1W4TA

X-ray crystallographic structure of pseudomonas aeruginosa arylamine n-acetyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
277
Chain Sequence
HMTPLTPEQTHAYLHHIGIDDPGPPSLANLDRLIDAHLRRVAFENLDVLLDRPIEIDADKVFAKVVEGSRGGYCFELNSLFARLLLALGYELELLVARVRWGLPDDAPLTQQSHLMLRLYLAEGEFLVDVGFGSANPPRALPLPGDEADAGQVHCVRLVDPHAGLYESAVRGRSGWLPLYRFDLRPQLWIDYIPRNWYTSTHPHSVFRQGLKAAITEGDLRLTLADGLFGQRAGNGETLQRQLRDVEELLDILQTRFRLRLDPASEVPALARRLAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Expression, purification, characterization and structure of Pseudomonas aeruginosa arylamine N-acetyltransferase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords Arylamine N-acetyltransferase
total genus 87
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 1w4tA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 1w4tA01
1W6FA 1GX3A 3LTWA 2VFCA 1W4TA 4B55A 4C5PA 1W5RA 2VFBA 4GUZA 3D9WA 4NV7A 4BGFA 2BSZA 1E2TA 4NV8A
chains in the Genus database with same CATH superfamily
1UREA 1N43A 1KL4A 2AVIA 3GE2A 1DZPA 2WQ9A 2LBVA 1HN2A 3B2JA 3AUMO 4AZRA 2AT3X 1HXZA 2GH7A 5FENA 3I0AA 1LCZA 4I3CA 4DQ3A 1QY0A 4AZOA 2RTEB 1RSTB 3NQ3A 2DJGA 4A60A 4ID2A 1MM9A 1Z24A 4ZCBA 4FBVA 3TGCA 1VWQB 1KQWA 4O49A 3SZIA 1I9HA 1ZNGA 2IZBA 2QO4A 3APUA 3O22A 4QZUA 1EALA 4YCHA 2OYBO 4HPCA 3I17A 2OY1O 4FGIB 4CDFA 1SLDB 3WZQA 1LDOA 3NPOA 1WBIA 5F1EA 1SY3A 1BLRA 4ORRA 2POAA 1KL3A 1KFFA 2GTLM 1E2TA 3PEDA 4QYPA 2GTLN 2A0AA 1QFVA 1SWDA 4TKJA 4QYNA 5FFHA 4RUUA 3PK2A 2KT4B 5B27A 3G7XA 4I60A 4R0BA 2BT9A 4TLJA 2RTCB 1MX7A 5FQ8E 3AKNA 5CHKA 2RTIB 4XMGA 2RCQA 4EEJA 2A2GA 4JNJA 3T6FA 1ADLA 3BX7A 1ICMA 3EMMA 4ORWA 4I6SA 2QOMA 2Y3EA 3B2IA 3PPTA 4LQZA 2DM5A 3BLGA 4GZVA 1HQPA 1EXSA 4NLJA 4AZNA 4TJZA 2Q4NA 3SLJA 5B5FA 2QMIA 4ML7B 4BOEA 4ZFXA 1CBQA 1MK5A 4FQBB 4Y0RA 4ZHFA 1AELA 1BBPA 1JJUA 1SWAA 1SWQA 3FELA 4IBAA 4IAWA 1EW3A 5EPQA 1NP1A 2RTHB 1KZXA 1ERBA 2A5CA 4GKCA 3WJFA 1KT6A 3CBSA 3CR6A 1IFCA 3DTQA 1DC9A 4GNWA 3T6LA 3WJBA 4Z28A 2AT8X 4MVIA 2QO6A 1JMXA 1MOYA 3EW1A 2QO5A 2XKLA 4GJSA 5IO7A 1ZNLA 4O4SA 2AT0X 3BS2A 2DJFA 3FEPA 3WOVA 1PM1X 3NQ9A 5IRAA 5HZ9A 5JR8A 1X89A 4Y59A 2BS6A 1RBPA 2OL6O 4WBKA 4BX7B 2AKQA 3EYCA 5H9AA 2HZRA 3SZHA 4GE1A 1KT4A 1STRB 4O9SA 5HCCC 1NQNA 4KT5A 2R74A 5LJDA 1PMPA 4Z2PA 4RUNA 3C77X 1I06A 3KFIA 4I95A 4KCAA 5LJKA 5CYBA 1KT7A 2FHNX 3STNA 3VE2A 2IJAA 2GTFX 4ORUA 5FQ6E 1AVDA 1N4JA 2X8FA 4ALOA 3P6FA 1SWOA 3KFGA 1L6MA 4PJ2A 1OBQA 3RWXA 4ZGFA 2MF6A 3B2LA 4GGTA 1LNMA 3WYQA 1O1UA 2IZIA 4ODDA 3HPEA 4IAXA 4FBOA 1VWEB 5EDBA 1DZMA 2JU8A 2XSTA 3APVA 3FENA 4KH8A 4NP1A 4ORXA 1BM5A 1X71A 4MVEA 1MVGA 1ZNHA 4ZH6A 3FW5A 1X8PA 3STKA 