IPAA 2ZFUA 3WHCA 3JW4A 1WI9A 2IA2A 4AD9A 2VKDA 2DLLA 3GTJJ 4M3GA 1VQLI 5L3EA 5F1RA 5HOOA 4YIIA 1ZLKA 4RLFA 1ETVA 2W25A 2DBBA 5E8IA 4CICA 1USTA 3D5RC 3VEPA 1LEAA 3TP3A 1H0MA 2L0KA 4A3LJ 2HOSA 3VFZA 2R7TA 3C7JA 1W1WE 3V42A 3GYHX 1ZR4A 2RDPA 3WU2C 4BS9A 1N77A 1LJ9A 2X0LA 1DUXC 1U9NA 3K69A 2DOAA 1WSUA 2VXZA 4XSZF 4EJUA 2VPLA 3KP2A 1TWFJ 2DMTA 4M6VA 1OLTA 3TKYA 4V19K 3K9TA 5C4JJ 5IYDJ 5K7FA 2ZMEB 2XF5A 3RQIA 4II2A 1IRZA 2FF4A 2HWVA 3BG9A 1WH7A 2VJ5A 4JK1X 2F4IA 3WG7H 3ZOBA 3WTWC 4P9FA 2Y48A 3I4PA 3ZMDA 2JVGA 3DEEA 3JCUC 4XKCA 4JBAA 4DQ2A 1MDMB 3OIOA 1JT6A 3RCOA 4DYRA 4R1HA 4Y4RA 4CZCA 3SEZA 2DQRA 4PDKA 5FRNA 2M30A 2KIFA 1MIJA 3S32A 1ODDA 3DF8A 2KIMA 1Z1DA 3OY9A 3V8KA 1YLFA 2QLZA 2B7EA 1VQOI 4CO8A 1T0FA 4A0ZA 1E3OC 1RNLA 1Z9CA 1SVLA 5FGMA 3WE3A 2HXOA 3HRMA 3U21A 5F1JA 5M5YJ 1SFUA 2Z9OA 3IL2A 2NVUB 3ABKH 3BR2A 3DBRB 1B72A 3C2BA 5EEGA 3MWMA 2DT5A 3HOUJ 3GW2A 2W24A 3QAHA 3KP5A 1BOBA 2EK5A 2IW5A 4OIPF 1FT9A 1VQPI 2RC4A 4B09A 3LSMA 3LSKA 2VUMJ 3GFIA 2KJBA 1HA8A 4S05A 4BY7J 1B8IB 4KJZA 3HG9A 1MMSA 2LKPA 2BZTA 2PBIA 2R5YA 3DLAA 3S93A 1O3RA 3LA3A 2R0QC 3O8HA 2K9SA 2VL8A 2EFNA 1OR7C 5ERIA 5EGOA 2M8EA 4F92B 1WZ2A 4L5IA 2EV6A 3ZR8X 5KHDA 1X2NA 2ZMEC 2VB6A 1X3ZB 4HLXA 1XGMA 2EIJH 2KLOA 4AIHA 5F64A 1IRGA 2KZVA 2COMA 2Y0SN 3PIPF 4F52A 1V55H 3OYDA 2OJED 1K78A 1EF4A 3QOEA 1BC7C 3CCMI 2P5KA 4NDLA 2M7AA 4B4CA 3AL0B 2IP2A 2AXLA 5IT9Z 3RIRA 1HLVA 2O9LA 4K2EA 3CC7I 4KN4X 5K7HA 4P5OA 3COAC 1BN5A 2MBFA 3CESA 2Z2SB 2K7LA 5ICFA 2V79A 1EH8A 2NOGA 4MO7A 3CCLI 2O3FA 2GXAA 4CGZA 1WFXA 2I5UA 5KAFC 2VC1A 1YOVB 1MMAA 3B73A 1R58A 3TO9A 3OYFA 4BE0A 1HSJA 2W82A 5E79C 4EEFG 3G73A 1XD7A 4HF1A 4OMYA 2R7UA 5C44J 1JKOC 2OTLI 2FNPA 5DDGA 2E36A 5DUKA 4N9HA 1HKTA 1GHCA 5CKTA 4YIFA 2DMPA 2M7BA 2O8XA 4XMYA 3F8BA 1IRFA 3RTRA 5C3EJ 4EGZA 5F08A 2X1DA 1R00A 2E5ZA 2LP0A 2PQ8A 4AUXA 1HCRA 4IEJA 1JHHA 3FX3A 5J1YA 4XLHA 1E3PA 2GOXB 3ESWB 1L3LA 1HKSA 3OR1C 3LNQA 2P6TA 4OIQF 1W4MA 3JSPA 3ZP5A 1IN4A 4D5FA 1D0YA 4M9ZA 3K4JA 1SMYF 4RB1A 4EGYA 6PAXA 3BCAA 4B3XA 4YFXF 1KZHA 2IGKA 4Y15A 4P9UA 4KUMA 4Z2YA 2LF7A 4OIOF 2WB1N 1GVJA 3ISPA 1XG1A 2YX4A 2Z33A 1BL0A 1J5YA 1E0EA 1UHMA 3OYBA 1DU6A 1FJLA 1JTYA 2WY7Q 1MBHA 4GCVA 1T0FC 3CF2A 5B3SH 1OKRA 3RSNA 2XC7A 2FOKA 3C3WA 3BR1A 2UXNA 3R61A 1K7AA 3V7SA 2KZGA 1IV6A 1IO2A 3QYBA 2KDOA 2ID3A 3ABLH 5EF6A 2HOEA 1G6NA 2Q2EB 2D5VA 3S16J 3O6BB 3HTUA 3W3CA 2M8GX 2HS5A 3IH3A 4Y3OA 1IJWC 3GZ5A 1H9TA 1FIAA 5AIPA 1RC9A 4LFUA 5EZHA 1MJAA 2XROA 4N9IA 4R8HA 4A3EJ 3DU6A 3VB2A 1W0TA 1OCZH 1ZRCA 4IOCF 1JI8A 2A69F 2BY0A 3F6OA 4D9JA 2Y69H 4IQ4A 1ON2A 2ESNA 2DDAA 4MFDA 4P55A 3RPQA 2DAOA 4ZTJA 2OCCH 3AL0C 4I76A 3G1MA 2EB7A 3HB9A 1PUFB 4C30A 3GBGA 2VASA 1YX5A 3TDZC 2V1XA 1UCRA 4YFKF 1XCVA 1JGGA 3WTYC 1SEUA 1EA3A 1XN7A 4I7HA 1FYMA 4DZPA 4RB3C 2EV5A 4BEHB 1D5YA 2UXXA 2XKPA 3W6KB 2W57A 5LFAA 1ON1A 5GAGJ 1KU9A 5ILVA 3E0JB 3GEZA 2E35A 2HVQA 4LLNA 2G9WA 1LE8A 3H5AA 3I9V2 3ZQGA 1JE8A 3PNYA 4IQJA 1RIOH 1LPQA 1V3FA 2XPUA 1R5HA 2R7QA 1FX7A 5JLWA 3CDHA 3GVAA 4E70A 2P81A 1XSDA 1XMAA 1WJAA 1X1BA 3B6CA 1MZBA 2DT6A 2JVHA 4IO9F 2V9KA 5ILUA 4XBFA 4HF2A 3CP8A 2Y0SA 2YSRA 5K7ZA 2LRDA 2F6CA 5FKMA 5DM6F 1XTAA 4M71A 2AQEA 5IYBJ 4HNTA 4E7KA 1UHSA 1D0XA 1ZGWA 2IS6A 2K40A 2LF8A 4B43A 3L2QA 3HOSA 4HAMA 1DU0A 3I55I 3Q0UA 3T0YA 3SZGA 2PJRB 1YX3A 1I3AA 4JX6A 4ENMA 2HDWA 5LEKA 2EFOA 1ZRDA 2CGPA 2VBWA 4OIRF 4RB0A 3BPVA 4GGGA 2L7KA 4L0ZB 1FP1D 2OAZA 1PJRA 4ESFA 4BBRJ 4CHUA 3M1EA 1DP3A 1XDUA 3BR6A 4AIDA 1FLIA 2OQGA 1VFCA 2RKHA 2UZKA 1ZYRF 3BJOA 3JSOA 4BE2A 3HOZJ 1RETA 2XAJA 2ME0A 3PO3J 1Z6TA 2FA5A 2QF7A 1XGSA 2DMNA 2MLGA 1OYIA 3E6BA 4FQGA 5BMZA 1K61A 3P7NA 2QA4I 3BG6A 3CC2I 2R7XA 3EPZA 1JUSA 3PNVA 2Y75A 1K78B 4WXHA 4XRSG 1X2MA 1JKQC 1YYVA 2BVMA 2VJJA 1WH5A 1Z0XA 1U5TC 1WJDA 1YS7A 3KLNA 5EG0B 1F5TA 1J2XA 4XLCA 2B63J 1P4AA 4LB5A 3CUQA 3E3VA 2M1BA 2GBYA 1LDDA 4MNUA 3FKJA 4JQFA 4ENJA 4IHYA 4PZJA 3GFMA 2MD5A 3P9IA 5B66C 1O3TA 3GZ6A 2UWMA 1U5TB 1T39A 5DCMA 1WCMJ 2CV0A 4E4HA 4Y7NJ 3QOPA 3MN2A 1TW3A 1NG7A 4N4NB 5CVUA 3EQLF 2ACJA 2K9QA 5K5OA 2HOTA 4ZDLA 3ZMVA 1ZG3A 1POGA 1X58A 3KEOA 3J7ZI 1Z7UA 4ZDOA 2BBYA 2FX0A 1TW2A 2CQQA 3ASOH 2XVCA 4M9XA 2VKHA 4HX7A 5GTHC 2QSGX 1W5CC 5EEHA 5JVTA 4FE7A 3F21A 2GM4A 2YU3A 4BXXJ 5B5EC 4G7OF 1U0JA 3BY6A 1O3SA 1YW7A 4KMUX 1NHAA 3ECOA 4EATA 1OQYA 1JUPA 1AA7A 3ERMA 4UUVA 3MD2A 2NNYA 5HVQC 3V7RA 2K9MA 3ABMH 4FASD 5K5RA 1RR7A 4UNOA 1FBQA 1D1AA 3KEQA 3FIWA 2DPUA 4V2FA 1V4RA 1FTTA 1BI0A 2GAUA 4NNJA 3S2DJ 3IRQA 4G7HF 2CQNA 1FP2A 1UAAA 2H8RA 2CW7A 3Q5FA 1MGTA 2VT3A 1N75A 2BVLA 2Y2ZA 3S1RJ 1BR2A 5DS9A 4E7IA 4UUTA 4PUSA 2GWRA 3O8GA 4BUPA 2UV1A 3OWTA 4O5VA 5K5QA 3HXLA 4HEA2 4ZYDA 4RGUA 5K1YA 2X6WA 4I98B 3DPUA 1S9HA 5HLTA 4ON0A 3PSIA 1WQ2A 4PSWA 2MFZA 3HUGA 2M34A 3G1OA 4J00A 3EDPA 1WVRA 2P7VB 3EUAA 3WTXC 2K9LA 1ENHA 1W7PD 2BY1A 3OIQA 1WWXA 3J80K 3QYEA 5J8CA 2CFXA 5J40A 4IHWA 5DEQA 2VPRA 3OYEA 1BIBA 1R5GA 3BTIA 2DDBA 1FIPA 2KHMA 3K6GA 3AFHA 5E1WA 1S7OA 1UG2A 2KIUA 3PQKA 3QODA 4LMYA 2B9SA 3CDLA 2XUBA 5J6XA 2R7VA 5IT3A 2BYVE 2OPTA 3BQYA 5FO5A 3NWSA 3DPTA 1XDSA 2XHKA 3MKYB 3V7CA 2P8TA 3A1YA 2OU2A 3BLYA 1QHGA 3BG7A 3HPGA 1GUUA 2LG4A 3HHHA 2QQAA 3FM3A 2FOWA 1LE8B 2CW0F 1OCPA 5FKLA 1V5GA 3K2ZA 4IXAA 4H0EA 4UXNA 4XICA 2GLOA 4ESJA 3F9KA 4RMNA 1UMQA 1SC7A 2IJLA 2RV8A 1VQ6I 2M87A 4HA8A 4C9YA 2D2WA 5B1AH 4RS8A 2VJ4A 1B9MA 5E18F 2F5FA 3DEWA 1FMWA 1HOMA
chains in the Genus database with same CATH topology
4HDVA 3M8EA 2FBIA 1WRJA 3F8NA 3J81Z 2CO5A 2IT0A 3FXUA 4IHTA 3BJ6A 3DP7A 3MZHA 2JT1A 2JPBA 5LBQA 2KJCA 2E7WA 4U0WA 5HLIA 1SMTA 2D1HA 5JFRA 2J5OA 5LEJA 2XIGA 1R1UA 3W6JB 1O3QA 1FC3A 3DEUA 3MEXA 1D5VA 3VOEA 1LVAA 4RGXA 1ULYA 4AVPA 3CUQB 4ZZLA 2LSOA 2VT2A 5BQTA 1J7KA 3CO7C 4HZFA 1IXRC 1ZGJA 3RYRA 4HV6A 1Q1HA 1XB4A 4O6JA 3LAPA 4Q5SF 2HR3A 4KNYA 2MLKA 4G6QA 3GFLA 1G4DA 3WODF 1ZRFA 1SFEA 4QWQA 2Z99A 4L18B 2PFBA 1AOYA 1ONVA 2Q8KA 1T98A 2RQPA 2FEZA 2XV4S 2PI0A 2FE3A 4IRGA 4G94A 5D6FA 4LK1F 2P6SA 2L3DA 3WGIA 3FHZA 3H3ZA 3TO6A 4HX8A 4MGRA 3Q9VA 1TQMA 4KICA 3KP6A 2C6YA 5E8GA 3MCZA 1U5TA 3BOQA 4U7BA 1KYWA 4XLPF 1IXSB 1LQ1A 2PMHA 4PGHA 1KGSA 5HS7A 5JI6A 3GFJA 1R22A 2H6BA 3QPHA 5ILSA 4G8XA 3IWFA 4GYIA 2NYXA 2ETHA 1RUOA 2J5PA 4MTDA 5IT9K 3RKXA 3R0AA 2FU4A 3NRVA 3SZTA 1RI7A 5TJJA 2O61A 1KQ8A 5D5VB 3ZN1A 1P4WA 1F1ZA 3REOA 5D4SA 2VE9A 2BV6A 4U7DA 3RDIA 2EV0A 4A0XA 2TDXA 2GZWA 1SAXA 5LRRA 2KRFA 4KFCA 3PQJA 5L3BA 3SXYA 2FBKA 1FWZA 1USSA 3FXQA 1QQIA 3HOTA 1FSHA 4Y13A 1W7PA 5L3GA 4ASNA 5D8LB 3EUHA 3P9KA 4HF0A 1O7LA 3HRUA 4HQEA 1IN7A 3CUQC 1W5TA 4BXUA 2BEOA 3ZPLA 2D1VA 1HQCA 2XAFA 3HIFA 1R36A 2IA1A 1AWCA 5FD5A 3LSTA 3E5XA 4M74A 2P5LC 1KU7A 2ZNYA 2XKOA 1LDJA 1EH6A 3Q9SA 3CO6C 3ZQ7A 3CLOA 4WXDA 2P4WA 4MTEA 1TQIA 2QQ9A 1OYYA 3JAMZ 3ZN0A 4WXCA 2JPCA 4IJAA 4ZH4F 1VTNC 3L2CA 3KCCA 5LGTA 4U88A 2H6CA 2VC0A 2HTJA 1BIAA 2NRAC 2ZKZA 3I54A 4UHTA 1GXPA 3L00A 4KIGA 4M6YA 2ISZA 2JZYA 4Q4ZF 1ZGAA 2WV0A 1DDNA 3R0JA 1G3TA 3EYIA 1T2KA 3TQNA 1B1BA 1TTYA 3KFWX 1DP7P 4A6DA 1LDKB 1ZARA 3FWEA 1FBUA 2ZO4A 1JXSA 1XGNA 1P4XA 4ETSA 2FMYA 3WTSC 3LWFA 4Q47A 1MD0A 2ADUA 4LGWA 2V1DA 2F5CA 2R7FA 3PFIA 2DTRA 3GXOA 4M6XA 4HLYA 4LD5A 2DQLA 5KVRA 2OD5A 2E7XA 1F4KA 3QP6A 2QENA 5DCMB 4AIJA 3HRTA 5F6FA 4QLCU 3J81K 1HXDA 5DUIA 2EWNA 1G3YA 3T5XA 5CVRA 1K6OA 2VODA 1ZG5A 4L9JA 2STTA 2HYFA 3ULQB 2K86A 1LNWA 3HRSA 3BJAA 1Z6RA 4ZYHA 4HYEA 4L9VA 1BI2A 4IPAA 5LGNA 1PP7U 2HFHA 2ZXJA 4D0PA 2VBZA 3WGHA 4MEXF 2K4JA 2XAHA 2HKXA 5BS6A 1U6GA 1I5ZA 2OQRA 3U9GA 3FM5A 2DK8A 3N97A 5KK1A 3BZ6A 3DFGA 4IVNA 5FLXK 2P7CB 5E1ZB 3GUDA 5L3FA 4KT5C 2Q0OA 4PCQA 3K0LA 3GX4X 4FX0A 1YO5C 1L0OC 1YG2A 4G7ZF 4RGRA 3T1BA 2VBXA 4EMSA 1D8KA 3ZMTA 2MH2A 4R79A 2X4HA 1TLHB 3ABTA 1QPMA 3U2RA 4ZZDA 1UFMA 1TNSA 4YG2F 1U8RA 3FZVA 5CVJA 4KN7X 4KA4A 4I0AA 2OZUA 4KDPA 3GWZA 2CG4A 5FFZA 1S6LA 1PP8F 3I71A 1G3SA 3NEUA 2ZMEA 3M7GA 2XGXA 3RKWA 2EFWA 2GXGA 3CUOA 4F7ZA 4U0YA 2NAZA 2VN2A 3ML6A 2YPRA 2E1NA 3LA7A 4CDGA 2L01A 3BPXA 4G6DA 4A5MA 4BH9A 4GXOA 2ISYA 1EH7A 4UVCA 4B8XA 3B02A 2PEXA 3SFZA 2HTSA 2H09A 3JTHA 2A61A 1HW2A 3E97A 2G7HA 4CXFA 1TNTA 3BP8A 3V8JA 2Q2EA 3HTSB 1YFHA 3F8FA 2QWWA 1D8JA 3I5UA 5HDKA 1R1VA 2DI3A 3DKWA 2HYGD 1YTYA 4Q48A 3ECHA 1CF7A 4HOBA 2XASA 2ZBKA 5LRSA 1OMIA 3O2PE 2QBYA 4A6EA 2GA2A 1T6SA 4LG0A 3C18A 3WTZA 1IN5A 2Y0MA 5TRDA 3RJPA 4KIFA 1ZLJA 1KYZA 1XSXA 3L7WA 1Y0UA 2ZFWA 3WE2A 3I58A 1DPRA 3E6CC 2LNBA 3RI4A 1MKMA 4I09A 5JHUA 2QVOA 3KZZA 1S8NA 4UVBA 1SD6A 1HW1A 1T38A 2EFPA 3ZMUA 4EJOA 3IRRA 3O3KA 1UB9A 4WK8F 3CJNA 3QPTA 4AIKA 4EQQA 2HGCA 1OYWA 2MC3A 1SD7A 1E17A 4LB6B 2A6HF 3KZYA 2HQRA 3LFKA 2YX7A 1FBSA 1ZREA 1JHFA 1IZ1A 3KP4A 5HLHA 5HDGA 3WG9A 4RAYA 5AONA 5ICGA 1R1TA 3K1PA 5D5WB 1P6RA 1ZN2A 3RYPA 5FD6A 3NQOA 2NS0A 3IC7A 1C0WA 4WX9A 1J0RA 2H94A 3HSEA 3MQ0A 5HS8A 5E20A 5ICEA 