3O2YA 2C1QA 3FDCA 1OSPO 1FJ1E 3RDOA 3FA6A 2G7BA 3WXQA 2VDFA 2UYWA 2W2AA 5KHPA 5H9NA 2OVAA 2P8GA 4ALBA 4DNEA 2OY7A 2AT6X 1GKAB 3VU1A 1CJ5A 1IW2A 4MVLA 4DMOA 4EQAC 2A5BA 4LKTA 4ARHA 3MVFA 4BX5A 1BRQA 5FAZA 3TGAA 4IB6A 3KFFA 4CDDA 4TQ2A 3EBWA 5H8TA 4CPIA 4FBRA 1R0UA 2WR6A 1N9YA 1Y9LA 3Q6LA 2AMMX 1KT5A 4HPBA 5KICA 1B56A 1SY0A 2RTGB 1AQBA 3RDMA 1X8UA 2VFBA 4KIIA 1K3BA 3P6GA 4NW4A 3TGBA 2AT5X 1SY2A 3FEKA 3NQKA 4IB9A 3WZOA 4D6AA 1W5RA 2HKDA 3C76X 4XMHA 1SXWA 3K3LA 4GJVA 4Y0QA 2I5VO 2G79A 1G74A 1JJXA 1SWNA 3RDXA 4QQ1A 4HWMA 4O3ZA 1FELA 3P6DA 4JHQA 1SA8A 5IO5A 1NGLA 1STSB 2F01A 2L68A 2OZQA 4JO6A 5D4AA 3GAQA 4GK9A 2QOSC 2IFBA 1LUQA 1ZRYA 4U8UM 3WJEA 2JW1A 4L1NA 2CBSA 3HWFA 1T68X 4BBOA 1QY1A 2L5PA 2AL0X 1DFVA 4GH7A 5EEDA 1CRBA 1EPAA 5K06A 2LKKA 1SRFA 2MM3A 2BS5A 5B10O 2Q39A 3VG4A 3C78X 5CSEA 2KTSA 4OS8A 1VYFA 1JJJA 2M4LA 3RY2A 1KT3A 1TOWA 2Q2MA 3HOLA 3IFBA 3RDUA 1NQMA 2MO5A 5HA1A 5K67A 2K23A 2BSZA 3HTYA 5EDCA 4NV8A 5K68A 4CDCA 1IFBA 3SLTA 1DZJA 5IRUA 1T0VA 4ORSA 4C5PA 4TKHA 1Y53X 3D96A 3T1DA 3ZQ3A 3FA9A 5BVTA 4PSQA 1SLFB 2HNXA 4IMNA 4D6BA 2GJ5A 1GX3A 2OY8A 4B55A 1GT1A 4XMEA 1SWGA 1SXUA 4GGZA 4O4UA 3WVMA 1SWRA 1I78A 1N9MA 1MX8A 1UYOX 3OJYC 1ZNDA 1BSOA 3O19A 4CSBA 1Y0GA 5HTEA 5B3MO 3S26A 1FENA 3UEUA 2WEWA 3RSWA 4O4XA 5LJHA 4ZHCA 1G5WA 3PH5A 3WJCA 5L8OA 1SXYA 2EU7X 1VWCB 3VHHA 1E06A 1DV9A 3ZI8A 3WBGA 1W6FA 2IZKA 2IZJA 2Z4IA 3HWEA 1A18A 4I3BA 4WFVA 5HZQA 1GT4A 2WEXA 3ELZA 5LJEA 4QGWA 1STPA 1SXXA 5B29A 4N7DA 1X8OA 2RTBB 1SRGA 1GX9A 1G7NA 1FTPA 3B2HA 1OEEA 4NV7A 5F7GA 2LA7A 5CE4A 1EIIA 3OBLA 1VWDB 2OVSA 4KC7A 1DF8A 2A13A 3ZW2A 4DCBA 2FGSA 3E3CA 3FIQA 4GDZA 5F58A 4OS3A 1AVEA 1QFTA 2AF5A 3EBKA 3BDRA 2OVEA 1TW4A 5F6ZA 4NLIA 1SWUA 1O8VA 1LICA 4HFOA 2RTFB 1S44A 2RTJA 2FHLA 3CBCA 2MWHA 3BY0A 1GT5A 1LPJA 4GETA 4EDEA 1U18A 2LFOA 4MIRA 3X00A 2IZAA 3P24A 3FMZA 3KZAA 4YH0A 4CDEA 1IKEA 1MDCA 2BLGA 3EW2A 3NX1A 4CPFA 4ES7A 4WHIA 4BX5B 3RZYA 2NNQA 1B4MA 4M7MA 2UZ2A 1UZ2X 4YDBA 4NYRA 1SRHA 2NNDA 4BCSA 3L4RA 4EFGA 1AB0A 3V8UA 3U0DA 2JMBA 4TNNA 1QG5A 3RE6A 3PQUA 4BQUA 1SLGB 2VFCA 3RDSA 1AVGI 2RQ0A 4OS0A 4BX7A 1LCWA 4ZH9A 1CBIA 2YMSA 4Y0PA 3QKGA 1YWCA 2FLJA 4QZTA 1U0XA 1XCAA 2JU3A 3WZPA 2F73A 1GT3A 1A3YA 3WJDA 4DQ4A 3VG7A 5HCDC 1PTSA 2K62A 2FRSA 1FDQA 4QRLA 1W4TA 2MHDA 2X45A 3SLOA 4YGGA 2Y32A 3KQ0A 1SWTA 2RCTA 1VWGB 1BEBA 1RAVA 3DSZA 4GD9A 1HMSA 4U9CA 4ZR2A 1VWIB 3HWGA 5EZ2A 3N91A 4IRWA 5H9LA 3VGWA 3H3IA 2FR2A 4WFUA 4CPEA 4CPHA 2FKJA 3BU9A 1DF3A 1IJ8A 3QQ2A 2OFRX 3D9WA 1EUOA 5AJCA 3ZZVA 1SWEA 2I5ZO 3AKMA 3VHIA 1SWJA 2ZAIA 3U9PC 1SRJA 1Y55X 5AJBA 1ALBA 1BSYA 2X34A 4OMXA 3IA8A 1SWHA 1RSUB 2NP1A 2RTLA 4O3XB 