5CJ9A 3I64A 3OV8A 1KQ9A 3GF2A 1R7JA 4ESBA 1FSEA 3DQVC 2OZ6A 4WF2A 1QZZA 4HW0A 2O0YA 3H92A 2XAGA 4A0YA 1SD4A 2EFQA 3SHFA 5JR3A 1TBXA 5BOXA 2W85A 1XMKA 4CYDA 2L02A 3EETA 2WTEA 5A2QZ 4IHSA 3F3XA 2XAQA 5J8FA 1DPUA 1F9NA 2HQNA 3F8CA 4N0BA 3KP3A 3LA2A 4EV0A 4BHCA 2M45A 3FMSA 3F6VA 4RGSA 2Z3YA 2OA4A 3TOBA 2JTVA 2VBYA 5D5UB 3WGGA 4LK0F 3FF5A 3I59B 3ELKA 2IPQX 4L5JA 3TO7A 1Z05A 3LQQA 2K4BA 3KLOA 3TGNA 2HEOA 3ZMSA 5D8KB 2GQQA 3FXRA 1ZAOA 5CVIA 3F8MA 4CZZA 4BHBA 2XRNA 1BBYA 2D45A 2EA4A 3WU1B 4EM0B 5FLXZ 1WKMA 1O7FA 5D5XB 5HS9A 3M8FA 1XSVA 1UHWA 4DNCA 2YR2A 1FNNA 4HQMA 2F5DA 3OOPA 1B6AA 1J9IA 2A68F 2M5WA 1CF7B 1QNTA 2FRHA 5E1XA 2WC2A 2ZNZA 2CSOA 1IXCA 4OOIA 1EV7A 2QBYB 1P92A 2RGVA 3R60A 3RPUA 3ERED 2FXAA 4NHJA 2MH9A 2DPDA 2LDUA 1B9NA 2IRFG 4LG0B 5ED4A 2KKOA 2VOOA 2FSWA 1Z91A 2K27A 1H9GA 1KU3A 4KYWA 3F23A 5LHGA 3IKVA 4LLLA 3GO5A 1HKQA 1MJ9A 4S04A 4ENKA 1REPC 4KIBA 3LAJA 2ZJ2A 2Z5UA 5CLSA 2QYOA 3F22A 2BE5F 2G7UA 2P5VA 3WTUC 4U0VA 3L09A 1BC8C 1G3WA 2OBPA 1BM9A 1KA8A 1W5SA 1YW9A 2VONA 5H6RA 3C1DA 1FPQA 3WTTC 2F5EA 2DW4A 3P9CA 5DD4A 1SFXA 3HSFA 2JRTA 4PGGA 3V4GA 4M73A 4HX4A 4G9YA 1KU2A 1FZPB 3TOAA 5LHHA 4HV5A 2A6EF 1RZ4A 4NQWA 2GXBA 4EM2A 1BJAA 5AIQA 5L3CA 2IA0A 1ZHFA 5FFXA 1B59A 3ZMZA 5LLQA 3KE2A 4I0BA 2ZCWA 4BQAA 4RB2C 2QZ8A 2V6CA 3EYYA 3T8RA 4Y17A 1SD5A 2E1CA 1QZYA 5BPDA 3E6DA 3WTVC 3F72A 4EVIA 4EJTA 2PG4A 2V9VA 4XSXF 1YW8A 1IUYA 5DCFA 1QBJA 3QRFF 3IHUA 3IWZA 5DD8A 2EJRA 4MEYF 2W84A 1IN6A 2MA3A 2PN6A 3QP5A 4HDUA 4HBLA 2DFIA 4IRIA 4WCGA 3MZYA 5A2QK 5HDNA 4A2UA 2B0LA 4ZYGA 4ENNA 1FYKA 4YFNF 3I0TA 4A5NA 1LEBA 1A04A 2CQKA 2PJPA 4BYYA 5LGUA 5ICCA 3JTGA 4M9SA 4NB5A 3I59A 3IKTA 3J7AO 3T8TA 3L9FA 3LQRA 1W7PB 1CGPA 4EJWA 3R6SA 3QU3A 3AAFA 1QO0D 1XGOA 1FYLA 2FQ3A 1BOAA 2HKOA 1KQ0A 2QM3A 4EM1A 2V1UA 2RN7A 1U78A 5H20A 1YQAA 1IAWA 3KP7A 1JGSA 3MAJA 5FB2A 4WWCA 2IVMA 5E17F 2FMLA 5H6QA 4GO1A 5CYVA 2FBHA 4MQ9F 3DXJF 4XLNF 1J75A 4M72A 1QGPA 3BROA 3HYIA 4L9TA 2EA2A 1MDMA 1YIOA 3S2WA 4AWXB 1BI1A 1B4AA 1HSTA 1PDNC 2NNNA 2L54A 1X3UA 1OPCA 1STZA 2VE8A 3D5LA 5D6EA 2WWYA 2QUFA 1OR7A 5BPIA 4LJZF 2H27A 2PLYA 1I6XA 3J80Z 1TQPA 4TV7A 2HDCA 1I1SA 5CVVA 1BI3A 2GA1A 4UV8A 2DO7A 4LLGF 1U3EM 4ZYEA 4FT8A 2FNAA 4OINF 3ROUA 3FMRA 3H3UA 3ABUA 3E5QA 5L3DA 3HSRA 2ELHA 4RAZA 4L9NA 2A3SA 3RKYA 3SQNA 4GYGA 1I1GA 3HHGA 4MQVA 1E2XA 2JSCA 5D4RA 1HBXG 4BAYA 2HZTA 4P96A 3K1NA 3DV8A 3VODA 3FMQA 4BHPA 2O6GE 2ESHA 1I27A 1PUEE 1ZH5A 4MHGA 3GLXA 3K1MA 2F2EA 1D3YA 2RNJA 5DV5A 4UVAA 2L4MA 4BNCA 2A07F 4KMFA 2AS5F 3JAMK 4IRHA 1S7AA 3E6MA 3I53A 2VOPA 1HW5A 1YS6A 1XCBA 3DPLC 3MFKA 3M9AA 1GXQA 1J59A 4UV9A 3R4KA 2RVCA 1ZG1A 1P2FA 3G3ZA 4I01A 2QQBA 4EJVA 2STWA 1IW7F 3SZPA 4I2OA 1S3JA 3D0SA 2L4AA 4FX4A 3QU6A 4IF4A 5HLGA 1O57A 4FHTA 2GIVA 1FOKA 4I02A 3CTAA 2BGCA 1U2WA 2CYYA 3WU0A 1IF1A 3N4MA 1MJBA 2A5YB 3KETA 1S29A 2K02A 1RUNA 4XRFA 2DU9A 4OU0A 1LB2A 2O03A 3BWGA 5DYMA 1K79A 3U1DA 1FY7A 3V8LA 2R3SA 3BDDA 4A12A 2DK5A 3TDUC 2CWEA 1IN8A 4L0YB 2R7DA 2PMUA 4O3MA 5LHIA 4OMZA 1R23A 3E5UA 3JW4A 1WI9A 2IA2A 4AD9A 2DLLA 5L3EA 5F1RA 5HOOA 4YIIA 1ZLKA 2W25A 2DBBA 5E8IA 4CICA 1USTA 3VEPA 1LEAA 1H0MA 3VFZA 3C7JA 3GYHX 2RDPA 1LJ9A 2X0LA 1DUXC 3K69A 1WSUA 2VXZA 4XSZF 4EJUA 3KP2A 3TKYA 3K9TA 2ZMEB 2FF4A 2HWVA 4JK1X 3WTWC 4P9FA 2Y48A 3I4PA 3ZMDA 1MDMB 4JBAA 4DQ2A 4R1HA 2DQRA 4PDKA 2M30A 2KIFA 1ODDA 3DF8A 2KIMA 1Z1DA 3V8KA 1YLFA 2QLZA 4CO8A 1T0FA 4A0ZA 1RNLA 1Z9CA 5FGMA 3WE3A 3HRMA 1SFUA 2Z9OA 3IL2A 5EEGA 3MWMA 2DT5A 3GW2A 2W24A 3QAHA 3KP5A 2EK5A 2IW5A 4OIPF 1FT9A 2RC4A 4B09A 3GFIA 2KJBA 4S05A 2LKPA 2PBIA 1O3RA 3LA3A 2EFNA 5ERIA 2M8EA 4L5IA 2EV6A 4HLXA 1XGMA 4AIHA 5F64A 1IRGA 2COMA 1K78A 1BC7C 2P5KA 2IP2A 2AXLA 5IT9Z 3RIRA 4K2EA 4KN4X 4P5OA 3COAC 1BN5A 2MBFA 2K7LA 5ICFA 2V79A 1EH8A 2O3FA 4CGZA 2VC1A 3B73A 1R58A 3TO9A 1HSJA 4HF1A 3G73A 1XD7A 4OMYA 2FNPA 5DDGA 5DUKA 4N9HA 1HKTA 1GHCA 4YIFA 2O8XA 3F8BA 1IRFA 3RTRA 4EGZA 1R00A 2PQ8A 1JHHA 3FX3A 1L3LA 1HKSA 2P6TA 4OIQF 1W4MA 3JSPA 3ZP5A 1IN4A 4M9ZA 6PAXA 1SMYF 4RB1A 4EGYA 4YFXF 4Y15A 4P9UA 4KUMA 4Z2YA 2LF7A 4OIOF 1GVJA 3ISPA 2YX4A 2Z33A 1J5YA 1UHMA 4GCVA 1OKRA 2FOKA 3C3WA 2UXNA 3R61A 1K7AA 3V7SA 2HOEA 1G6NA 3O6BB 3HTUA 2HS5A 3GZ5A 1H9TA 5AIPA 4LFUA 2XROA 1MJAA 4N9IA 4R8HA 3VB2A 1ZRCA 2A69F 3F6OA 1ON2A 2ESNA 4P55A 3RPQA 2DAOA 2EB7A 3TDZC 2V1XA 1UCRA 4YFKF 1XCVA 3WTYC 1XN7A 4I7HA 1FYMA 4RB3C 2EV5A 2UXXA 2XKPA 3W6KB 2W57A 1ON1A 1KU9A 5ILVA 3GEZA 4LLNA 2G9WA 1JE8A 1RIOH 1V3FA 1R5HA 1FX7A 3CDHA 3GVAA 4E70A 1XSDA 1XMAA 1MZBA 5ILUA 4XBFA 4HF2A 2YSRA 4M71A 2LF8A 3HOSA 4HAMA 3T0YA 4ENMA 5LEKA 2EFOA 1ZRDA 2CGPA 2VBWA 4OIRF 4RB0A 3BPVA 4GGGA 4L0ZB 1FP1D 2OAZA 4ESFA 4CHUA 3M1EA 1XDUA 1FLIA 2OQGA 2RKHA 2UZKA 1ZYRF 3BJOA 3JSOA 2XAJA 1Z6TA 2FA5A 1XGSA 2MLGA 5BMZA 1OYIA 3E6BA 3P7NA 2Y75A 1K78B 4WXHA 1YYVA 1U5TC 3KLNA 1YS7A 1F5TA 1J2XA 1P4AA 4LB5A 3CUQA 3E3VA 2M1BA 1LDDA 4MNUA 4JQFA 4ENJA 4PZJA 3GFMA 2MD5A 3P9IA 1O3TA 3GZ6A 2UWMA 1U5TB 1T39A 5DCMA 3QOPA 1TW3A 5CVUA 3EQLF 2ACJA 5K5OA 3ZMVA 1ZG3A 3KEOA 1Z7UA 2BBYA 1TW2A 2XVCA 4M9XA 4HX7A 5EEHA 5JVTA 3F21A 2YU3A 4G7OF 3BY6A 1O3SA 1YW7A 4KMUX 1NHAA 3ECOA 4UUVA 2NNYA 5HVQC 3V7RA 5K5RA 4UNOA 1FBQA 3KEQA 2DPUA 1V4RA 1BI0A 2GAUA 3IRQA 4G7HF 1FP2A 3Q5FA 1MGTA 2VT3A 2GWRA 4O5VA 5K5QA 4ZYDA 4RGUA 5K1YA 4I98B 4ON0A 1WQ2A 3HUGA 3EDPA 2P7VB 3WTXC 1W7PD 1WWXA 3J80K 5J8CA 2CFXA 5DEQA 1BIBA 1R5GA 5E1WA 1S7OA 2KIUA 3PQKA 4LMYA 2XUBA 5J6XA 5IT3A 2BYVE 5FO5A 1XDSA 2XHKA 3DPTA 3V7CA 2P8TA 2OU2A 3HHHA 2QQAA 3FM3A 2CW0F 3K2ZA 4IXAA 4H0EA 4UXNA 4ESJA 2IJLA 2RV8A 2M87A 4HA8A 2D2WA 4RS8A 1B9MA 5E18F 2F5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HDV A;  3M8E A;  2FBI A;  1WRJ A;  3F8N A;  3J81 Z;  2CO5 A;  2IT0 A;  3FXU A;  4IHT A;  3BJ6 A;  3DP7 A;  3MZH A;  2JT1 A;  2JPB A;  5LBQ A;  2KJC A;  2E7W A;  4U0W A;  5HLI A;  1SMT A;  2D1H A;  5JFR A;  2J5O A;  5LEJ A;  2XIG A;  1R1U A;  3W6J B;  1O3Q A;  1FC3 A;  3DEU A;  3MEX A;  1D5V A;  3VOE A;  1LVA A;  4RGX A;  1ULY A;  4AVP A;  3CUQ B;  4ZZL A;  2LSO A;  2VT2 A;  5BQT A;  1J7K A;  3CO7 C;  4HZF A;  1IXR C;  1ZGJ A;  3RYR A;  4HV6 A;  1Q1H A;  1XB4 A;  4O6J A;  3LAP A;  4Q5S F;  2HR3 A;  4KNY A;  2MLK A;  4G6Q A;  3GFL A;  1G4D A;  3WOD F;  1ZRF A;  1SFE A;  4QWQ A;  2Z99 A;  4L18 B;  2PFB A;  1AOY A;  1ONV A;  2Q8K A;  1T98 A;  2RQP A;  2FEZ A;  2XV4 S;  2PI0 A;  2FE3 A;  4IRG A;  4G94 A;  5D6F A;  4LK1 F;  2P6S A;  2L3D A;  3WGI A;  3FHZ A;  3H3Z A;  3TO6 A;  4HX8 A;  4MGR A;  3Q9V A;  1TQM A;  4KIC A;  3KP6 A;  2C6Y A;  5E8G A;  3MCZ A;  1U5T A;  3BOQ A;  4U7B A;  1KYW A;  4XLP F;  1IXS B;  1LQ1 A;  2PMH A;  4PGH A;  1KGS A;  5HS7 A;  5JI6 A;  3GFJ A;  1R22 A;  2H6B A;  3QPH A;  5ILS A;  4G8X A;  3IWF A;  4GYI A;  2NYX A;  2ETH A;  1RUO A;  2J5P A;  4MTD A;  5IT9 K;  3RKX A;  3R0A A;  2FU4 A;  3NRV A;  3SZT A;  1RI7 A;  5TJJ A;  2O61 A;  1KQ8 A;  5D5V B;  3ZN1 A;  1P4W A;  1F1Z A;  3REO A;  5D4S A;  2VE9 A;  2BV6 A;  4U7D A;  3RDI A;  2EV0 A;  4A0X A;  2TDX A;  2GZW A;  1SAX A;  5LRR A;  2KRF A;  4KFC A;  3PQJ A;  5L3B A;  3SXY A;  2FBK A;  1FWZ A;  1USS A;  3FXQ A;  1QQI A;  3HOT A;  1FSH A;  4Y13 A;  1W7P A;  5L3G A;  4ASN A;  5D8L B;  3EUH A;  3P9K A;  4HF0 A;  1O7L A;  3HRU A;  4HQE A;  1IN7 A;  3CUQ C;  1W5T A;  4BXU A;  2BEO A;  3ZPL A;  2D1V A;  1HQC A;  2XAF A;  3HIF A;  1R36 A;  2IA1 A;  1AWC A;  5FD5 A;  3LST A;  3E5X A;  4M74 A;  2P5L C;  1KU7 A;  2ZNY A;  2XKO A;  1LDJ A;  1EH6 A;  3Q9S A;  3CO6 C;  3ZQ7 A;  3CLO A;  4WXD A;  2P4W A;  4MTE A;  1TQI A;  2QQ9 A;  1OYY A;  3JAM Z;  3ZN0 A;  4WXC A;  2JPC A;  4IJA A;  4ZH4 F;  1VTN C;  3L2C A;  3KCC A;  5LGT A;  4U88 A;  2H6C A;  2VC0 A;  2HTJ A;  1BIA A;  2NRA C;  2ZKZ A;  3I54 A;  4UHT A;  1GXP A;  3L00 A;  4KIG A;  4M6Y A;  2ISZ A;  2JZY A;  4Q4Z F;  1ZGA A;  2WV0 A;  1DDN A;  3R0J A;  1G3T A;  3EYI A;  1T2K A;  3TQN A;  1B1B A;  1TTY A;  3KFW X;  1DP7 P;  4A6D A;  1LDK B;  1ZAR A;  3FWE A;  1FBU A;  2ZO4 A;  1JXS A;  1XGN A;  1P4X A;  4ETS A;  2FMY A;  3WTS C;  3LWF A;  4Q47 A;  1MD0 A;  2ADU A;  4LGW A;  2V1D A;  2F5C A;  2R7F A;  3PFI A;  2DTR A;  3GXO A;  4M6X A;  4HLY A;  4LD5 A;  2DQL A;  5KVR A;  2OD5 A;  2E7X A;  1F4K A;  3QP6 A;  2QEN A;  5DCM B;  4AIJ A;  3HRT A;  5F6F A;  4QLC U;  3J81 K;  1HXD A;  5DUI A;  2EWN A;  1G3Y A;  3T5X A;  5CVR A;  1K6O A;  2VOD A;  1ZG5 A;  4L9J A;  2STT A;  2HYF A;  3ULQ B;  2K86 A;  1LNW A;  3HRS A;  3BJA A;  1Z6R A;  4ZYH A;  4HYE A;  4L9V A;  1BI2 A;  4IPA A;  5LGN A;  1PP7 U;  2HFH A;  2ZXJ A;  4D0P A;  2VBZ A;  3WGH A;  4MEX F;  2K4J A;  2XAH A;  2HKX A;  5BS6 A;  1U6G A;  1I5Z A;  2OQR A;  3U9G A;  3FM5 A;  2DK8 A;  3N97 A;  5KK1 A;  3BZ6 A;  3DFG A;  4IVN A;  