1VYOA 1U17A 1RXKA 4O4OA 2G8CO 5DG4A 3RDQA 2F09A 3Q34A 3ZWEA 4BJ8A 1VWHB 2HZQA 1JBHA 3EC5A 2L67A 4AZPA 2E4JA 5HBSA 1DZKA 3BU1A 3B2KA 4U46A 3LTWA 1QQSA 1SWBA 3CMPA 4YBUA 1CBSA 1SWFA 2C1SA 4TKBA 4XMFA 5C0NA 4Z27A 1EPBA 2FS7A 2IZFB 5HCEC 2KTDA 1PBOA 3D4RA 5DPQA 4JGLA 1ZNKA 4YFQA 2ALLX 3APWA 4HPDA 4IMOA 5LJCA 1YWDA 5HA0A 3SOTA 1BJ7A 1QY2A 2PY1A 1B8EA 2HLVA 2N93A 3PQSA 3RBYA 4NYQA 3S60A 3STMX 5IRWA 2RTKA 2ZSCA 2G5LA 1T8VA 1VWAB 2BHVA 3FW4A 4YFPA 3FR4A 3T2WA 3WZNA 5AEOA 1BWYA 2X8TA 1SMPI 4CPHB 3F6ZB 2WWPA 2RTPB 3PP6A 4LZVA 3VG6A 4CK4A 3VPJE 2L9CA 1GX8A 1PBYA 3JSQA 2A3FX 1JIWI 3HK1A 4YBPA 3SAOA 3TF6A 5LKFA 5BYPA 3AEHA 2Q2PA 4GU8A 2RTNB 1A57A 3D97A 3TZSA 3P6CA 2Z4HA 5HAEA 4ON1A 3MM0A 3HWDA 2R56A 2GTLO 1ICNA 5F2BA 1I05A 1MUPA 5BVQA 4AW8A 2IZHB 4GUZA 5EEEA 3UEXA 5HZ8A 2RTRB 3NADA 3BX8A 2ACPX 2LB6A 3F8AA 3VG5A 4O3YA 5L8NA 4MEEA 1K24A 3ZUOA 4Z2VA 1GGLA 3SZJA 3VG3A 4YMYA 2HMBA 3FA7A 2O62A 1SWSA 1VWFB 2GC9A 2X4MA 3FLLA 2OVDA 2HYSA 1D3SA 2LBAA 3VHMA 1EIOA 2RTOB 1HY2A 3OD9A 2OY5O 2OFMX 3EM0A 1OPBA 4U8UO 1E00A 1SWCA 1JMZA 3NX2A 2RN4A 4OMWA 1FEMA 4IABA 3WJGA 2OF9A 1QWDA 3ELXA 3LV4A 4YKOA 2IZLB 5B11O 5KIDA 4YGHA 2W2BA 4YDAA 2OL7A 2JN3A 2WSJA 3CKGA 4U8UN 3RKGA 1LCVA 4GDAA 4QNIA 1NP4A 1YP6A 4KC8A 2CZTA 4U3QA 1JQPA 4ZHHA 3OE3A 1SY1A 4OELA 4OKAA 4NNTA 1OEJA 1SREA 2ANSA 3CKFA 2X55A 4BVMA 1O1VA 2A2UA 3MG5A 1FE3A 1GM6A 1HMTA 4XMDA 3HOEA 4A8ZA 4YCEA 2JU7A 5D8JA 1RLBE 4NNSA 2RTMA 1QABE 1LKEA 1YWBA 1KOIA 2YG2A 2KD2A 4A1YA 3CQNA 1VWBB 1OBUA 1G85A 4MVKA 5B5GA 4Z6JA 1TVQA 1VWRB 5HTDA 1HQQA 2R73A 2X32A 3CWKA 1LIBA 4HPAA 4I3DA 4K19A 1YIVA 3PDFA 3S5VA 1SWLA 3JS1A 1PEEA 2OF8A 2X8SA 1VWNB 2IZDB 2ACOA 4OEMA 1P6PA 1IIUA 2JOZA 2QM9A 2IZEB 5BVSA 2RTQB 4GNYA 3CQRA 4QGXA 3MBTA 1KGLA 1OEKA 1SWKA 5AQ6A 1JYDA 1GKAA 1IKJA 1NC9A 1YP7A 2A8GA 2WUTA 4YKMA 2FT9A 1Y9TA 5IO6A 1ERXA 1NDJA 3KVNA 3P6EA 5LKEA 3UEWA 1KL5A 1LIDA 4LZUA 5D48A 1SWPA 1VWJB 2WQAE 4L3RA 2FR3A 3RE5A 1VWPB 1MEPA 2CM9A 1ML7A 4IB7A 4BX6B 2PFRA 1JV4A 4EXZA 3LHNA 4YFRA 1HBPA 1SRIA 3JQOA 1LIFA 4CV7A 1HBQA 3NP1A 3VE1A 4COTA 2RD7C 2CZUA 1OBPA 2IZGB 3F9DA 2NNEA 3FR5A 1VWMB 4LKPA 3NBXX 2OFBA 4QAEA 1KXOA 1KZWA 1LIEA 3FR2A 4GGRA 5H9KA 2CM4A 3KFHA 4I9RA 5LJGA 3BRNA 1D2UA 1Y52X 1UYNX 2ASNX 4ZHDA 3LNBA 2WPUA 1X8NA 2AH7X 1EQDA 1A2DA 1NBXA 2CBRA 4MISA 3FIDA 3P6HA 2RA6A 5JD2A 3RY1A 2FWVA 3PECA 1XKIA 2X46A 4GRJA 4ORYA 4M6SA 5D47A 2FKGA 3ZUIA 2ZAGA 4AYHA 2FTBA 4ZJ0A 4IB8A 4INNA 1VWLB 2C4IA 5HWZA 1I04A 1LDQA 1HMRA 1OPAA 1VYGA 4I9SA 1ZNEA 3U03A 3VG2A 4XMCA 2OFAA 1WUBA 1LFOA 3UAQA 1SLEB 1JZUA 2G78A 1BRPA 3UEVA 4BGFA 4N7CA 1RXHA 2Q9SA 5IXGA 2BC3A 2JGSA 5F6BA 3T2XA 1S7DA 4YVBA 