5FLX K;  2P7C B;  5E1Z B;  3GUD A;  5L3F A;  4KT5 C;  2Q0O A;  4PCQ A;  3K0L A;  3GX4 X;  4FX0 A;  1YO5 C;  1L0O C;  1YG2 A;  4G7Z F;  4RGR A;  3T1B A;  2VBX A;  4EMS A;  1D8K A;  3ZMT A;  2MH2 A;  4R79 A;  2X4H A;  1TLH B;  3ABT A;  1QPM A;  3U2R A;  4ZZD A;  1UFM A;  1TNS A;  4YG2 F;  1U8R A;  3FZV A;  5CVJ A;  4KN7 X;  4KA4 A;  4I0A A;  2OZU A;  4KDP A;  3GWZ A;  2CG4 A;  5FFZ A;  1S6L A;  1PP8 F;  3I71 A;  1G3S A;  3NEU A;  2ZME A;  3M7G A;  2XGX A;  3RKW A;  2EFW A;  2GXG A;  3CUO A;  4F7Z A;  4U0Y A;  2NAZ A;  2VN2 A;  3ML6 A;  2YPR A;  2E1N A;  3LA7 A;  4CDG A;  2L01 A;  3BPX A;  4G6D A;  4A5M A;  4BH9 A;  4GXO A;  2ISY A;  1EH7 A;  4UVC A;  4B8X A;  3B02 A;  2PEX A;  3SFZ A;  2HTS A;  2H09 A;  3JTH A;  2A61 A;  1HW2 A;  3E97 A;  2G7H A;  4CXF A;  1TNT A;  3BP8 A;  3V8J A;  2Q2E A;  3HTS B;  1YFH A;  3F8F A;  2QWW A;  1D8J A;  3I5U A;  5HDK A;  1R1V A;  2DI3 A;  3DKW A;  2HYG D;  1YTY A;  4Q48 A;  3ECH A;  1CF7 A;  4HOB A;  2XAS A;  2ZBK A;  5LRS A;  1OMI A;  3O2P E;  2QBY A;  4A6E A;  2GA2 A;  1T6S A;  4LG0 A;  3C18 A;  3WTZ A;  1IN5 A;  2Y0M A;  5TRD A;  3RJP A;  4KIF A;  1ZLJ A;  1KYZ A;  1XSX A;  3L7W A;  1Y0U A;  2ZFW A;  3WE2 A;  3I58 A;  1DPR A;  3E6C C;  2LNB A;  3RI4 A;  1MKM A;  4I09 A;  5JHU A;  2QVO A;  3KZZ A;  1S8N A;  4UVB A;  1SD6 A;  1HW1 A;  1T38 A;  2EFP A;  3ZMU A;  4EJO A;  3IRR A;  3O3K A;  1UB9 A;  4WK8 F;  3CJN A;  3QPT A;  4AIK A;  4EQQ A;  2HGC A;  1OYW A;  2MC3 A;  1SD7 A;  1E17 A;  4LB6 B;  2A6H F;  3KZY A;  2HQR A;  3LFK A;  2YX7 A;  1FBS A;  1ZRE A;  1JHF A;  1IZ1 A;  3KP4 A;  5HLH A;  5HDG A;  3WG9 A;  4RAY A;  5AON A;  5ICG A;  1R1T A;  3K1P A;  5D5W B;  1P6R A;  1ZN2 A;  3RYP A;  5FD6 A;  3NQO A;  2NS0 A;  3IC7 A;  1C0W A;  4WX9 A;  1J0R A;  2H94 A;  3HSE A;  3MQ0 A;  5HS8 A;  5E20 A;  5ICE A;  5CJ9 A;  3I64 A;  3OV8 A;  1KQ9 A;  3GF2 A;  1R7J A;  4ESB A;  1FSE A;  3DQV C;  2OZ6 A;  4WF2 A;  1QZZ A;  4HW0 A;  2O0Y A;  3H92 A;  2XAG A;  4A0Y A;  1SD4 A;  2EFQ A;  3SHF A;  5JR3 A;  1TBX A;  5BOX A;  2W85 A;  1XMK A;  4CYD A;  2L02 A;  3EET A;  2WTE A;  5A2Q Z;  4IHS A;  3F3X A;  2XAQ A;  5J8F A;  1DPU A;  1F9N A;  2HQN A;  3F8C A;  4N0B A;  3KP3 A;  3LA2 A;  4EV0 A;  4BHC A;  2M45 A;  3FMS A;  3F6V A;  4RGS A;  2Z3Y A;  2OA4 A;  3TOB A;  2JTV A;  2VBY A;  5D5U B;  3WGG A;  4LK0 F;  3FF5 A;  3I59 B;  3ELK A;  2IPQ X;  4L5J A;  3TO7 A;  1Z05 A;  3LQQ A;  2K4B A;  3KLO A;  3TGN A;  2HEO A;  3ZMS A;  5D8K B;  2GQQ A;  3FXR A;  1ZAO A;  5CVI A;  3F8M A;  4CZZ A;  4BHB A;  2XRN A;  1BBY A;  2D45 A;  2EA4 A;  3WU1 B;  4EM0 B;  5FLX Z;  1WKM A;  1O7F A;  5D5X B;  5HS9 A;  3M8F A;  1XSV A;  1UHW A;  4DNC A;  2YR2 A;  1FNN A;  4HQM A;  2F5D A;  3OOP A;  1B6A A;  1J9I A;  2A68 F;  2M5W A;  1CF7 B;  1QNT A;  2FRH A;  5E1X A;  2WC2 A;  2ZNZ A;  2CSO A;  1IXC A;  4OOI A;  1EV7 A;  2QBY B;  1P92 A;  2RGV A;  3R60 A;  3RPU A;  3ERE D;  2FXA A;  4NHJ A;  2MH9 A;  2DPD A;  2LDU A;  1B9N A;  2IRF G;  4LG0 B;  5ED4 A;  2KKO A;  2VOO A;  2FSW A;  1Z91 A;  2K27 A;  1H9G A;  1KU3 A;  4KYW A;  3F23 A;  5LHG A;  3IKV A;  4LLL A;  3GO5 A;  1HKQ A;  1MJ9 A;  4S04 A;  4ENK A;  1REP C;  4KIB A;  3LAJ A;  2ZJ2 A;  2Z5U A;  5CLS A;  2QYO A;  3F22 A;  2BE5 F;  2G7U A;  2P5V A;  3WTU C;  4U0V A;  3L09 A;  1BC8 C;  1G3W A;  2OBP A;  1BM9 A;  1KA8 A;  1W5S A;  1YW9 A;  2VON A;  5H6R A;  3C1D A;  1FPQ A;  3WTT C;  2F5E A;  2DW4 A;  3P9C A;  5DD4 A;  1SFX A;  3HSF A;  2JRT A;  4PGG A;  3V4G A;  4M73 A;  4HX4 A;  4G9Y A;  1KU2 A;  1FZP B;  3TOA A;  5LHH A;  4HV5 A;  2A6E F;  1RZ4 A;  4NQW A;  2GXB A;  4EM2 A;  1BJA A;  5AIQ A;  5L3C A;  2IA0 A;  1ZHF A;  5FFX A;  1B59 A;  3ZMZ A;  5LLQ A;  3KE2 A;  4I0B A;  2ZCW A;  4BQA A;  4RB2 C;  2QZ8 A;  2V6C A;  3EYY A;  3T8R A;  4Y17 A;  1SD5 A;  2E1C A;  1QZY A;  5BPD A;  3E6D A;  3WTV C;  3F72 A;  4EVI A;  4EJT A;  2PG4 A;  2V9V A;  4XSX F;  1YW8 A;  1IUY A;  5DCF A;  1QBJ A;  3QRF F;  3IHU A;  3IWZ A;  5DD8 A;  2EJR A;  4MEY F;  2W84 A;  1IN6 A;  2MA3 A;  2PN6 A;  3QP5 A;  4HDU A;  4HBL A;  2DFI A;  4IRI A;  4WCG A;  3MZY A;  5A2Q K;  5HDN A;  4A2U A;  2B0L A;  4ZYG A;  4ENN A;  1FYK A;  4YFN F;  3I0T A;  4A5N A;  1LEB A;  1A04 A;  2CQK A;  2PJP A;  4BYY A;  5LGU A;  5ICC A;  3JTG A;  4M9S A;  4NB5 A;  3I59 A;  3IKT A;  3J7A O;  3T8T A;  3L9F A;  3LQR A;  1W7P B;  1CGP A;  4EJW A;  3R6S A;  3QU3 A;  3AAF A;  1QO0 D;  1XGO A;  1FYL A;  2FQ3 A;  1BOA A;  2HKO A;  1KQ0 A;  2QM3 A;  4EM1 A;  2V1U A;  2RN7 A;  1U78 A;  5H20 A;  1YQA A;  1IAW A;  3KP7 A;  1JGS A;  3MAJ A;  5FB2 A;  4WWC A;  2IVM A;  5E17 F;  2FML A;  5H6Q A;  4GO1 A;  5CYV A;  2FBH A;  4MQ9 F;  3DXJ F;  4XLN F;  1J75 A;  4M72 A;  1QGP A;  3BRO A;  3HYI A;  4L9T A;  2EA2 A;  1MDM A;  1YIO A;  3S2W A;  4AWX B;  1BI1 A;  1B4A A;  1HST A;  1PDN C;  2NNN A;  2L54 A;  1X3U A;  1OPC A;  1STZ A;  2VE8 A;  3D5L A;  5D6E A;  2WWY A;  2QUF A;  1OR7 A;  5BPI A;  4LJZ F;  2H27 A;  2PLY A;  1I6X A;  3J80 Z;  1TQP A;  4TV7 A;  2HDC A;  1I1S A;  5CVV A;  1BI3 A;  2GA1 A;  4UV8 A;  2DO7 A;  4LLG F;  1U3E M;  4ZYE A;  4FT8 A;  2FNA A;  4OIN F;  3ROU A;  3FMR A;  3H3U A;  3ABU A;  3E5Q A;  5L3D A;  3HSR A;  2ELH A;  4RAZ A;  4L9N A;  2A3S A;  3RKY A;  3SQN A;  4GYG A;  1I1G A;  3HHG A;  4MQV A;  1E2X A;  2JSC A;  5D4R A;  1HBX G;  4BAY A;  2HZT A;  4P96 A;  3K1N A;  3DV8 A;  3VOD A;  3FMQ A;  4BHP A;  2O6G E;  2ESH A;  1I27 A;  1PUE E;  1ZH5 A;  4MHG A;  3GLX A;  3K1M A;  2F2E A;  1D3Y A;  2RNJ A;  5DV5 A;  4UVA A;  2L4M A;  4BNC A;  2A07 F;  4KMF A;  2AS5 F;  3JAM K;  4IRH A;  1S7A A;  3E6M A;  3I53 A;  2VOP A;  1HW5 A;  1YS6 A;  1XCB A;  3DPL C;  3MFK A;  3M9A A;  1GXQ A;  1J59 A;  4UV9 A;  3R4K A;  2RVC A;  1ZG1 A;  1P2F A;  3G3Z A;  4I01 A;  2QQB A;  4EJV A;  2STW A;  1IW7 F;  3SZP A;  4I2O A;  1S3J A;  3D0S A;  2L4A A;  4FX4 A;  3QU6 A;  4IF4 A;  5HLG A;  1O57 A;  4FHT A;  2GIV A;  1FOK A;  4I02 A;  3CTA A;  2BGC A;  1U2W A;  2CYY A;  3WU0 A;  1IF1 A;  3N4M A;  1MJB A;  2A5Y B;  3KET A;  1S29 A;  2K02 A;  1RUN A;  4XRF A;  2DU9 A;  4OU0 A;  1LB2 A;  2O03 A;  3BWG A;  5DYM A;  1K79 A;  3U1D A;  1FY7 A;  3V8L A;  2R3S A;  3BDD A;  4A12 A;  2DK5 A;  3TDU C;  2CWE A;  1IN8 A;  4L0Y B;  2R7D A;  2PMU A;  4O3M A;  5LHI A;  4OMZ A;  1R23 A;  3E5U A;  3JW4 A;  1WI9 A;  2IA2 A;  4AD9 A;  2DLL A;  5L3E A;  5F1R A;  5HOO A;  4YII A;  1ZLK A;  2W25 A;  2DBB A;  5E8I A;  4CIC A;  1UST A;  3VEP A;  1LEA A;  1H0M A;  3VFZ A;  3C7J A;  3GYH X;  2RDP A;  1LJ9 A;  2X0L A;  1DUX C;  3K69 A;  1WSU A;  2VXZ A;  4XSZ F;  4EJU A;  3KP2 A;  3TKY A;  3K9T A;  2ZME B;  2FF4 A;  2HWV A;  4JK1 X;  3WTW C;  4P9F A;  2Y48 A;  3I4P A;  3ZMD A;  1MDM B;  4JBA A;  4DQ2 A;  4R1H A;  2DQR A;  4PDK A;  2M30 A;  2KIF A;  1ODD A;  3DF8 A;  2KIM A;  1Z1D A;  3V8K A;  1YLF A;  2QLZ A;  4CO8 A;  1T0F A;  4A0Z A;  1RNL A;  1Z9C A;  5FGM A;  3WE3 A;  3HRM A;  1SFU A;  2Z9O A;  3IL2 A;  5EEG A;  3MWM A;  2DT5 A;  3GW2 A;  2W24 A;  3QAH A;  3KP5 A;  2EK5 A;  2IW5 A;  4OIP F;  1FT9 A;  2RC4 A;  4B09 A;  3GFI A;  2KJB A;  4S05 A;  2LKP A;  2PBI A;  1O3R A;  3LA3 A;  2EFN A;  5ERI A;  2M8E A;  4L5I A;  2EV6 A;  4HLX A;  1XGM A;  4AIH A;  5F64 A;  1IRG A;  2COM A;  1K78 A;  1BC7 C;  2P5K A;  2IP2 A;  2AXL A;  5IT9 Z;  3RIR A;  4K2E A;  4KN4 X;  4P5O A;  3COA C;  1BN5 A;  2MBF A;  2K7L A;  5ICF A;  2V79 A;  1EH8 A;  2O3F A;  4CGZ A;  2VC1 A;  3B73 A;  1R58 A;  3TO9 A;  1HSJ A;  4HF1 A;  3G73 A;  1XD7 A;  4OMY A;  2FNP A;  5DDG A;  5DUK A;  4N9H A;  1HKT A;  1GHC A;  4YIF A;  2O8X A;  3F8B A;  1IRF A;  3RTR A;  4EGZ A;  1R00 A;  2PQ8 A;  1JHH A;  3FX3 A;  1L3L A;  1HKS A;  2P6T A;  4OIQ F;  1W4M A;  3JSP A;  3ZP5 A;  1IN4 A;  4M9Z A;  6PAX A;  1SMY F;  4RB1 A;  4EGY A;  4YFX F;  4Y15 A;  4P9U A;  4KUM A;  4Z2Y A;  2LF7 A;  4OIO F;  1GVJ A;  3ISP A;  2YX4 A;  2Z33 A;  1J5Y A;  1UHM A;  4GCV A;  1OKR A;  2FOK A;  3C3W A;  2UXN A;  3R61 A;  1K7A A;  3V7S A;  2HOE A;  1G6N A;  3O6B B;  3HTU A;  2HS5 A;  3GZ5 A;  1H9T A;  5AIP A;  4LFU A;  2XRO A;  1MJA A;  4N9I A;  4R8H A;  3VB2 A;  1ZRC A;  2A69 F;  3F6O A;  1ON2 A;  2ESN A;  4P55 A;  3RPQ A;  2DAO A;  2EB7 A;  3TDZ C;  2V1X A;  1UCR A;  4YFK F;  1XCV A;  3WTY C;  1XN7 A;  4I7H A;  1FYM A;  4RB3 C;  2EV5 A;  2UXX A;  2XKP A;  3W6K B;  2W57 A;  1ON1 A;  1KU9 A;  5ILV A;  3GEZ A;  4LLN A;  2G9W A;  1JE8 A;  1RIO H;  1V3F A;  1R5H A;  1FX7 A;  3CDH A;  3GVA A;  4E70 A;  1XSD A;  1XMA A;  1MZB A;  5ILU A;  4XBF A;  4HF2 A;  2YSR A;  4M71 A;  2LF8 A;  3HOS A;  4HAM A;  3T0Y A;  4ENM A;  5LEK A;  2EFO A;  1ZRD