4UU3A 2RTDB 5HZ6A 3MX7A 4O3WA 1GXAA 1X8QA 5L8IA 4YGZA 1VWKB 1HXLA 3D95A 3BSZE 5HZ5A 1S2PA 4Y0SA 4ZHGA 5B2AO 2FS6A 2QCBA 1VWOB 1N0SA 3APXA 1E5PA 2PQTA 3ZW1B 2OL8O 1N7YA 2Y3FA 1VPRA 5LJBA 2KW1A 2IZCB 5FQ7E 4A1HA 3S5XA 4AZMA 1E02A 1JYJA 4Y5DA 4EKVA 4Z2OA 2CAMA 3PH6A 3WYPA 1CBRA 3ZW0A 3FYFA 5L3YA 1LF7A 3P02A 1LELA 1YWAA 5D45A 3ZW1A 2RTAA 4QGVA 3FA8A 1TOUA 1B0OA 1YUPA 1KQXA 1ACDA 1RXJA 2PI3O 2W2FA 1EI5A 2X56A 1BSQA 1H91A 4UU2A 4BX6A 4ZGUA 4AZQA 1I4UA 2MJIA 3ZW0B 1TXLA 3NR3A
chains in the Genus database with same CATH topology
8PCHA 5J94A 2IBIA 4DMYA 3PBHA 2CIOA 1U5IA 1HUCB 1EWMA 1K3BB 2JQFR 3P5WA 1GMYA 1CJLA 1MEGA 2P0RA 2XU4A 4QRVA 1E2TA 2PNSA 1AECA 9PAPA 3BCNA 4HWYA 2BDLA 1YALA 2PBHA 1AU0A 1PPDA 4MZOA 2DCDA 4FK5A 2R9FA 4MSXA 3IOQA 1VJVA 4I07A 4XUIA 1S4VA 3WXEA 1PPNA 3BC3A 3H6SA 3IUTA 1U9WA 1AYWA 3QSDA 4YYUA 2E02A 1YK8A 3P5VA 3F5VA 2HD5A 4P6EA 3LFYA 2DZYA 1KFXL 4PP1A 3BPMA 3KWBX 1ATKA 3P5UA 2R9OA 4BQVA 2NQAA 5FPWA 2G6DA 3N3GA 1NPZA 3USVA 4Q8GA 1GCBA 1EWLA 1PBHA 2PREA 4PP2E 2ACTA 4FJCA 3RVVA 1MIRA 2ATOA 3HHIA 4QH6A 4CDEB 1DEUA 2OP3A 3B79A 1XKGA 2HXZA 1PXVA 3I3TA 4P6GA 1AU3A 2GHUA 1CS8A 3H8BA 2VFBA 3C9EA 1PIPA 2AYNA 1W5RA 3MORA 2F1GA 1Q6KA 2XU1A 1SNKA 3OVXA 1FH0A 1CSBB 3LXSA 1KHQA 3RVXA 1SP4B 4YV8A 2E01A 4X6IA 1F2BA 1THEA 3IHPA 2OULA 4K7CA 1CB5A 4YYSA 4PI3A 2ARYA 2E00A 2FUDA 3AI8A 1ME4A 3GCBA 1Y4HA 4X6HA 3O0UA 2BSZA 4NV8A 4QBBA 4C5PA 3N4CA 1STFE 2Y6EA 3QJ3A 1GX3A 4B55A 3NHEA 2NQGA 3DF0A 2CB5A 3TNXA 4W5CA 2B1NA 1U9XA 2PADA 1GLOA 3QT4A 5JA7A 1W6FA 3O1GA 3I06A 2AIMA 5PADA 7PCKA 3H7DA 3MTNA 1BQIA 4G54A 2YJBA 1NB5A 4NV7A 2JQGR 3CBJA 1X9YA 3HWNA 1EWOA 2R9CA 2IPPB 2G8EA 3IV2A 1NLJA 4W4UA 3E1ZB 2FYEA 3KSEA 2DC8A 1BY8A 1PCIA 2AVWA 1U9QX 3WXGA 2VFCA 3KFQA 1Y08A 5CHVA 3KWZA 2HH5A 3H89A 1IWDA 4PADA 2DCCA 5CHTA 1QDQA 1AYUA 3WXFA 4WA6A 3U8EA 1TL9A 1W4TA 2XU5A 4BPVA 1KFUL 2VHFA 2VHSA 3V6EA 3S3RA 2FQ9A 1ITOA 3D9WA 1MS6A 2C0YA 1BGOA 4AXMA 1YVBA 3S3QA 2WBFX 4YYVA 5A24A 2DC6A 3LTWA 5EGWA 2FT2A 2G8JA 1VSNA 3KX1A 3K24A 4YYQA 4YVAA 2P7UA 4CDFB 4BSQA 4RY2A 1F29A 2B1MA 1MDWA 5CVMA 1YT7A 4XR7A 1QMYA 3K9MA 2FO5A 1POPA 1ICFA 2FTDA 2AYOA 3P5XA 1AU4A 2F7DA 1EWPA 3BPFA 5CVOB 1EF7A 1MHWA 2P86A 1BP4A 1KXRA 4QRGA 4GUZA 4MZSA 2HHNA 2OZ2A 1YK7A 1MEMA 1TU6A 1CQDA 1CPJA 4N79A 1AYVA 1CTEA 1NQCA 4N4ZA 3IEJA 3KW9A 5EF4A 2GFOA 1ZIVA 1O0EA 2G7YA 3CH3X 2XU3A 4W5BA 1NB3A 2DZZA 2Y5BA 1JQPA 2DCBA 2AUXA 4OELA 1M6DA 5F02A 4I05A 1PPOA 4KLBA 2AU1A 4N8WA 4CDCB 3OVZA 2DC7A 1A6RA 4Q8HA 1CV8A 2BDZA 1DF0A 4DMXA 3HHAA 3N3KA 5CVNB 1GECE 3M99A 4AXLA 1NL6A 1AIMA 5JH3A 2AS8A 3PDFA 2FRAA 4OEMA 5K16A 3D6SA 2NQIA 3KKUA 4ZUXU 4BS5A 3OF9A 