A;  2CGP A;  2VBW A;  4OIR F;  4RB0 A;  3BPV A;  4GGG A;  4L0Z B;  1FP1 D;  2OAZ A;  4ESF A;  4CHU A;  3M1E A;  1XDU A;  1FLI A;  2OQG A;  2RKH A;  2UZK A;  1ZYR F;  3BJO A;  3JSO A;  2XAJ A;  1Z6T A;  2FA5 A;  1XGS A;  2MLG A;  5BMZ A;  1OYI A;  3E6B A;  3P7N A;  2Y75 A;  1K78 B;  4WXH A;  1YYV A;  1U5T C;  3KLN A;  1YS7 A;  1F5T A;  1J2X A;  1P4A A;  4LB5 A;  3CUQ A;  3E3V A;  2M1B A;  1LDD A;  4MNU A;  4JQF A;  4ENJ A;  4PZJ A;  3GFM A;  2MD5 A;  3P9I A;  1O3T A;  3GZ6 A;  2UWM A;  1U5T B;  1T39 A;  5DCM A;  3QOP A;  1TW3 A;  5CVU A;  3EQL F;  2ACJ A;  5K5O A;  3ZMV A;  1ZG3 A;  3KEO A;  1Z7U A;  2BBY A;  1TW2 A;  2XVC A;  4M9X A;  4HX7 A;  5EEH A;  5JVT A;  3F21 A;  2YU3 A;  4G7O F;  3BY6 A;  1O3S A;  1YW7 A;  4KMU X;  1NHA A;  3ECO A;  4UUV A;  2NNY A;  5HVQ C;  3V7R A;  5K5R A;  4UNO A;  1FBQ A;  3KEQ A;  2DPU A;  1V4R A;  1BI0 A;  2GAU A;  3IRQ A;  4G7H F;  1FP2 A;  3Q5F A;  1MGT A;  2VT3 A;  2GWR A;  4O5V A;  5K5Q A;  4ZYD A;  4RGU A;  5K1Y A;  4I98 B;  4ON0 A;  1WQ2 A;  3HUG A;  3EDP A;  2P7V B;  3WTX C;  1W7P D;  1WWX A;  3J80 K;  5J8C A;  2CFX A;  5DEQ A;  1BIB A;  1R5G A;  5E1W A;  1S7O A;  2KIU A;  3PQK A;  4LMY A;  2XUB A;  5J6X A;  5IT3 A;  2BYV E;  5FO5 A;  1XDS A;  2XHK A;  3DPT A;  3V7C A;  2P8T A;  2OU2 A;  3HHH A;  2QQA A;  3FM3 A;  2CW0 F;  3K2Z A;  4IXA A;  4H0E A;  4UXN A;  4ESJ A;  2IJL A;  2RV8 A;  2M87 A;  4HA8 A;  2D2W A;  4RS8 A;  1B9M A;  5E18 F;  2F5F A; 
#chains in the Genus database with same CATH topology
 4HDV A;  3M8E A;  2FBI A;  2VQH A;  1WRJ A;  3F8N A;  1IUF A;  4DZJ A;  2F5V A;  2X1C A;  2BHZ A;  1TWG J;  1GT0 C;  3J81 Z;  4RBO A;  2CO5 A;  4F93 B;  2ZJP F;  2IT0 A;  3FXU A;  4IHT A;  4UUS B;  2QQ8 A;  3BJ6 A;  3DP7 A;  3MZH A;  1VZ0 A;  1MSE C;  2JT1 A;  2JPB A;  4S0H B;  5LBQ A;  2KJC A;  1K6Y A;  3LSR A;  2E7W A;  3LMM A;  4U0W A;  2O5R A;  5HLI A;  1SMT A;  2D1H A;  2FJ1 A;  3K4L A;  5TIS C;  5JFR A;  2J5O A;  2IS1 A;  3VSK A;  5LEJ A;  1OIS A;  2XIG A;  1R1U A;  3BTL A;  3LSG A;  3SEQ A;  3W6J B;  3ZRG A;  1O3Q A;  4BU2 A;  2KDZ A;  1FC3 A;  2A05 A;  2KL4 A;  3DEU A;  3MEX A;  4BGD A;  3IV5 A;  1R4N B;  1D5V A;  5EG0 A;  3VOE A;  3OSF A;  1LVA A;  2ZC2 A;  4RGX A;  1ULY A;  2BXZ A;  4AVP A;  3CUQ B;  4ZZL A;  2LSO A;  2VT2 A;  4LIT A;  5BQT A;  2DOF A;  2HVR A;  1J7K A;  3I3L A;  3PUF A;  3K4B A;  2AO9 A;  2UUZ A;  1IDZ A;  3CO7 C;  3PO2 J;  5F0C A;  4HZF A;  2E60 A;  1IXR C;  3OYG A;  1ZGJ A;  3RYR A;  4HV6 A;  4MLO A;  1Q1H A;  2PJR A;  1XB4 A;  1G2H A;  1D1C A;  4O6J A;  3DCF A;  3LAP A;  4Q5S F;  2HR3 A;  4RLQ A;  4KNY A;  5FRM A;  1H8A C;  2MLK A;  1X4P A;  2EQR A;  2VIX A;  3H5R A;  4G6Q A;  1SFK A;  4XQF A;  2V1N A;  3GFL A;  1G4D A;  3WOD F;  3X2Q H;  1G8X A;  4N4O B;  4QPO A;  3E7L A;  1SFE A;  2R7O A;  2Z99 A;  4QWQ A;  1ZRF A;  3OYK A;  1MNE A;  4L18 B;  2PFB A;  2F4O B;  5M3M J;  1IG7 A;  1D0Z A;  3OMY A;  1AOY A;  3FHN A;  1MW7 A;  1ONV A;  2L9N A;  4W97 A;  3L2W A;  2Q8K A;  1T98 A;  2RQP A;  4D7N A;  1ZK8 A;  1XPX A;  2FEZ A;  2XV4 S;  2PI0 A;  3DTI A;  2FE3 A;  4IRG A;  3HOW J;  2ELK A;  2DT7 B;  4G94 A;  5D6F A;  1T33 A;  5EZG A;  2HQ5 A;  3PM1 A;  3L2V A;  4LK1 F;  2P6S A;  2L3D A;  4XRS A;  3WGI A;  2E1M C;  3FHZ A;  4BJ6 C;  3H3Z A;  3TO6 A;  4HX8 A;  3DKX A;  2XF6 A;  4MGR A;  3Q9V A;  1NG6 A;  1TQM A;  3KIO A;  3M1C A;  2CUE A;  3CCJ I;  3CCQ I;  3H9G A;  4KIC A;  3TW6 A;  4FIS A;  2L9S A;  3KP6 A;  4CA0 A;  2C6Y A;  5FKO A;  5E8G A;  3TP0 A;  4PJJ A;  1X19 A;  1U5T A;  3MCZ A;  3BOQ A;  3FIS A;  3W2W A;  3A01 B;  4U7B A;  2KP6 A;  1KYW A;  1Y8R B;  5GAE J;  4XLP F;  1IXS B;  1LQ1 A;  2PMH A;  4PGH A;  1FOW A;  1KGS A;  5HS7 A;  2X1E A;  5JI6 A;  3BT9 A;  3GFJ A;  3CMA I;  2IEK A;  1R22 A;  2H6B A;  3ZQC A;  3QPH A;  3JRI A;  1VF9 A;  5ILS A;  4Y52 J;  4G8X A;  3IWF A;  1K4T A;  4GYI A;  3CCS I;  2NYX A;  2ETH A;  4BXF A;  3DU5 A;  3DLL F;  2VI6 A;  2J5P A;  1RUO A;  4MTD A;  3DTE A;  1YJW I;  2H8W A;  5IT9 K;  3EUH C;  1UG0 A;  3OR2 C;  3RKX A;  3R0A A;  4NUB A;  4U87 A;  2FU4 A;  1TC3 C;  3NRV A;  2L5Q A;  3SZT A;  4CCN A;  4BKX A;  1RI7 A;  2V9P A;  3F0C A;  1A5J A;  4LG3 A;  5TJJ A;  4YRV A;  2O61 A;  3IAS 2;  2WAQ N;  1KQ8 A;  1R6R A;  5D5V B;  1MH3 A;  3RQ4 A;  4BQQ A;  2OV7 A;  3ZN1 A;  4BQO A;  1P4W A;  1F1Z A;  2QSF X;  4M3F A;  1Y8Q B;  3REO A;  5D4S A;  2VE9 A;  2BV6 A;  4U7D A;  1YRN B;  3RDI A;  2EV0 A;  4A0X A;  3DBL B;  2TDX A;  2R7R A;  2GZW A;  1SAX A;  1QRY A;  4HST A;  5LRR A;  2KRF A;  2X9D A;  3L2R A;  4KFC A;  4KIS A;  2NXN B;  2E2H J;  3PQJ A;  2LK2 A;  1TWC J;  1ZKG A;  5L3B A;  4CCJ A;  3VDX A;  3KX2 A;  2IGO A;  3SXY A;  2FBK A;  1FWZ A;  1USS A;  3FXQ A;  3Q0V A;  1WJB A;  1QQI A;  3LOC A;  4C3H J;  1JKR C;  3GLL A;  3S8P A;  3HOT A;  4HRI A;  1VQN I;  1FSH A;  4Y13 A;  1WPK A;  2DA1 A;  1W7P A;  5L3G A;  4ASN A;  1FOY A;  4CUG A;  2ZB9 A;  3ZQI A;  3FXM A;  5D8L B;  4D1Q A;  3EUH A;  3OS1 A;  3P9K A;  2VQL A;  1QVT A;  1PVE A;  5GAH J;  4HF0 A;  4ZYA A;  1O7L A;  4E7L A;  3OYA A;  3A0H C;  3HRU A;  4PFP A;  4HQE A;  1IN7 A;  2W1O A;  3CUQ C;  1W5T A;  4BXU A;  3H9J A;  2BEO A;  3ZPL A;  3HL2 A;  2KPM A;  1X4O A;  2DJI A;  1GVD A;  2D1V A;  1HQC A;  2RQQ A;  2XAF A;  3HIF A;  3ZCO A;  1Z3Y A;  1R36 A;  3DTK A;  3QYF A;  2IA1 A;  1AWC A;  5JLX A;  5FD5 A;  3HKZ A;  5IY5 H;  3H0D A;  2HZD A;  3B6A A;  3LST A;  3E5X A;  1TT5 B;  3FDY A;  4M74 A;  2P5L C;  1KU7 A;  2ZNY A;  2MW8 A;  2LKS A;  2XKO A;  1LDJ A;  5GPC A;  3W6V A;  3H0G J;  3PUB A;  1ZQ3 P;  4FCY A;  1NK3 P;  2CJJ A;  1EH6 A;  2F48 A;  3Q9S A;  3J7A Y;  3CO6 C;  1MMG A;  3ZQ7 A;  3SDB A;  3K4N A;  2JA6 J;  1VND A;  2X6X A;  3CLO A;  1OCO H;  2WAE A;  3PSF A;  1VQ4 I;  4M3E A;  4WXD A;  3SDG A;  1RR8 C;  1YJ9 I;  4B48 A;  1G59 A;  2P4W A;  4MTE A;  2CV1 A;  1CQT A;  2BXY A;  1X1C A;  1TQI A;  3A02 A;  5FLM J;  2QQ9 A;  1OYY A;  3S17 J;  3JAM Z;  3ZN0 A;  2DCE A;  3RPU D;  2CS3 A;  4WXC A;  2JPC A;  2L7Z A;  4XKB A;  1IDY A;  4IJA A;  4ZH4 F;  2BHY A;  1VTN C;  3L2C A;  3CME I;  3KCC A;  5LGT A;  1A36 A;  4U88 A;  4LIV A;  2H6C A;  2VC0 A;  3LSI A;  3IUO A;  2HTJ A;  1BIA A;  2NRA C;  2ZKZ A;  3I54 A;  2LTP A;  2PMZ N;  4UHT A;  1GXP A;  3BTJ A;  3L00 A;  4KIG A;  2LH9 A;  4M6Y A;  3CCY A;  2ISZ A;  2JZY A;  4Q4Z F;  4CYC A;  1ZGA A;  2DTZ A;  2WV0 A;  1FEX A;  1DDN A;  3R0J A;  1LFB A;  1G3T A;  4UB8 C;  3EYI A;  2M9H A;  2Y30 A;  1T2K A;  2VKE A;  2E71 A;  2OCE A;  1B1B A;  3TQN A;  1TTY A;  3KFW X;  1DP7 P;  2DN0 A;  4A6D A;  2VQG A;  2CV2 A;  1BW6 A;  1RES A;  2KIS A;  1LDK B;  1ZAR A;  2M0C A;  3GTM J;  3FWE A;  2OUM A;  4DYC A;  1FBU A;  2ZO4 A;  1JXS A;  2KMU A;  4BAC A;  1XGN A;  1OFC X;  3A03 A;  3MKZ A;  1P4X A;  2WAQ A;  5FRO A;  4ETS A;  4I6Z A;  2FMY A;  3WTS C;  3JRF A;  3LWF A;  2NS8 A;  4Q47 A;  1OJL A;  1MD0 A;  2ECB A;  3KZI C;  2ADU A;  4LGW A;  2V1D A;  2F5C A;  2X6O A;  2R7F A;  3M8J A;  3K4K A;  3PFI A;  2DTR A;  3FK7 A;  3GXO A;  4M6X A;  4HLY A;  1UJ8 A;  4A3B J;  1YI2 I;  4LD5 A;  2DQL A;  5KVR A;  3A0B C;  2BW3 B;  4ITV A;  3K4M A;  1Z21 A;  2ECC A;  2LY9 A;  2MD0 A;  2OD5 A;  1JJ6 C;  4HPQ A;  2E7X A;  1F4K A;  3KYC B;  3QP6 A;  2YUS A;  4OAY A;  2P0W A;  1YRN A;  3ZXS A;  2QEN A;  1Y39 A;  3CC4 I;  5DCM B;  4AIJ A;  3HRT A;  5F6F A;  4RM2 A;  2CH0 A;  1S7E A;  3FXL A;  4QLC U;  5F0H A;  3J81 K;  2R5Z B;  4PJM A;  1HXD A;  3JRG A;  2M0M A;  3BR0 A;  2HI3 A;  1TWH J;  5DUI A;  2EWN A;  2Y31 A;  1AU7 A;  4AYB A;  1G3Y A;  1HDD C;  1I6H J;  2CFO A;  3HGY A;  3T5X A;  3AKZ A;  4CCL A;  5CVR A;  5E3N A;  1K6O A;  2VOD A;  1JJ8 C;  1ZG5 A;  5CQE A;  4L9J A;  2STT A;  2HYF A;  3HM5 A;  3ULQ B;  2K86 A;  4ZC3 A;  2XGE A;  3QQA A;  1LNW A;  5IP7 J;  3HRS A;  3VYU B;  3BJA A;  1V5F A;  1Z6R A;  4ZYH A;  4HYE A;  4L9V A;  2VQC A;  1BI2 A;  1APL C;  4IPA A;  2LBF B;  2VJI A;  3TMO A;  5LGN A;  1PP7 U;  2HFH A;  2ZXJ A;  1ETW A;  2LOO A;  4D0P A;  2VBZ A;  4DBQ A;  1UEL B;  3WGH A;  3KYL A;  3G2B A;  3UNG C;  4MEX F;  2K4J A;  2XAH A;  3CJT B;  3Q0W A;  5KAI C;  4CSW A;  4D7M A;  2HKX A;  5BS6 A;  1U6G A;  1I5Z A;  2OQR A;  1J09 A;  1JT0 A;  3U9G A;  3FM5 A;  2DK8 A;  2JSP A;  4E7H A;  2ZSH B;  3N97 A;  5KK1 A;  4PJ0 C;  5DTD A;  3HBL A;  2K3F A;  3N05 A;  2NVX J;  1K4S A;  3BZ6 A;  3DFG A;  4LIU A;  2WA0 A;  4IZZ A;  2Z16 A;  4IVN A;  3MKW B;  5FLX K;  4D5C A;  3K2A A;  4G12 A;  2P7C B;  4ZDP A;  3HUG B;  3GUD A;  3IP4 B;  5E1Z B;  5L3F A;  3GTG J;  3FXK A;  2Q0O A;  4KT5 C;  3C2H A;  1TL8 A;  2K5C A;  4PCQ A;  3K0L A;  3GX4 X;  1HF0 A;  4A93 J;  4ANJ A;  2LKX A;  4FX0 A;  1YO5 C;  4BDY A;  1L0O C;  5F27 A;  4J19 A;  1YG2 A;  3MMY B;  3TW7 A;  3JRE A;  3FBN B;  2G0E A;  1QVU A;  4G7Z F;  4RGR A;  3K10 A;  5HNH A;  1YJN I;  5IP9 J;  4OWR B;  3OOU A;  2L2O A;  3T1B A;  2V6E A;  2VBX A;  9ANT A;  2DYR H;  4XOP A;  1T56 A;  2FD5 A;  1X1P A;  4EMS A;  1D8K A;  1ETX A;  2DXI A;  3ZMT A;  5B1B H;  2MH2 A;  1XMX A;  2IGN A;  3W2A A;  1OCT C;  4R79 A;  5M3F J;  2X4H A;  1TLH B;  3RKQ A;  2X48 A;  3S1N J;  3ABT A;  2I8D A;  1Y1W J;  1QPM A;  3U2R A;  4ZZD A;  1UFM A;  1VQK I;  1TNS A;  2E2J J;  4YG2 F;  1U8R A;  1JKP C;  3OYN A;  3FZV A;  5KNL A;  2NVY J;  2W00 A;  5CVJ A;  4KN7 X;  1SAN A;  4KA4 A;  3FKI J;  5M5X J;  4E7S A;  4I0A A;  2OZU A;  4KDP A;  1R71 A;  3K4C A;  3GWZ A;  2W48 A;  2EZK A;  5HNF A;  4XRM A;  3NAU A;  1RKW A;  1T8I A;  2CG4 A;  5FFZ A;  1S6L A;  2PMZ A;  2CMP A;  1PP8 F;  3CJQ B;  4G6T B;  4KT6 A;  3I71 A;  4XLA A;  2IS4 A;  4UB6 C;  1G3S A;  3NEU A;  3ZQH A;  2ZME A;  3M7G A;  2XGX A;  3RKW A;  1JUM A;  2EFW A;  3MKL A;  2O7O A;  2AQF A;  2GXG A;  1Y0N A;  2JQ7 A;  3CUO A;  4F7Z A;  4U0Y A;  2NAZ A;  3BR3 A;  2VN2 A;  3ML6 A;  3OYM A;  2YPR A;  2A5W A;  1MMN A;  3SJM A;  4AM3 A;  4YEL A;  2ME6 A;  2DA5 A;  2E1N A;  3LA7 A;  3FXJ A;  1TWA J;  3CCV I;  1WGX A;  3SYT A;  4CDG A;  2L01 A;  3BPX A;  2YU9 J;  2HPM A;  4G6D A;  4MFE A;  4A5M A;  1F36 A;  3ONQ A;  4BH9 A;  4GXO A;  2ISY A;  2HDD A;  1EH7 A;  1MMD A;  2RNG A;  4UVC A;  4B8X A;  2MG4 A;  3B02 A;  2PEX A;  3SFZ A;  2HTS A;  2H1K A;  2H09 A;  3JTH A;  1WJC A;  2A61 A;  3RZO J;  2DMU A;  3CMY A;  1VQ9 I;  2KQR A;  1HW2 A;  1M1E B;  1HC8 A;  3VPR A;  2XB0 X;  3E97 A;  2G7H A;  1YHQ I;  4ZJZ A;  4CXF A;  3HOX J;  1TNT A;  4AYB N;  4FET A;  2EIK H;  3BP8 A;  3V8J A;  2Q2E A;  3HTS B;  2KRC A;  1YFH A;  3F8F A;  2QWW A;  4IOA F;  3KEY A;  3HDD A;  2F4M B;  1D8J A;  3I5U A;  5HDK A;  1R1V A;  2DI3 A;  1YIJ I;  2WBM A;  3DKW A;  2HYG D;  1YTY A;  4Q48 A;  3ECH A;  3VWB A;  3M4O J;  2BOL A;  1CF7 A;  2XSJ C;  4HOB A;  2XAS A;  2ZBK A;  1VQ8 I;  2WB1 A;  2DJN A;  3H9Q A;  5LRS A;  3OYC A;  2R92 J;  4CCK A;  2CUF A;  4BL0 B;  2R93 J;  1OMI A;  2WAF A;  1V5E A;  3O2P E;  2X85 A;  4XKW A;  1MH4 A;  2QBY A;  4XM3 A;  4BEH A;  4A6E A;  2DOE A;  2GA2 A;  2XGD A;  3ASN H;  3GTO J;  1T6S A;  2CW8 A;  3OYH A;  2JUC A;  4LG0 A;  3C18 A;  3WTZ A;  4RA2 A;  1R49 A;  4AVZ A;  3HPH A;  1IN5 A;  2E34 A;  2Y0M A;  2HXI A;  5TRD A;  1P7I A;  1MBK A;  3RJP A;  4C2U A;  4KIF A;  1WJ5 A;  2KFD A;  3H5N A;  3A01 A;  1ZLJ A;  1KYZ A;  3G71 I;  1XSX A;  4CCM A;  4L5E A;  2EZH A;  3L7W A;  2ZJR F;  1Y0U A;  2ZFW A;  3WE2 A;  3I58 A;  1T08 B;  1Y6I A;  1DPR A;  4I99 C;  3E6C C;  2LNB A;  2N8G A;  3RI4 A;  3OSG A;  1MKM A;  4I09 A;  5IOZ A;  5JHU A;  2QVO A;  4QPQ A;  2XGC A;  3KZZ A;  1S8N A;  4A3J J;  1I39 A;  3S15 J;  2CRG A;  4UVB A;  1SD6 A;  2ZJQ F;  1HW1 A;  3G4S I;  1T38 A;  1U9O A;  4JX5 A;  2Z1D A;  2LRE A;  2EFP A;  3ZMU A;  1N25 A;  4P1W A;  5F0F A;  4EJO A;  3IRR A;  3O3K A;  1UB9 A;  1XS9 A;  3S14 J;  4A3I J;  2HQA A;  1X1A A;  3S3M A;  4WK8 F;  3CJN A;  3PNT A;  3QPT A;  3PFY A;  4AIK A;  5IOY A;  5IP6 A;  4EQQ A;  1ZTR A;  5DM7 F;  2HGC A;  4OAZ A;  5J1U A;  1OYW A;  2MC3 A;  4JYK A;  1SD7 A;  1E17 A;  4LB6 B;  2A6H F;  3KZY A;  2HQR A;  3LFK A;  2YX7 A;  1SAU A;  1FBS A;  1ZRE A;  1JHF A;  1IZ1 A;  2XDV A;  3KP4 A;  1ORK A;  4Y33 A;  2E19 A;  4F55 A;  5HLH A;  2RAE A;  5HDG A;  3WG9 A;  4RAY A;  4GFB A;  5AON A;  5H2F C;  5J3L A;  5ICG A;  3JRC A;  1R1T A;  3K1P A;  5D5W B;  1IC8 A;  1P6R A;  1ZN2 A;  4LOC A;  3RYP A;  4MIM A;  5FD6 A;  5EJC A;  3NQO A;  2NS0 A;  2W4S A;  4GDF A;  3IC7 A;  1C0W A;  4DJA A;  3ZQQ A;  4BJT A;  2BY2 A;  4WX9 A;  1J0R A;  2H94 A;  3BTC A;  3HSE A;  2DA3 A;  4XON A;  3MQ0 A;  5HS8 A;  5E20 A;  4ABZ A;  5ICE A;  5CJ9 A;  3I64 A;  3OV8 A;  1Z77 A;  1KQ9 A;  3GF2 A;  4AC0 A;  1R7J A;  1QA6 A;  4ESB A;  2JRM A;  2JA8 J;  1N78 A;  1FSE A;  3DQV C;  2OZ6 A;  4WF2 A;  1P9Q C;  2EPF A;  1QZZ A;  2HYJ A;  4HW0 A;  4FE4 A;  4XNF A;  2Y9Y A;  2ZXW H;  4QTR A;  3S3O A;  2O0Y A;  4XKV A;  1BA5 A;  2EZL A;  2I10 A;  3H92 A;  3U1K A;  4B44 A;  2XAG A;  4PSX A;  4A0Y A;  1ERD A;  1SD4 A;  2EFQ A;  3SHF A;  4M3D A;  5JR3 A;  2LMD A;  2AXT C;  2K85 A;  1TBX A;  2RRE A;  4E6K G;  5BOX A;  2NVT J;  5LD2 C;  4M3B A;  3BQZ A;  1EJ9 A;  2W85 A;  2MC4 A;  4YEJ A;  1XMK A;  4CYD A;  2L02 A;  1I50 J;  1FOX A;  1WHU A;  3EET A;  3EUK L;  4BE1 A;  2WY8 Q;  2FQ4 A;  1KON A;  2WTE A;  3BG3 A;  3IH4 A;  2HNH A;  3HZJ A;  5A2Q Z;  4IHS A;  3F3X A;  3CF5 F;  2Y9Z A;  2XAQ A;  2LYC A;  4CCO A;  4DW6 A;  5J8F A;  4DGW B;  1DPU A;  4C3I J;  3QPS A;  2W7N A;  3QWL A;  1F9N A;  1Z7L A;  2R7W A;  1U8B A;  2HQN A;  3F8C A;  4NC6 A;  3CD6 I;  3ZQF A;  4N0B A;  4XID A;  4A3C J;  3KP3 A;  3LA2 A;  1X3W B;  4CH7 A;  1GLN A;  3JRH A;  4EV0 A;  4BHC A;  2M45 A;  3FMS A;  5J4V A;  1IRX A;  3H3V K;  1SFO J;  3F6V A;  4RGS A;  2Z3Y A;  3K70 C;  3JRA A;  3P5J A;  2OA4 A;  2ID6 A;  3TOB A;  2JTV A;  3IAM 2;  2VBY A;  4HNU A;  2XRL A;  5D5U B;  4XK4 A;  3WGG A;  2DFE A;  4LK0 F;  3FF5 A;  3BR5 A;  4JP0 A;  1GV5 A;  5GPA A;  1QPI A;  3I59 B;  3ELK A;  2MGQ A;  2IPQ X;  4V2G A;  3HJE A;  4L5J A;  3TO7 A;  1Z05 A;  3ZGK A;  4XN0 A;  5E3M A;  1MBG A;  2E1O A;  4CYC B;  3LFU A;  4RAF A;  1VI0 A;  3LQQ A;  2K4B A;  3KLO A;  3TGN A;  2HEO A;  3CP2 A;  2DFF A;  3ZMS A;  5D8K B;  1PYV A;  2GQQ A;  1OCR H;  3FXR A;  1ZAO A;  5CVI A;  3F8M A;  4CZZ A;  1MNM C;  4GRI A;  4BBS J;  1R5I D;  3CCR I;  1TT0 A;  2ZXH A;  2XRN A;  4BHB A;  4IKF A;  1QHH D;  1BBY A;  2D45 A;  2EA4 A;  1H88 C;  4PK4 A;  2XPW A;  3WU1 B;  4EM0 B;  5FLX Z;  1WKM A;  1BJZ A;  5FKK A;  1O7F A;  5D5X B;  5HS9 A;  3CZ6 A;  4XLE A;  1TZL A;  4DYQ A;  1ZR2 A;  3M8F A;  2QCO A;  1XSV A;  1UHW A;  3AG3 H;  4DNC A;  3S3N A;  5FLV A;  2DA4 A;  3GTP J;  2YR2 A;  1FNN A;  4HQM A;  2F5D A;  3OOP A;  2NS7 A;  4E7J A;  1B6A A;  3ZQL A;  1J9I A;  2A68 F;  2M5W A;  4NC7 A;  4UUS A;  3JR9 A;  4DIQ A;  1CF7 B;  3HOY J;  2YS9 A;  1ZEL A;  1QNT A;  2FRH A;  5E1X A;  3MVP A;  2TCT A;  2WC2 A;  2ZNZ A;  2XB5 A;  2CSO A;  1IXC A;  4OOI A;  1EV7 A;  2QBY B;  1P92 A;  1NK2 P;  2L7M P;  2RGV A;  3R60 A;  1P7J A;  3RPU A;  2FXA A;  3ERE D;  4IL6 C;  4NHJ A;  2MH9 A;  3CLQ A;  3LSH A;  2DPD A;  2LDU A;  1B9N A;  2IRF G;  4LG0 B;  1Y1V J;  5ED4 A;  2HVS A;  2KKO A;  2EH3 A;  4AU7 A;  1W0U A;  2VOO A;  3GCM A;  5JHF A;  1RPW A;  3IH2 A;  2FSW A;  5FJ8 J;  3CCU I;  1Z91 A;  2JA5 J;  2K27 A;  2R5Z A;  1H9G A;  3VSL A;  1KU3 A;  4KYW A;  3F23 A;  3HEF A;  4RM3 A;  5GAD J;  5LHG A;  3IKV A;  1ETO A;  3VYT B;  2LD5 A;  2X51 A;  4LLL A;  3S2H J;  2EIN H;  3GO5 A;  1HKQ A;  5E3O A;  1MJ9 A;  4QSH A;  4S04 A;  4ENK A;  1REP C;  4KIB A;  3UKG A;  3LAJ A;  3I4N J;  2ZJ2 A;  2Z5U A;  5CLS A;  2QYO A;  4QIW N;  3F22 A;  2BE5 F;  2G7U A;  1B72 B;  1S72 I;  4C3J J;  2P5V A;  3WTU C;  2KIQ A;  3K7A J;  4U0V A;  3L09 A;  2A6T A;  1BC8 C;  5CPR B;  2CQ7 A;  1G3W A;  1HDP A;  2OBP A;  1W36 D;  1BR1 A;  1BM9 A;  1KA8 A;  1W5S A;  1YW9 A;  3AG4 H;  2VON A;  5H6R A;  3C1D A;  1FPQ A;  5BNG A;  2TRT A;  3WTT C;  3OYI A;  2F5E A;  3M3Y J;  2DW4 A;  1B8I A;  3P9C A;  5DD4 A;  1SFX A;  3CQZ J;  3HSF A;  1VQ7 I;  2M4K A;  2JRT A;  2HU9 A;  2M3A A;  5EGO B;  4PGG A;  3V4G A;  3CCE I;  4A69 C;  4M73 A;  2DMQ A;  3A2K A;  4HX4 A;  4RAG A;  4HNV A;  3NWT A;  4G9Y A;  1KU2 A;  1FZP B;  3TOA A;  2ICW G;  3RZD J;  5LHH A;  4HV5 A;  5EEA A;  4X6A J;  2A6E F;  1RZ4 A;  2NOJ B;  4NQW A;  2GXB A;  3FBI B;  3L1P A;  3MZ8 A;  4IX7 A;  1BR4 A;  2DYS H;  3TBI A;  3AG2 H;  3BZC A;  4F3Q A;  4EM2 A;  4XL9 A;  1BJA A;  1BW5 A;  4A3G J;  5AIQ A;  5L3C A;  2IA0 A;  1ZHF A;  2COB A;  5FFX A;  1B59 A;  3ZMZ A;  5LLQ A;  3H1C A;  3KE2 A;  4I0B A;  4BY1 J;  2ZCW A;  3PL8 A;  4BQA A;  4RB2 C;  2LLK A;  2QZ8 A;  2V6C A;  3EYY A;  3T8R A;  3D1N I;  2LFB A;  1VQ5 I;  4Y17 A;  2JA2 A;  2DA6 A;  4HG2 A;  1SD5 A;  1R9T J;  2E1C A;  1QZY A;  1NH3 A;  5BPD A;  3E6D A;  3WTV C;  1RKT A;  3F72 A;  4EVI A;  4EJT A;  2PG4 A;  2EBI A;  2X6Y A;  2V9V A;  4XSX F;  1YW8 A;  1TP4 A;  3PIO F;  1H89 C;  1IUY A;  5DCF A;  3OS2 A;  1QBJ A;  1S5L C;  3QRF F;  5J47 A;  3HKZ N;  2HPI A;  3IHU A;  2JA7 J;  2IXS A;  1XC5 A;  1Z67 A;  3IWZ A;  2EJR A;  5DD8 A;  2GOM A;  1MND A;  4MEY F;  1FTZ A;  5JVG F;  2W84 A;  1IN6 A;  2M4G A;  2O8K A;  2MA3 A;  4W1U A;  2PN6 A;  2V4J C;  2QKL B;  1XX5 A;  4XR6 A;  1UZC A;  3QP5 A;  4HDU A;  5EDN