3OF8A 2DC9A 2DCAA 4BS6A 4X6JA 1QOLA 1KHPA 2AUZA 4YYRA 3F75A 3K8UA 4QRXA 2DJFB 2E03A 3PW3A 4CZWA 2YJ9A 2O6XA 3ZUAA 1PPPA 2YJ8A 3H8CA 1F2AA 2YJ2A 2R9NA 2R9MA 1U9VA 2FRQA 3V6CA 3MHSA 3PNRA 2DJGB 3OISA 4FIPA 4BGFA 3HD3A 2YJCA 1ME3A 3MHHA 3RVWA 2H7JA 2NQDB 3IMAA 1TLOA 1CVZA 3BOWA 3CH2X 6PADA 4I04A 4YYWA 1PADA 2R6NA 3BWKA 3CBKA 1F2CA 1ZCMA 1AU2A 1QXPA 1PE6A 3ERVA 4CDDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6F A;  1GX3 A;  3LTW A;  2VFC A;  1W4T A;  4B55 A;  4C5P A;  1W5R A;  2VFB A;  4GUZ A;  3D9W A;  4NV7 A;  4BGF A;  2BSZ A;  1E2T A;  4NV8 A; 
#chains in the Genus database with same CATH topology
 1URE A;  1N43 A;  1KL4 A;  2AVI A;  3GE2 A;  1DZP A;  2WQ9 A;  2LBV A;  1HN2 A;  3B2J A;  3AUM O;  4AZR A;  2AT3 X;  1HXZ A;  2GH7 A;  5FEN A;  3I0A A;  1LCZ A;  4I3C A;  4DQ3 A;  1QY0 A;  4AZO A;  2RTE B;  1RST B;  3NQ3 A;  2DJG A;  4A60 A;  4ID2 A;  1MM9 A;  1Z24 A;  4ZCB A;  4FBV A;  3TGC A;  1VWQ B;  1KQW A;  4O49 A;  3SZI A;  1I9H A;  1ZNG A;  2IZB A;  2QO4 A;  3APU A;  3O22 A;  4QZU A;  1EAL A;  4YCH A;  2OYB O;  4HPC A;  3I17 A;  2OY1 O;  4FGI B;  4CDF A;  1SLD B;  3WZQ A;  1LDO A;  3NPO A;  1WBI A;  5F1E A;  1SY3 A;  1BLR A;  4ORR A;  2POA A;  1KL3 A;  1KFF A;  2GTL M;  1E2T A;  3PED A;  4QYP A;  2GTL N;  2A0A A;  1QFV A;  1SWD A;  4TKJ A;  4QYN A;  5FFH A;  4RUU A;  3PK2 A;  2KT4 B;  5B27 A;  3G7X A;  4I60 A;  4R0B A;  2BT9 A;  4TLJ A;  2RTC B;  1MX7 A;  5FQ8 E;  3AKN A;  5CHK A;  2RTI B;  4XMG A;  2RCQ A;  4EEJ A;  2A2G A;  4JNJ A;  3T6F A;  1ADL A;  3BX7 A;  1ICM A;  3EMM A;  4ORW A;  4I6S A;  2QOM A;  2Y3E A;  3B2I A;  3PPT A;  4LQZ A;  2DM5 A;  3BLG A;  4GZV A;  1HQP A;  1EXS A;  4NLJ A;  4AZN A;  4TJZ A;  2Q4N A;  3SLJ A;  5B5F A;  2QMI A;  4ML7 B;  4BOE A;  4ZFX A;  1CBQ A;  1MK5 A;  4FQB B;  4Y0R A;  4ZHF A;  1AEL A;  1BBP A;  1JJU A;  1SWA A;  1SWQ A;  3FEL A;  4IBA A;  4IAW A;  1EW3 A;  5EPQ A;  1NP1 A;  2RTH B;  1KZX A;  1ERB A;  2A5C A;  4GKC A;  3WJF A;  1KT6 A;  3CBS A;  3CR6 A;  1IFC A;  3DTQ A;  1DC9 A;  4GNW A;  3T6L A;  3WJB A;  4Z28 A;  2AT8 X;  4MVI A;  2QO6 A;  1JMX A;  1MOY A;  3EW1 A;  2QO5 A;  2XKL A;  4GJS A;  5IO7 A;  1ZNL A;  4O4S A;  2AT0 X;  3BS2 A;  2DJF A;  3FEP A;  3WOV A;  1PM1 X;  3NQ9 A;  5IRA A;  5HZ9 A;  5JR8 A;  1X89 A;  4Y59 A;  2BS6 A;  1RBP A;  2OL6 O;  4WBK A;  4BX7 B;  2AKQ A;  3EYC A;  5H9A A;  2HZR A;  3SZH A;  4GE1 A;  1KT4 A;  1STR B;  4O9S A;  5HCC C;  1NQN A;  4KT5 A;  2R74 A;  5LJD A;  1PMP A;  4Z2P A;  4RUN A;  3C77 X;  1I06 A;  3KFI A;  4I95 A;  4KCA A;  5LJK A;  5CYB A;  1KT7 A;  2FHN X;  3STN A;  3VE2 A;  2IJA