A;  2JK3 A;  1SVM A;  4HBL A;  2IS2 A;  3TL4 X;  2DFI A;  1I3Q J;  2WAD A;  3FK6 A;  4E7Z A;  4IRI A;  2MAB A;  2EIM H;  4WCG A;  5EYR A;  1A31 A;  1E3H A;  3MZY A;  5A2Q K;  5J4Y A;  5HDN A;  2IAI A;  4A2U A;  2BY3 A;  3LL7 A;  1O4X A;  2B0L A;  2GIZ A;  3GZN B;  4C2T A;  2JWT A;  4A3M J;  4ZYG A;  4ENN A;  1FYK A;  4YFN F;  3I0T A;  1QZE A;  2H1L A;  4A5N A;  4B1R A;  1A04 A;  2CU7 A;  2CQK A;  4BQN A;  1LEB A;  3KYD B;  2FUG 2;  2PJP A;  3D5S C;  4BYY A;  2XAU A;  5LGU A;  5ICC A;  5HOD A;  2IGM A;  4XOT A;  3JTG A;  4M9S A;  2CQX A;  4PFO A;  4NB5 A;  3I59 A;  3IKT A;  3J7A O;  4ZTF A;  3T8T A;  3L9F A;  3E1S A;  3LQR A;  3LSP A;  1MBF A;  4RDU A;  1W7P B;  1AHD P;  2NVQ J;  1NTC A;  1YIT I;  1CGP A;  2QGU A;  1IGN A;  4EJW A;  3M07 A;  3R6S A;  3QU3 A;  3AAF A;  3Q3S A;  3JRD A;  1QO0 D;  1XGO A;  5M5W J;  1FYL A;  2FQ3 A;  1A6Q A;  2DOD A;  1GV2 A;  1BOA A;  2HKO A;  2Q1Z B;  1KQ0 A;  1DGR M;  3AG1 H;  2JMW A;  2QM3 A;  4EM1 A;  1AKH A;  2IBD A;  2ELJ A;  3NAR A;  3KPH A;  1RRJ A;  2MSY A;  2QSH X;  4H4K C;  2V1U A;  2RN7 A;  1U78 A;  5H20 A;  2XF7 A;  4IHX A;  1YE9 A;  1YQA A;  1IAW A;  3GTL J;  3KP7 A;  1LVK A;  2EZI A;  2E5N A;  2OF7 A;  5TGT A;  1Y56 A;  3SFI A;  3DBH B;  3VYR B;  1JGS A;  2CUZ A;  3HOV J;  3MAJ A;  2K3P A;  3FXO A;  3CDI A;  5FB2 A;  2PX9 A;  4II3 A;  2E1M B;  2MYS A;  4BDZ A;  1ETQ A;  4HSR A;  4WWC A;  2LY1 A;  2IVM A;  3GME A;  1DQU A;  5E17 F;  2FML A;  5H6Q A;  4GO1 A;  3WHB A;  1DGW Y;  1WJF A;  5CYV A;  2FBH A;  4MQ9 F;  3DXJ F;  3OIP A;  4XLN F;  1J75 A;  5E3L A;  4A3K J;  4M72 A;  1QGP A;  3BRO A;  3OS0 A;  3HYI A;  4L9T A;  2EA2 A;  1SVO A;  2V7F A;  3G6E I;  5GTI C;  1MDM A;  1YIO A;  3S2W A;  2XPV A;  2CUJ A;  1FMV A;  4Z6Y A;  2R7Z J;  4JX4 A;  4AWX B;  4JOM A;  2LVS A;  3DKY A;  2R7S A;  1BI1 A;  2JUG A;  3OYJ A;  1B4A A;  1HST A;  2E2I J;  1PDN C;  2NNN A;  2L54 A;  1A6I A;  4NQW B;  1X3U A;  1OPC A;  3OYL A;  1STZ A;  4A3D J;  2VE8 A;  1Z3X A;  3D5L A;  5D6E A;  1GDT A;  4UY8 I;  2WWY A;  1A35 A;  2DA7 A;  2QKM B;  2QUF A;  1OR7 A;  3GTK J;  2XSD C;  2VXD A;  1V54 H;  4F91 B;  1D1B A;  5BPI A;  4LJZ F;  2H27 A;  2PLY A;  1I6X A;  3OL3 A;  2L9V A;  3H36 A;  4J01 A;  3J80 Z;  1TQP A;  3VYS B;  4TV7 A;  2HDC A;  3CJR B;  1I1S A;  5CVV A;  1BI3 A;  2GA1 A;  4UV8 A;  2OC6 A;  2L7F P;  2DO7 A;  4FTH A;  4LLG F;  1U3E M;  2R5Y B;  4NBQ A;  4ZYE A;  4FT8 A;  2FNA A;  4OIN F;  3ROU A;  3H3U A;  3FMR A;  1ETY A;  2WV1 A;  3ABU A;  3E5Q A;  5L3D A;  3HSR A;  2ELH A;  4PJN A;  2JN6 A;  4RAZ A;  4L9N A;  1W36 C;  3BG5 A;  2A3S A;  2LY2 A;  5CQG A;  3RKY A;  3S1M J;  3SQN A;  4GYG A;  1I1G A;  2ZSI B;  3I56 I;  3HHG A;  4MQV A;  5J1R A;  4IHV A;  1WI3 A;  1T95 A;  1E2X A;  2JSC A;  5D4R A;  1HBX G;  4BAY A;  1X1D A;  3LSJ A;  3DWL E;  2HZT A;  4P96 A;  3K1N A;  3DV8 A;  3VOD A;  4DOZ A;  2R4G A;  3H35 A;  3FMQ A;  4BHP A;  2O6G E;  2ESH A;  1I27 A;  1PUE E;  1MBJ A;  1ZH5 A;  4MHG A;  3GLX A;  3K1M A;  2QEX I;  1VQM I;  1LFU P;  4XLF A;  2F2E A;  2VLA A;  1D3Y A;  2RNJ A;  5DV5 A;  4DBR A;  4UVA A;  2L4M A;  4BNC A;  2A07 F;  4KMF A;  2AS5 F;  1OCC H;  3JAM K;  1R4M B;  1LKX A;  4IRH A;  1LUJ B;  2L9R A;  3TED A;  4BJ5 C;  1S7A A;  3E6M A;  3HC7 A;  3I53 A;  3GTQ J;  2VOP A;  1HW5 A;  1YS6 A;  3CMM A;  4X0G A;  3PJR A;  2AHQ A;  1XCB A;  1IV8 A;  3DPL C;  1MSF C;  1ACI A;  3MFK A;  2M2E A;  3M9A A;  3W2V A;  1JTX A;  1GXQ A;  1MBE A;  1J59 A;  2KRH A;  4UV9 A;  3R4K A;  1WJE A;  3JRB A;  4NC8 A;  2RVC A;  1F43 A;  2OTJ I;  1ZG1 A;  4XN3 A;  4B47 A;  3L2U A;  2LBF A;  5FKN A;  1P2F A;  3G3Z A;  4I01 A;  4YIR X;  2QQB A;  4EJV A;  3A4C A;  2STW A;  1IW7 F;  2EIL H;  2ZXI A;  3SZP A;  3S1Q J;  4I2O A;  1EKE A;  5IYC J;  1S3J A;  3D0S A;  1AKH B;  2L4A A;  2DA2 A;  4FX4 A;  3QU6 A;  4C2M J;  1QU3 A;  2VKV A;  3QPL A;  1ETK A;  4IF4 A;  5HLG A;  1O57 A;  4FHT A;  2GIV A;  2HOA A;  1FOK A;  4I02 A;  1LFP A;  3CTA A;  1K83 J;  2BGC A;  3HGG A;  4B3A A;  1U2W A;  1Q1V A;  2DFH A;  2CYY A;  3WU0 A;  3BCB A;  1IF1 A;  4X1E A;  3N4M A;  1MJB A;  2A5Y B;  3KET A;  2LC2 A;  5GP9 A;  1ITY A;  5F04 A;  1S29 A;  3OL4 A;  1PUF A;  2JJ7 A;  2K02 A;  5KCM A;  4A3F J;  1RUN A;  3J7Y J;  4XRF A;  2BW3 A;  3BC8 A;  2DU9 A;  2V26 A;  4OU0 A;  1LB2 A;  2O03 A;  3BZK A;  3BWG A;  5DYM A;  1K79 A;  3U1D A;  1FY7 A;  3G1L A;  3V8L A;  3C2G A;  4XOR A;  2R3S A;  3BDD A;  4A12 A;  2DK5 A;  3TDU C;  2K9N A;  2CWE A;  2KT0 A;  1IN8 A;  3UR3 C;  3K70 D;  4L0Y B;  2R7D A;  4PJL A;  3I4M J;  2PMU A;  4O3M A;  4KIT B;  2LR8 A;  5C4X J;  5LHI A;  4OMZ A;  1R23 A;  3E5U A;  5IPA A;  2ZFU A;  3WHC A;  3JW4 A;  1WI9 A;  2IA2 A;  4AD9 A;  2VKD A;  2DLL A;  3GTJ J;  4M3G A;  1VQL I;  5L3E A;  5F1R A;  5HOO A;  4YII A;  1ZLK A;  4RLF A;  1ETV A;  2W25 A;  2DBB A;  5E8I A;  4CIC A;  1UST A;  3D5R C;  3VEP A;  1LEA A;  3TP3 A;  1H0M A;  2L0K A;  4A3L J;  2HOS A;  3VFZ A;  2R7T A;  3C7J A;  1W1W E;  3V42 A;  3GYH X;  1ZR4 A;  2RDP A;  3WU2 C;  4BS9 A;  1N77 A;  1LJ9 A;  2X0L A;  1DUX C;  1U9N A;  3K69 A;  2DOA A;  1WSU A;  2VXZ A;  4XSZ F;  4EJU A;  2VPL A;  3KP2 A;  1TWF J;  2DMT A;  4M6V A;  1OLT A;  3TKY A;  4V19 K;  3K9T A;  5C4J J;  5IYD J;  5K7F A;  2ZME B;  2XF5 A;  3RQI A;  4II2 A;  1IRZ A;  2FF4 A;  2HWV A;  3BG9 A;  1WH7 A;  2VJ5 A;  4JK1 X;  2F4I A;  3WG7 H;  3ZOB A;  3WTW C;  4P9F A;  2Y48 A;  3I4P A;  3ZMD A;  2JVG A;  3DEE A;  3JCU C;  4XKC A;  4JBA A;  4DQ2 A;  1MDM B;  3OIO A;  1JT6 A;  3RCO A;  4DYR A;  4R1H A;  4Y4R A;  4CZC A;  3SEZ A;  2DQR A;  4PDK A;  5FRN A;  2M30 A;  2KIF A;  1MIJ A;  3S32 A;  1ODD A;  3DF8 A;  2KIM A;  1Z1D A;  3OY9 A;  3V8K A;  1YLF A;  2QLZ A;  2B7E A;  1VQO I;  4CO8 A;  1T0F A;  4A0Z A;  1E3O C;  1RNL A;  1Z9C A;  1SVL A;  5FGM A;  3WE3 A;  2HXO A;  3HRM A;  3U21 A;  5F1J A;  5M5Y J;  1SFU A;  2Z9O A;  3IL2 A;  2NVU B;  3ABK H;  3BR2 A;  3DBR B;  1B72 A;  3C2B A;  5EEG A;  3MWM A;  2DT5 A;  3HOU J;  3GW2 A;  2W24 A;  3QAH A;  3KP5 A;  1BOB A;  2EK5 A;  2IW5 A;  4OIP F;  1FT9 A;  1VQP I;  2RC4 A;  4B09 A;  3LSM A;  3LSK A;  2VUM J;  3GFI A;  2KJB A;  1HA8 A;  4S05 A;  4BY7 J;  1B8I B;  4KJZ A;  3HG9 A;  1MMS A;  2LKP A;  2BZT A;  2PBI A;  2R5Y A;  3DLA A;  3S93 A;  1O3R A;  3LA3 A;  2R0Q C;  3O8H A;  2K9S A;  2VL8 A;  2EFN A;  1OR7 C;  5ERI A;  5EGO A;  2M8E A;  4F92 B;  1WZ2 A;  4L5I A;  2EV6 A;  3ZR8 X;  5KHD A;  1X2N A;  2ZME C;  2VB6 A;  1X3Z B;  4HLX A;  1XGM A;  2EIJ H;  2KLO A;  4AIH A;  5F64 A;  1IRG A;  2KZV A;  2COM A;  2Y0S N;  3PIP F;  4F52 A;  1V55 H;  3OYD A;  2OJE D;  1K78 A;  1EF4 A;  3QOE A;  1BC7 C;  3CCM I;  2P5K A;  4NDL A;  2M7A A;  4B4C A;  3AL0 B;  2IP2 A;  2AXL A;  5IT9 Z;  3RIR A;  1HLV A;  2O9L A;  4K2E A;  3CC7 I;  4KN4 X;  5K7H A;  4P5O A;  3COA C;  1BN5 A;  2MBF A;  3CES A;  2Z2S B;  2K7L A;  5ICF A;  2V79 A;  1EH8 A;  2NOG A;  4MO7 A;  3CCL I;  2O3F A;  2GXA A;  4CGZ A;  1WFX A;  2I5U A;  5KAF C;  2VC1 A;  1YOV B;  1MMA A;  3B73 A;  1R58 A;  3TO9 A;  3OYF A;  4BE0 A;  1HSJ A;  2W82 A;  5E79 C;  4EEF G;  3G73 A;  1XD7 A;  4HF1 A;  4OMY A;  2R7U A;  5C44 J;  1JKO C;  2OTL I;  2FNP A;  5DDG A;  2E36 A;  5DUK A;  4N9H A;  1HKT A;  1GHC A;  5CKT A;  4YIF A;  2DMP A;  2M7B A;  2O8X A;  4XMY A;  3F8B A;  1IRF A;  3RTR A;  5C3E J;  4EGZ A;  5F08 A;  2X1D A;  1R00 A;  2E5Z A;  2LP0 A;  2PQ8 A;  4AUX A;  1HCR A;  4IEJ A;  1JHH A;  3FX3 A;  5J1Y A;  4XLH A;  1E3P A;  2GOX B;  3ESW B;  1L3L A;  1HKS A;  3OR1 C;  3LNQ A;  2P6T A;  4OIQ F;  1W4M A;  3JSP A;  3ZP5 A;  1IN4 A;  4D5F A;  1D0Y A;  4M9Z A;  3K4J A;  1SMY F;  4RB1 A;  4EGY A;  6PAX A;  3BCA A;  4B3X A;  4YFX F;  1KZH A;  2IGK A;  4Y15 A;  4P9U A;  4KUM A;  4Z2Y A;  2LF7 A;  4OIO F;  2WB1 N;  1GVJ A;  3ISP A;  1XG1 A;  2YX4 A;  2Z33 A;  1BL0 A;  1J5Y A;  1E0E A;  1UHM A;  3OYB A;  1DU6 A;  1FJL A;  1JTY A;  2WY7 Q;  1MBH A;  4GCV A;  1T0F C;  3CF2 A;  5B3S H;  1OKR A;  3RSN A;  2XC7 A;  2FOK A;  3C3W A;  3BR1 A;  2UXN A;  3R61 A;  1K7A A;  3V7S A;  2KZG A;  1IV6 A;  1IO2 A;  3QYB A;  2KDO A;  2ID3 A;  3ABL H;  5EF6 A;  2HOE A;  1G6N A;  2Q2E B;  2D5V A;  3S16 J;  3O6B B;  3HTU A;  3W3C A;  2M8G X;  2HS5 A;  3IH3 A;  4Y3O A;  1IJW C;  3GZ5 A;  1H9T A;  1FIA A;  5AIP A;  1RC9 A;  4LFU A;  5EZH A;  1MJA A;  2XRO A;  4N9I A;  4R8H A;  4A3E J;  3DU6 A;  3VB2 A;  1W0T A;  1OCZ H;  1ZRC A;  4IOC F;  1JI8 A;  2A69 F;  2BY0 A;  3F6O A;  4D9J A;  2Y69 H;  4IQ4 A;  1ON2 A;  2ESN A;  2DDA A;  4MFD A;  4P55 A;  3RPQ A;  2DAO A;  4ZTJ A;  2OCC H;  3AL0 C;  4I76 A;  3G1M A;  2EB7 A;  3HB9 A;  1PUF B;  