A;  2GTF X;  4ORU A;  5FQ6 E;  1AVD A;  1N4J A;  2X8F A;  4ALO A;  3P6F A;  1SWO A;  3KFG A;  1L6M A;  4PJ2 A;  1OBQ A;  3RWX A;  4ZGF A;  2MF6 A;  3B2L A;  4GGT A;  1LNM A;  3WYQ A;  1O1U A;  2IZI A;  4ODD A;  3HPE A;  4IAX A;  4FBO A;  1VWE B;  5EDB A;  1DZM A;  2JU8 A;  2XST A;  3APV A;  3FEN A;  4KH8 A;  4NP1 A;  4ORX A;  1BM5 A;  1X71 A;  4MVE A;  1MVG A;  1ZNH A;  4ZH6 A;  3FW5 A;  1X8P A;  3STK A;  3O2Y A;  2C1Q A;  3FDC A;  1OSP O;  1FJ1 E;  3RDO A;  3FA6 A;  2G7B A;  3WXQ A;  2VDF A;  2UYW A;  2W2A A;  5KHP A;  5H9N A;  2OVA A;  2P8G A;  4ALB A;  4DNE A;  2OY7 A;  2AT6 X;  1GKA B;  3VU1 A;  1CJ5 A;  1IW2 A;  4MVL A;  4DMO A;  4EQA C;  2A5B A;  4LKT A;  4ARH A;  3MVF A;  4BX5 A;  1BRQ A;  5FAZ A;  3TGA A;  4IB6 A;  3KFF A;  4CDD A;  4TQ2 A;  3EBW A;  5H8T A;  4CPI A;  4FBR A;  1R0U A;  2WR6 A;  1N9Y A;  1Y9L A;  3Q6L A;  2AMM X;  1KT5 A;  4HPB A;  5KIC A;  1B56 A;  1SY0 A;  2RTG B;  1AQB A;  3RDM A;  1X8U A;  2VFB A;  4KII A;  1K3B A;  3P6G A;  4NW4 A;  3TGB A;  2AT5 X;  1SY2 A;  3FEK A;  3NQK A;  4IB9 A;  3WZO A;  4D6A A;  1W5R A;  2HKD A;  3C76 X;  4XMH A;  1SXW A;  3K3L A;  4GJV A;  4Y0Q A;  2I5V O;  2G79 A;  1G74 A;  1JJX A;  1SWN A;  3RDX A;  4QQ1 A;  4HWM A;  4O3Z A;  1FEL A;  3P6D A;  4JHQ A;  1SA8 A;  5IO5 A;  1NGL A;  1STS B;  2F01 A;  2L68 A;  2OZQ A;  4JO6 A;  5D4A A;  3GAQ A;  4GK9 A;  2QOS C;  2IFB A;  1LUQ A;  1ZRY A;  4U8U M;  3WJE A;  2JW1 A;  4L1N A;  2CBS A;  3HWF A;  1T68 X;  4BBO A;  1QY1 A;  2L5P A;  2AL0 X;  1DFV A;  4GH7 A;  5EED A;  1CRB A;  1EPA A;  5K06 A;  2LKK A;  1SRF A;  2MM3 A;  2BS5 A;  5B10 O;  2Q39 A;  3VG4 A;  3C78 X;  5CSE A;  2KTS A;  4OS8 A;  1VYF A;  1JJJ A;  2M4L A;  3RY2 A;  1KT3 A;  1TOW A;  2Q2M A;  3HOL A;  3IFB A;  3RDU A;  1NQM A;  2MO5 A;  5HA1 A;  5K67 A;  2K23 A;  2BSZ A;  3HTY A;  5EDC A;  4NV8 A;  5K68 A;  4CDC A;  1IFB A;  3SLT A;  1DZJ A;  5IRU A;  1T0V A;  4ORS A;  4C5P A;  4TKH A;  1Y53 X;  3D96 A;  3T1D A;  3ZQ3 A;  3FA9 A;  5BVT A;  4PSQ A;  1SLF B;  2HNX A;  4IMN A;  4D6B A;  2GJ5 A;  1GX3 A;  2OY8 A;  4B55 A;  1GT1 A;  4XME A;  1SWG A;  1SXU A;  4GGZ A;  4O4U A;  3WVM A;  1SWR A;  1I78 A;  1N9M A;  1MX8 A;  1UYO X;  3OJY C;  1ZND A;  1BSO A;  3O19 A;  4CSB A;  1Y0G A;  5HTE A;  5B3M O;  3S26 A;  1FEN A;  3UEU A;  2WEW A;  3RSW A;  4O4X A;  5LJH A;  4ZHC A;  1G5W A;  3PH5 A;  3WJC A;  5L8O A;  1SXY A;  2EU7 X;  1VWC B;  3VHH A;  1E06 A;  1DV9 A;  3ZI8 A;  3WBG A;  1W6F A;  2IZK A;  2IZJ A;  2Z4I A;  3HWE A;  1A18 A;  4I3B A;  4WFV A;  5HZQ A;  1GT4 A;  2WEX A;  3ELZ A;  5LJE A;  4QGW A;  1STP A;  1SXX