4C30 A;  3GBG A;  2VAS A;  1YX5 A;  3TDZ C;  2V1X A;  1UCR A;  4YFK F;  1XCV A;  1JGG A;  3WTY C;  1SEU A;  1EA3 A;  1XN7 A;  4I7H A;  1FYM A;  4DZP A;  4RB3 C;  2EV5 A;  4BEH B;  1D5Y A;  2UXX A;  2XKP A;  3W6K B;  2W57 A;  5LFA A;  1ON1 A;  5GAG J;  1KU9 A;  5ILV A;  3E0J B;  3GEZ A;  2E35 A;  2HVQ A;  4LLN A;  2G9W A;  1LE8 A;  3H5A A;  3I9V 2;  3ZQG A;  1JE8 A;  3PNY A;  4IQJ A;  1RIO H;  1LPQ A;  1V3F A;  2XPU A;  1R5H A;  2R7Q A;  1FX7 A;  5JLW A;  3CDH A;  3GVA A;  4E70 A;  2P81 A;  1XSD A;  1XMA A;  1WJA A;  1X1B A;  3B6C A;  1MZB A;  2DT6 A;  2JVH A;  4IO9 F;  2V9K A;  5ILU A;  4XBF A;  4HF2 A;  3CP8 A;  2Y0S A;  2YSR A;  5K7Z A;  2LRD A;  2F6C A;  5FKM A;  5DM6 F;  1XTA A;  4M71 A;  2AQE A;  5IYB J;  4HNT A;  4E7K A;  1UHS A;  1D0X A;  1ZGW A;  2IS6 A;  2K40 A;  2LF8 A;  4B43 A;  3L2Q A;  3HOS A;  4HAM A;  1DU0 A;  3I55 I;  3Q0U A;  3T0Y A;  3SZG A;  2PJR B;  1YX3 A;  1I3A A;  4JX6 A;  4ENM A;  2HDW A;  5LEK A;  2EFO A;  1ZRD A;  2CGP A;  2VBW A;  4OIR F;  4RB0 A;  3BPV A;  4GGG A;  2L7K A;  4L0Z B;  1FP1 D;  2OAZ A;  1PJR A;  4ESF A;  4BBR J;  4CHU A;  3M1E A;  1DP3 A;  1XDU A;  3BR6 A;  4AID A;  1FLI A;  2OQG A;  1VFC A;  2RKH A;  2UZK A;  1ZYR F;  3BJO A;  3JSO A;  4BE2 A;  3HOZ J;  1RET A;  2XAJ A;  2ME0 A;  3PO3 J;  1Z6T A;  2FA5 A;  2QF7 A;  1XGS A;  2DMN A;  2MLG A;  1OYI A;  3E6B A;  4FQG A;  5BMZ A;  1K61 A;  3P7N A;  2QA4 I;  3BG6 A;  3CC2 I;  2R7X A;  3EPZ A;  1JUS A;  3PNV A;  2Y75 A;  1K78 B;  4WXH A;  4XRS G;  1X2M A;  1JKQ C;  1YYV A;  2BVM A;  2VJJ A;  1WH5 A;  1Z0X A;  1U5T C;  1WJD A;  1YS7 A;  3KLN A;  5EG0 B;  1F5T A;  1J2X A;  4XLC A;  2B63 J;  1P4A A;  4LB5 A;  3CUQ A;  3E3V A;  2M1B A;  2GBY A;  1LDD A;  4MNU A;  3FKJ A;  4JQF A;  4ENJ A;  4IHY A;  4PZJ A;  3GFM A;  2MD5 A;  3P9I A;  5B66 C;  1O3T A;  3GZ6 A;  2UWM A;  1U5T B;  1T39 A;  5DCM A;  1WCM J;  2CV0 A;  4E4H A;  4Y7N J;  3QOP A;  3MN2 A;  1TW3 A;  1NG7 A;  4N4N B;  5CVU A;  3EQL F;  2ACJ A;  2K9Q A;  5K5O A;  2HOT A;  4ZDL A;  3ZMV A;  1ZG3 A;  1POG A;  1X58 A;  3KEO A;  3J7Z I;  1Z7U A;  4ZDO A;  2BBY A;  2FX0 A;  1TW2 A;  2CQQ A;  3ASO H;  2XVC A;  4M9X A;  2VKH A;  4HX7 A;  5GTH C;  2QSG X;  1W5C C;  5EEH A;  5JVT A;  4FE7 A;  3F21 A;  2GM4 A;  2YU3 A;  4BXX J;  5B5E C;  4G7O F;  1U0J A;  3BY6 A;  1O3S A;  1YW7 A;  4KMU X;  1NHA A;  3ECO A;  4EAT A;  1OQY A;  1JUP A;  1AA7 A;  3ERM A;  4UUV A;  3MD2 A;  2NNY A;  5HVQ C;  3V7R A;  2K9M A;  3ABM H;  4FAS D;  5K5R A;  1RR7 A;  4UNO A;  1FBQ A;  1D1A A;  3KEQ A;  3FIW A;  2DPU A;  4V2F A;  1V4R A;  1FTT A;  1BI0 A;  2GAU A;  4NNJ A;  3S2D J;  3IRQ A;  4G7H F;  2CQN A;  1FP2 A;  1UAA A;  2H8R A;  2CW7 A;  3Q5F A;  1MGT A;  2VT3 A;  1N75 A;  2BVL A;  2Y2Z A;  3S1R J;  1BR2 A;  5DS9 A;  4E7I A;  4UUT A;  4PUS A;  2GWR A;  3O8G A;  4BUP A;  2UV1 A;  3OWT A;  4O5V A;  5K5Q A;  3HXL A;  4HEA 2;  4ZYD A;  4RGU A;  5K1Y A;  2X6W A;  4I98 B;  3DPU A;  1S9H A;  5HLT A;  4ON0 A;  3PSI A;  1WQ2 A;  4PSW A;  2MFZ A;  3HUG A;  2M34 A;  3G1O A;  4J00 A;  3EDP A;  1WVR A;  2P7V B;  3EUA A;  3WTX C;  2K9L A;  1ENH A;  1W7P D;  2BY1 A;  3OIQ A;  1WWX A;  3J80 K;  3QYE A;  5J8C A;  2CFX A;  5J40 A;  4IHW A;  5DEQ A;  2VPR A;  3OYE A;  1BIB A;  1R5G A;  3BTI A;  2DDB A;  1FIP A;  2KHM A;  3K6G A;  3AFH A;  5E1W A;  1S7O A;  1UG2 A;  2KIU A;  3PQK A;  3QOD A;  4LMY A;  2B9S A;  3CDL A;  2XUB A;  5J6X A;  2R7V A;  5IT3 A;  2BYV E;  2OPT A;  3BQY A;  5FO5 A;  3NWS A;  3DPT A;  1XDS A;  2XHK A;  3MKY B;  3V7C A;  2P8T A;  3A1Y A;  2OU2 A;  3BLY A;  1QHG A;  3BG7 A;  3HPG A;  1GUU A;  2LG4 A;  3HHH A;  2QQA A;  3FM3 A;  2FOW A;  1LE8 B;  2CW0 F;  1OCP A;  5FKL A;  1V5G A;  3K2Z A;  4IXA A;  4H0E A;  4UXN A;  4XIC A;  2GLO A;  4ESJ A;  3F9K A;  4RMN A;  1UMQ A;  1SC7 A;  2IJL A;  2RV8 A;  1VQ6 I;  2M87 A;  4HA8 A;  4C9Y A;  2D2W A;  5B1A H;  4RS8 A;  2VJ4 A;  1B9M A;  5E18 F;  2F5F A;  3DEW A;  1FMW A;  1HOM A; 
#chains in the Genus database with same CATH homology
 4HDV A;  3M8E A;  2FBI A;  1WRJ A;  3F8N A;  3J81 Z;  2CO5 A;  2IT0 A;  3FXU A;  4IHT A;  3BJ6 A;  3DP7 A;  3MZH A;  2JT1 A;  2JPB A;  5LBQ A;  2KJC A;  2E7W A;  4U0W A;  5HLI A;  1SMT A;  2D1H A;  5JFR A;  2J5O A;  5LEJ A;  2XIG A;  1R1U A;  3W6J B;  1O3Q A;  1FC3 A;  3DEU A;  3MEX A;  1D5V A;  3VOE A;  1LVA A;  4RGX A;  1ULY A;  4AVP A;  3CUQ B;  4ZZL A;  2LSO A;  2VT2 A;  5BQT A;  1J7K A;  3CO7 C;  4HZF A;  1IXR C;  1ZGJ A;  3RYR A;  4HV6 A;  1Q1H A;  1XB4 A;  4O6J A;  3LAP A;  4Q5S F;  2HR3 A;  4KNY A;  2MLK A;  4G6Q A;  3GFL A;  1G4D A;  3WOD F;  1ZRF A;  1SFE A;  4QWQ A;  2Z99 A;  4L18 B;  2PFB A;  1AOY A;  1ONV A;  2Q8K A;  1T98 A;  2RQP A;  2FEZ A;  2XV4 S;  2PI0 A;  2FE3 A;  4IRG A;  4G94 A;  5D6F A;  4LK1 F;  2P6S A;  2L3D A;  3WGI A;  3FHZ A;  3H3Z A;  3TO6 A;  4HX8 A;  4MGR A;  3Q9V A;  1TQM A;  4KIC A;  3KP6 A;  2C6Y A;  5E8G A;  3MCZ A;  1U5T A;  3BOQ A;  4U7B A;  1KYW A;  4XLP F;  1IXS B;  1LQ1 A;  2PMH A;  4PGH A;  1KGS A;  5HS7 A;  5JI6 A;  3GFJ A;  1R22 A;  2H6B A;  3QPH A;  5ILS A;  4G8X A;  3IWF A;  4GYI A;  2NYX A;  2ETH A;  1RUO A;  2J5P A;  4MTD A;  5IT9 K;  3RKX A;  3R0A A;  2FU4 A;  3NRV A;  3SZT A;  1RI7 A;  5TJJ A;  2O61 A;  1KQ8 A;  5D5V B;  3ZN1 A;  1P4W A;  1F1Z A;  3REO A;  5D4S A;  2VE9 A;  2BV6 A;  4U7D A;  3RDI A;  2EV0 A;  4A0X A;  2TDX A;  2GZW A;  1SAX A;  5LRR A;  2KRF A;  4KFC A;  3PQJ A;  5L3B A;  3SXY A;  2FBK A;  1FWZ A;  1USS A;  3FXQ A;  1QQI A;  3HOT A;  1FSH A;  4Y13 A;  1W7P A;  5L3G A;  4ASN A;  5D8L B;  3EUH A;  3P9K A;  4HF0 A;  1O7L A;  3HRU A;  4HQE A;  1IN7 A;  3CUQ C;  1W5T A;  4BXU A;  2BEO A;  3ZPL A;  2D1V A;  1HQC A;  2XAF A;  3HIF A;  1R36 A;  2IA1 A;  1AWC A;  5FD5 A;  3LST A;  3E5X A;  4M74 A;  2P5L C;  1KU7 A;  2ZNY A;  2XKO A;  1LDJ A;  1EH6 A;  3Q9S A;  3CO6 C;  3ZQ7 A;  3CLO A;  4WXD A;  2P4W A;  4MTE A;  1TQI A;  2QQ9 A;  1OYY A;  3JAM Z;  3ZN0 A;  4WXC A;  2JPC A;  4IJA A;  4ZH4 F;  1VTN C;  3L2C A;  3KCC A;  5LGT A;  4U88 A;  2H6C A;  2VC0 A;  2HTJ A;  1BIA A;  2NRA C;  2ZKZ A;  3I54 A;  4UHT A;  1GXP A;  3L00 A;  4KIG A;  4M6Y A;  2ISZ A;  2JZY A;  4Q4Z F;  1ZGA A;  2WV0 A;  1DDN A;  3R0J A;  1G3T A;  3EYI A;  1T2K A;  3TQN A;  1B1B A;  1TTY A;  3KFW X;  1DP7 P;  4A6D A;  1LDK B;  1ZAR A;  3FWE A;  1FBU A;  2ZO4 A;  1JXS A;  1XGN A;  1P4X A;  4ETS A;  2FMY A;  3WTS C;  3LWF A;  4Q47 A;  1MD0 A;  2ADU A;  4LGW A;  2V1D A;  2F5C A;  2R7F A;  3PFI A;  2DTR A;  3GXO A;  4M6X A;  4HLY A;  4LD5 A;  2DQL A;  5KVR A;  2OD5 A;  2E7X A;  1F4K A;  3QP6 A;  2QEN A;  5DCM B;  4AIJ A;  3HRT A;  5F6F A;  4QLC U;  3J81 K;  1HXD A;  5DUI A;  2EWN A;  1G3Y A;  3T5X A;  5CVR A;  1K6O A;  2VOD A;  1ZG5 A;  4L9J A;  2STT A;  2HYF A;  3ULQ B;  2K86 A;  1LNW A;  3HRS A;  3BJA A;  1Z6R A;  4ZYH A;  4HYE A;  4L9V A;  1BI2 A;  4IPA A;  5LGN A;  1PP7 U;  2HFH A;  2ZXJ A;  4D0P A;  2VBZ A;  3WGH A;  4MEX F;  2K4J A;  2XAH A;  2HKX A;  5BS6 A;  1U6G A;  1I5Z A;  2OQR A;  3U9G A;  3FM5 A;  2DK8 A;  3N97 A;  5KK1 A;  3BZ6 A;  3DFG A;  4IVN A;  5FLX K;  2P7C B;  5E1Z B;  3GUD A;  5L3F A;  4KT5 C;  2Q0O A;  4PCQ A;  3K0L A;  3GX4 X;  4FX0 A;  1YO5 C;  1L0O C;  1YG2 A;  4G7Z F;  4RGR A;  3T1B A;  2VBX A;  4EMS A;  1D8K A;  3ZMT A;  2MH2 A;  4R79 A;  2X4H A;  1TLH B;  3ABT A;  1QPM A;  3U2R A;  4ZZD A;  1UFM A;  1TNS A;  4YG2 F;  1U8R A;  3FZV A;  5CVJ A;  4KN7 X;  4KA4 A;  4I0A A;  2OZU A;  4KDP A;  3GWZ A;  2CG4 A;  5FFZ A;  1S6L A;  1PP8 F;  3I71 A;  1G3S A;  3NEU A;  2ZME A;  3M7G A;  2XGX A;  3RKW A;  2EFW A;  2GXG A;  3CUO A;  4F7Z A;  4U0Y A;  2NAZ A;  2VN2 A;  3ML6 A;  2YPR A;  2E1N A;  3LA7 A;  4CDG A;  2L01 A;  3BPX A;  4G6D A;  4A5M A;  4BH9 A;  4GXO A;  2ISY A;  1EH7 A;  4UVC A;  4B8X A;  3B02 A;  2PEX A;  3SFZ A;  2HTS A;  2H09 A;  3JTH A;  2A61 A;  1HW2 A;  3E97 A;  2G7H A;  4CXF A;  1TNT A;  3BP8 A;  3V8J A;  2Q2E A;  3HTS B;  1YFH A;  3F8F A;  2QWW A;  1D8J A;  3I5U A;  5HDK A;  1R1V A;  2DI3 A;  3DKW A;  2HYG D;  1YTY A;  4Q48 A;  3ECH A;  1CF7 A;  4HOB A;  2XAS A;  2ZBK A;  5LRS A;  1OMI A;  3O2P E;  2QBY A;  4A6E A;  2GA2 A;  1T6S A;  4LG0 A;  3C18 A;  3WTZ A;  1IN5 A;  2Y0M A;  5TRD A;  3RJP A;  4KIF A;  1ZLJ A;  1KYZ A;  1XSX A;  3L7W A;  1Y0U A;  2ZFW A;  3WE2 A;  3I58 A;  1DPR A;  3E6C C;  2LNB A;  3RI4 A;  1MKM A;  4I09 A;  5JHU A;  2QVO A;  3KZZ A;  1S8N A;  4UVB A;  1SD6 A;  1HW1 A;  1T38 A;  2EFP A;  3ZMU A;  4EJO A;  3IRR A;  3O3K A;  1UB9 A;  4WK8 F;  3CJN A;  3QPT A;  4AIK A;  4EQQ A;  2HGC A;  1OYW A;  2MC3 A;  1SD7 A;  1E17 A;  4LB6 B;  2A6H F;  3KZY A;  2HQR A;  3LFK A;  2YX7 A;  1FBS A;  1ZRE A;  1JHF A;  1IZ1 A;  3KP4 A;  5HLH A;  5HDG A;  3WG9 A;  4RAY A;  5AON A;  5ICG A;  1R1T A;  3K1P A;  5D5W B;  1P6R A;  1ZN2 A;  3RYP A;  5FD6 A;  3NQO A;  2NS0 A;  3IC7 A;  1C0W A;  4WX9 A;  1J0R A;  2H94 A;  3HSE A;  3MQ0 A;  5HS8 A;  5E20 A;  5ICE A;  5CJ9 A;  3I64 A;  3OV8 A;  1KQ9 A;  3GF2 A;  1R7J A;  4ESB A;  1FSE A;  3DQV C;  2OZ6 A;  4WF2 A;  1QZZ A;  4HW0 A;  2O0Y A;  3H92 A;  2XAG A;  4A0Y A;  1SD4 A;  2EFQ A;  3SHF A;  5JR3 A;  1TBX A;  5BOX A;  2W85 A;  1XMK A;  4CYD A;  2L02 A;  3EET A;  2WTE A;  5A2Q Z;  4IHS A;  3F3X A;  2XAQ A;  5J8F A;  1DPU A;  1F9N A;  2HQN A;  3F8C A;  4N0B A;  3KP3 A;  3LA2 A;  4EV0 A;  4BHC A;  2M45 A;  3FMS A;  3F6V A;  4RGS A;  2Z3Y A;  2OA4 A;  3TOB A;  2JTV A;  2VBY A;  5D5U B;  3WGG A;  4LK0 F;  3FF5 A;  3I59 B;  3ELK A;  2IPQ X;  4L5J A;  3TO7 A;  1Z05 A;  3LQQ A;  2K4B A;  3KLO A;  3TGN A;  2HEO A;  3ZMS A;  5D8K B;  2GQQ A;  3FXR A;  1ZAO A;  5CVI A;  3F8M A;  4CZZ A;  4BHB A;  2XRN A;  1BBY A;  2D45 A;  2EA4 A;  3WU1 B;  4EM0 B;  5FLX Z;  1WKM A;  1O7F A;  5D5X B;  5HS9 A;  3M8F A;  1XSV A;  1UHW A;  4DNC A;  2YR2 A;  1FNN A;  4HQM A;  2F5D A;  3OOP A;  1B6A A;  1J9I A;  2A68 F;  2M5W A;  1CF7 B;  1QNT A;  2FRH A;  5E1X A;  2WC2 A;  2ZNZ A;  2CSO A;  1IXC A;  4OOI A;  1EV7 A;  2QBY B;  1P92 A;  2RGV A;  3R60 A;  3RPU A;  3ERE D;  2FXA A;  4NHJ A;  2MH9 A;  2DPD A;  2LDU A;  1B9N A;  2IRF G;  4LG0 B;  5ED4 A;  2KKO A;  2VOO A;  2FSW A;  1Z91 A;  2K27 A;  1H9G A;  1KU3 A;  4KYW A;  3F23 A;  5LHG A;  3IKV A;  4LLL A;  3GO5 A;  1HKQ A;  1MJ9 A;  4S04 A;  4ENK A;  1REP C;  4KIB A;  3LAJ A;  2ZJ2 A;  2Z5U A;  5CLS A;  2QYO A;  3F22 A;  2BE5 F;  2G7U A;  2P5V A;  3WTU C;  4U0V A;  3L09 A;  1BC8 C;  1G3W A;  2OBP A;  1BM9 A;  1KA8 A;  1W5S A;  1YW9 A;  2VON A;  5H6R A;  3C1D A;  1FPQ A;  3WTT C;  2F5E A;  2DW4 A;  3P9C A;  5DD4 A;  1SFX A;  3HSF A;  2JRT A;  4PGG A;  3V4G A;  4M73 A;  4HX4 A;  4G9Y A;  1KU2 A;  1FZP B;  3TOA A;  5LHH A;  4HV5 A;  2A6E F;  1RZ4 A;  4NQW A;  2GXB A;  4EM2 A;  1BJA A;  5AIQ A;  5L3C A;  2IA0 A;  1ZHF A;  5FFX A;  1B59 A;  3ZMZ A;  5LLQ A;  3KE2 A;  4I0B A;  2ZCW A;  4BQA A;  4RB2 C;  2QZ8 A;  2V6C A;  3EYY A;  3T8R A;  4Y17 A;  1SD5 A;  2E1C A;  1QZY A;  5BPD A;  3E6D A;  3WTV C;  3F72 A;  4EVI A;  4EJT A;  2PG4 A;  2V9V A;  4XSX F;  1YW8 A;  1IUY A;  5DCF A;  1QBJ A;  3QRF F;  3IHU A;  3IWZ A;  5DD8 A;  2EJR A;  4MEY F;  2W84 A;  1IN6 A;  2MA3 A;  2PN6 A;  3QP5 A;  4HDU A;  4HBL A;  2DFI A;  4IRI A;  4WCG A;  3MZY A;  5A2Q K;  5HDN A;  4A2U A;  2B0L A;  4ZYG A;  4ENN A;  1FYK A;  4YFN F;  3I0T A;  4A5N A;  1LEB A;  1A04 A;  2CQK A;  2PJP A;  4BYY A;  5LGU A;  5ICC A;  3JTG A;  4M9S A;  4NB5 A;  3I59 A;  3IKT A;  3J7A O;  3T8T A;  3L9F A;  3LQR A;  1W7P B;  1CGP A;  4EJW A;  3R6S A;  3QU3 A;  3AAF A;  1QO0 D;  1XGO A;  1FYL A;  2FQ3 A;  1BOA A;  2HKO A;  1KQ0 A;  2QM3 A;  4EM1 A;  2V1U A;  2RN7 A;  1U78 A;  5H20 A;  1YQA A;  1IAW A;  3KP7 A;  1JGS A;  3MAJ A;  5FB2 A;  4WWC A;  2IVM A;  5E17 F;  2FML A;  5H6Q A;  4GO1 A;  5CYV A;  2FBH A;  4MQ9 F;  3DXJ F;  4XLN F;  1J75 A;  4M72 A;  1QGP A;  3BRO A;  3HYI A;  4L9T A;  2EA2 A;  1MDM A;  1YIO A;  3S2W A;  4AWX B;  1BI1 A;  1B4A A;  1HST A;  1PDN C;  2NNN A;  2L54 A;  1X3U A;  1OPC A;  1STZ A;  2VE8 A;  3D5L A;  5D6E A;  2WWY A;  2QUF A;  1OR7 A;  5BPI A;  4LJZ F;  2H27 A;  2PLY A;  1I6X A;  3J80 Z;  1TQP A;  4TV7 A;  2HDC A;  1I1S A;  5CVV A;  1BI3 A;  2GA1 A;  4UV8 A;  2DO7 A;  4LLG F;  1U3E M;  4ZYE A;  4FT8 A;  2FNA A;  4OIN F;  3ROU A;  3FMR A;  3H3U A;  3ABU A;  3E5Q A;  5L3D A;  3HSR A;  2ELH A;  4RAZ A;  4L9N A;  2A3S A;  3RKY A;  3SQN A;  4GYG A;  1I1G A;  3HHG A;  4MQV A;  1E2X A;  2JSC A;  5D4R A;  1HBX G;  4BAY A;  2HZT A;  4P96 A;  3K1N A;  3DV8 A;  3VOD A;  3FMQ A;  4BHP A;  2O6G E;  2ESH A;  1I27 A;  1PUE E;  1ZH5 A;  4MHG A;  3GLX A;  3K1M A;  2F2E A;  1D3Y A;  2RNJ A;  5DV5 A;  4UVA A;  2L4M A;  4BNC A;  2A07 F;  4KMF A;  2AS5 F;  3JAM K;  4IRH A;  1S7A A;  3E6M A;  3I53 A;  2VOP A;  1HW5 A;  1YS6 A;  1XCB A;  3DPL C;  3MFK A;  3M9A A;  1GXQ A;  1J59 A;  4UV9 A;  3R4K A;  2RVC A;  1ZG1 A;  1P2F A;  3G3Z A;  4I01 A;  2QQB A;  4EJV A;  2STW A;  1IW7 F;  3SZP A;  4I2O A;  1S3J A;  3D0S A;  2L4A A;  4FX4 A;  3QU6 A;  4IF4 A;  5HLG A;  1O57 A;  4FHT A;  2GIV A;  1FOK A;  4I02 A;  3CTA A;  2BGC A;  1U2W A;  2CYY A;  3WU0 A;  1IF1 A;  3N4M A;  1MJB A;  2A5Y B;  3KET A;  1S29 A;  2K02 A;  1RUN A;  4XRF A;  2DU9 A;  4OU0 A;  1LB2 A;  2O03 A;  3BWG A;  5DYM A;  1K79 A;  3U1D A;  1FY7 A;  3V8L A;  2R3S A;  3BDD A;  4A12 A;  2DK5 A;  3TDU C;  2CWE A;  1IN8 A;  4L0Y B;  2R7D A;  2PMU A;  4O3M A;  5LHI A;  4OMZ A;  1R23 A;  3E5U A;  3JW4 A;  1WI9 A;  2IA2 A;  4AD9 A;  2DLL A;  5L3E A;  5F1R A;  5HOO A;  4YII A;  1ZLK A;  2W25 A;  2DBB A;  5E8I A;  4CIC A;  1UST A;  3VEP A;  1LEA A;  1H0M A;  3VFZ A;  3C7J A;  3GYH X;  2RDP A;  1LJ9 A;  2X0L A;  1DUX C;  3K69 A;  1WSU A;  2VXZ A;  4XSZ F;  4EJU A;  3KP2 A;  3TKY A;  3K9T A;  2ZME B;  2FF4 A;  2HWV A;  4JK1 X;  3WTW C;  4P9F A;  2Y48 A;  3I4P A;  3ZMD A;  1MDM B;  4JBA A;  4DQ2 A;  4R1H A;  2DQR A;  4PDK A;  2M30 A;  2KIF A;  1ODD A;  3DF8 A;  2KIM A;  1Z1D A;  3V8K A;  1YLF A;  2QLZ A;  4CO8 A;  1T0F A;  4A0Z A;  1RNL A;  1Z9C A;  5FGM A;  3WE3 A;  3HRM A;  1SFU A;  2Z9O A;  3IL2 A;  5EEG A;  3MWM A;  2DT5 A;  3GW2 A;  2W24 A;  3QAH A;  3KP5 A;  2EK5 A;  2IW5 A;  4OIP F;  1FT9 A;  2RC4 A;  4B09 A;  3GFI A;  2KJB A;  4S05 A;  2LKP A;  2PBI A;  1O3R A;  3LA3 A;  2EFN A;  5ERI A;  2M8E A;  4L5I A;  2EV6 A;  4HLX A;  1XGM A;  4AIH A;  5F64 A;  1IRG A;  2COM A;  1K78 A;  1BC7 C;  2P5K A;  2IP2 A;  2AXL A;  5IT9 Z;  3RIR A;  4K2E A;  4KN4 X;  4P5O A;  3COA C;  1BN5 A;  2MBF A;  2K7L A;  5ICF A;  2V79 A;  1EH8 A;  2O3F A;  4CGZ A;  2VC1 A;  3B73 A;  1R58 A;  3TO9 A;  1HSJ A;  4HF1 A;  3G73 A;  1XD7 A;  4OMY A;  2FNP A;  5DDG A;  5DUK A;  4N9H A;  1HKT A;  1GHC A;  4YIF A;  2O8X A;  3F8B A;  1IRF A;  3RTR A;  4EGZ A;  1R00 A;  2PQ8 A;  1JHH A;  3FX3 A;  1L3L A;  1HKS A;  2P6T A;  4OIQ F;  1W4M A;  3JSP A;  3ZP5 A;  1IN4 A;  4M9Z A;  6PAX A;  1SMY F;  4RB1 A;  4EGY A;  4YFX F;  4Y15 A;  4P9U A;  4KUM A;  4Z2Y A;  2LF7 A;  4OIO F;  1GVJ A;  3ISP A;  2YX4 A;  2Z33 A;  1J5Y A;  1UHM A;  4GCV A;  1OKR A;  2FOK A;  3C3W A;  2UXN A;  3R61 A;  1K7A A;  3V7S A;  2HOE A;  1G6N A;  3O6B B;  3HTU A;  2HS5 A;  3GZ5 A;  1H9T A;  5AIP A;  4LFU A;  2XRO A;  1MJA A;  4N9I A;  4R8H A;  3VB2 A;  1ZRC A;  2A69 F;  3F6O A;  1ON2 A;  2ESN A;  4P55 A;  3RPQ A;  2DAO A;  2EB7 A;  3TDZ C;  2V1X A;  1UCR A;  4YFK F;  1XCV A;  3WTY C;  1XN7 A;  4I7H A;  1FYM A;  4RB3 C;  2EV5 A;  2UXX A;  2XKP A;  3W6K B;  2W57 A;  1ON1 A;  1KU9 A;  5ILV A;  3GEZ A;  4LLN A;  2G9W A;  1JE8 A;  1RIO H;  1V3F A;  1R5H A;  1FX7 A;  3CDH A;  3GVA A;  4E70 A;  1XSD A;  1XMA A;  1MZB A;  5ILU A;  4XBF A;  4HF2 A;  2YSR A;  4M71 A;  2LF8 A;  3HOS A;  4HAM A;  3T0Y A;  4ENM A;  5LEK A;  2EFO A;  1ZRD A;  2CGP A;  2VBW A;  4OIR F;  4RB0 A;  3BPV A;  4GGG A;  4L0Z B;  1FP1 D;  2OAZ A;  4ESF A;  4CHU A;  3M1E A;  1XDU A;  1FLI A;  2OQG A;  2RKH A;  2UZK A;  1ZYR F;  3BJO A;  3JSO A;  2XAJ A;  1Z6T A;  2FA5 A;  1XGS A;  2MLG A;  5BMZ A;  1OYI A;  3E6B A;  3P7N A;  2Y75 A;  1K78 B;  4WXH A;  1YYV A;  1U5T C;  3KLN A;  1YS7 A;  1F5T A;  1J2X A;  1P4A A;  4LB5 A;  3CUQ A;  3E3V A;  2M1B A;  1LDD A;  4MNU A;  4JQF A;  4ENJ A;  4PZJ A;  3GFM A;  2MD5 A;  3P9I A;  1O3T A;  3GZ6 A;  2UWM A;  1U5T B;  1T39 A;  5DCM A;  3QOP A;  1TW3 A;  5CVU A;  3EQL F;  2ACJ A;  5K5O A;  3ZMV A;  1ZG3 A;  3KEO A;  1Z7U A;  2BBY A;  1TW2 A;  2XVC A;  4M9X A;  4HX7 A;  5EEH A;  5JVT A;  3F21 A;  2YU3 A;  4G7O F;  3BY6 A;  1O3S A;  1YW7 A;  4KMU X;  1NHA A;  3ECO A;  4UUV A;  2NNY A;  5HVQ C;  3V7R A;  5K5R A;  4UNO A;  1FBQ A;  3KEQ A;  2DPU A;  1V4R A;  1BI0 A;  2GAU A;  3IRQ A;  4G7H F;  1FP2 A;  3Q5F A;  1MGT A;  2VT3 A;  2GWR A;  4O5V A;  5K5Q A;  4ZYD A;  4RGU A;  5K1Y A;  4I98 B;  4ON0 A;  1WQ2 A;  3HUG A;  3EDP A;  2P7V B;  3WTX C;  1W7P D;  1WWX A;  3J80 K;  5J8C A;  2CFX A;  5DEQ A;  1BIB A;  1R5G A;  5E1W A;  1S7O A;  2KIU A;  3PQK A;  4LMY A;  2XUB A;  5J6X A;  5IT3 A;  2BYV E;  5FO5 A;  1XDS A;  2XHK A;  3DPT A;  3V7C A;  2P8T A;  2OU2 A;  3HHH A;  2QQA A;  3FM3 A;  2CW0 F;  3K2Z A;  4IXA A;  4H0E A;  4UXN A;  4ESJ A;  2IJL A;  2RV8 A;  2M87 A;  4HA8 A;  2D2W A;  4RS8 A;  1B9M A;  5E18 F;  2F5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...