A;  5B29 A;  4N7D A;  1X8O A;  2RTB B;  1SRG A;  1GX9 A;  1G7N A;  1FTP A;  3B2H A;  1OEE A;  4NV7 A;  5F7G A;  2LA7 A;  5CE4 A;  1EII A;  3OBL A;  1VWD B;  2OVS A;  4KC7 A;  1DF8 A;  2A13 A;  3ZW2 A;  4DCB A;  2FGS A;  3E3C A;  3FIQ A;  4GDZ A;  5F58 A;  4OS3 A;  1AVE A;  1QFT A;  2AF5 A;  3EBK A;  3BDR A;  2OVE A;  1TW4 A;  5F6Z A;  4NLI A;  1SWU A;  1O8V A;  1LIC A;  4HFO A;  2RTF B;  1S44 A;  2RTJ A;  2FHL A;  3CBC A;  2MWH A;  3BY0 A;  1GT5 A;  1LPJ A;  4GET A;  4EDE A;  1U18 A;  2LFO A;  4MIR A;  3X00 A;  2IZA A;  3P24 A;  3FMZ A;  3KZA A;  4YH0 A;  4CDE A;  1IKE A;  1MDC A;  2BLG A;  3EW2 A;  3NX1 A;  4CPF A;  4ES7 A;  4WHI A;  4BX5 B;  3RZY A;  2NNQ A;  1B4M A;  4M7M A;  2UZ2 A;  1UZ2 X;  4YDB A;  4NYR A;  1SRH A;  2NND A;  4BCS A;  3L4R A;  4EFG A;  1AB0 A;  3V8U A;  3U0D A;  2JMB A;  4TNN A;  1QG5 A;  3RE6 A;  3PQU A;  4BQU A;  1SLG B;  2VFC A;  3RDS A;  1AVG I;  2RQ0 A;  4OS0 A;  4BX7 A;  1LCW A;  4ZH9 A;  1CBI A;  2YMS A;  4Y0P A;  3QKG A;  1YWC A;  2FLJ A;  4QZT A;  1U0X A;  1XCA A;  2JU3 A;  3WZP A;  2F73 A;  1GT3 A;  1A3Y A;  3WJD A;  4DQ4 A;  3VG7 A;  5HCD C;  1PTS A;  2K62 A;  2FRS A;  1FDQ A;  4QRL A;  1W4T A;  2MHD A;  2X45 A;  3SLO A;  4YGG A;  2Y32 A;  3KQ0 A;  1SWT A;  2RCT A;  1VWG B;  1BEB A;  1RAV A;  3DSZ A;  4GD9 A;  1HMS A;  4U9C A;  4ZR2 A;  1VWI B;  3HWG A;  5EZ2 A;  3N91 A;  4IRW A;  5H9L A;  3VGW A;  3H3I A;  2FR2 A;  4WFU A;  4CPE A;  4CPH A;  2FKJ A;  3BU9 A;  1DF3 A;  1IJ8 A;  3QQ2 A;  2OFR X;  3D9W A;  1EUO A;  5AJC A;  3ZZV A;  1SWE A;  2I5Z O;  3AKM A;  3VHI A;  1SWJ A;  2ZAI A;  3U9P C;  1SRJ A;  1Y55 X;  5AJB A;  1ALB A;  1BSY A;  2X34 A;  4OMX A;  3IA8 A;  1SWH A;  1RSU B;  2NP1 A;  2RTL A;  4O3X B;  1VYO A;  1U17 A;  1RXK A;  4O4O A;  2G8C O;  5DG4 A;  3RDQ A;  2F09 A;  3Q34 A;  3ZWE A;  4BJ8 A;  1VWH B;  2HZQ A;  1JBH A;  3EC5 A;  2L67 A;  4AZP A;  2E4J A;  5HBS A;  1DZK A;  3BU1 A;  3B2K A;  4U46 A;  3LTW A;  1QQS A;  1SWB A;  3CMP A;  4YBU A;  1CBS A;  1SWF A;  2C1S A;  4TKB A;  4XMF A;  5C0N A;  4Z27 A;  1EPB A;  2FS7 A;  2IZF B;  5HCE C;  2KTD A;  1PBO A;  3D4R A;  5DPQ A;  4JGL A;  1ZNK A;  4YFQ A;  2ALL X;  3APW A;  4HPD A;  4IMO A;  5LJC A;  1YWD A;  5HA0 A;  3SOT A;  1BJ7 A;  1QY2 A;  2PY1 A;  1B8E A;  2HLV A;  2N93 A;  3PQS A;  3RBY A;  4NYQ A;  3S60 A;  3STM X;  5IRW A;  2RTK A;  2ZSC A;  2G5L A;  1T8V A;  1VWA B;  2BHV A;  3FW4 A;  4YFP A;  3FR4 A;  3T2W A;  3WZN A;  5AEO A;  1BWY A;  2X8T A;  1SMP I;  4CPH B;  3F6Z B;  2WWP A;  2RTP B;  3PP6 A;  4LZV A;  3VG6 A;  4CK4 A;  3VPJ E;  2L9C A;  1GX8 A;  1PBY A;  3JSQ A;  2A3F X;  1JIW I;  3HK1 A;  4YBP A;  3SAO A;  3TF6 A;  5LKF A;  5BYP A;  3AEH A;  2Q2P A;  4GU8 A;  2RTN B;  1A57 A;  3D97 A;  3TZS A;  3P6C A;  2Z4H A;  5HAE A;  4ON1 A;  3MM0 A;  3HWD A;  2R56 A;  2GTL O;  1ICN A;  5F2B A;  1I05 A;  1MUP A;  5BVQ A;  4AW8 A;  2IZH B;  4GUZ A;  5EEE A;  3UEX A;  5HZ8 A;  2RTR B;  3NAD A;  3BX8 A;  2ACP X;  2LB6 A;  3F8A A;  3VG5 A;  4O3Y A;  5L8N A;  4MEE A;  1K24 A;  3ZUO A;  4Z2V A;  1GGL A;  3SZJ A;  3VG3 A;  4YMY A;  2HMB A;  3FA7 A;  2O62 A;  1SWS A;  1VWF B;  2GC9 A;  2X4M A;  3FLL A;  2OVD A;  2HYS A;  1D3S A;  2LBA A;  3VHM A;  1EIO A;  2RTO B;  1HY2 A;  3OD9 A;  2OY5 O;  2OFM X;  3EM0 A;  1OPB A;  4U8U O;  1E00 A;  1SWC A;  1JMZ A;  3NX2 A;  2RN4 A;  4OMW A;  1FEM A;  4IAB A;  3WJG A;  2OF9 A;  1QWD A;  3ELX A;  3LV4 A;  4YKO A;  2IZL B;  5B11 O;  5KID A;  4YGH A;  2W2B A;  4YDA A;  2OL7 A;  2JN3 A;  2WSJ A;  3CKG A;  4U8U N;  3RKG A;  1LCV A;  4GDA A;  4QNI A;  1NP4 A;  1YP6 A;  4KC8 A;  2CZT A;  4U3Q A;  1JQP A;  4ZHH A;  3OE3 A;  1SY1 A;  4OEL A;  4OKA A;  4NNT A;  1OEJ A;  1SRE A;  2ANS A;  3CKF A;  2X55 A;  4BVM A;  1O1V A;  2A2U A;  3MG5 A;  1FE3 A;  1GM6 A;  1HMT A;  4XMD A;  3HOE A;  4A8Z A;  4YCE A;  2JU7 A;  5D8J A;  1RLB E;  4NNS A;  2RTM A;  1QAB E;  1LKE A;  1YWB A;  1KOI A;  2YG2 A;  2KD2 A;  4A1Y A;  3CQN A;  1VWB B;  1OBU A;  1G85 A;  4MVK A;  5B5G A;  4Z6J A;  1TVQ A;  1VWR B;  5HTD A;  1HQQ A;  2R73 A;  2X32 A;  3CWK A;  1LIB A;  4HPA A;  4I3D A;  4K19 A;  1YIV A;  3PDF A;  3S5V A;  1SWL A;  3JS1 A;  1PEE A;  2OF8 A;  2X8S A;  1VWN B;  2IZD B;  2ACO A;  4OEM A;  1P6P A;  1IIU A;  2JOZ A;  2QM9 A;  2IZE B;  5BVS A;  2RTQ B;  4GNY A;  3CQR A;  4QGX A;  3MBT A;  1KGL A;  1OEK A;  1SWK A;  5AQ6 A;  1JYD A;  1GKA A;  1IKJ A;  1NC9 A;  1YP7 A;  2A8G A;  2WUT A;  4YKM A;  2FT9 A;  1Y9T A;  5IO6 A;  1ERX A;  1NDJ A;  3KVN A;  3P6E A;  5LKE A;  3UEW A;  1KL5 A;  1LID A;  4LZU A;  5D48 A;  1SWP A;  1VWJ B;  2WQA E;  4L3R A;  2FR3 A;  3RE5 A;  1VWP B;  1MEP A;  2CM9 A;  1ML7 A;  4IB7 A;  4BX6 B;  2PFR A;  1JV4 A;  4EXZ A;  3LHN A;  4YFR A;  1HBP A;  1SRI A;  3JQO A;  1LIF A;  4CV7 A;  1HBQ A;  3NP1 A;  3VE1 A;  4COT A;  2RD7 C;  2CZU A;  1OBP A;  2IZG B;  3F9D A;  2NNE A;  3FR5 A;  1VWM B;  4LKP A;  3NBX X;  2OFB A;  4QAE A;  1KXO A;  1KZW A;  1LIE A;  3FR2 A;  4GGR A;  5H9K A;  2CM4 A;  3KFH A;  4I9R A;  5LJG A;  3BRN A;  1D2U A;  1Y52 X;  1UYN X;  2ASN X;  4ZHD A;  3LNB A;  2WPU A;  1X8N A;  2AH7 X;  1EQD A;  1A2D A;  1NBX A;  2CBR A;  4MIS A;  3FID A;  3P6H A;  2RA6 A;  5JD2 A;  3RY1 A;  2FWV A;  3PEC A;  1XKI A;  2X46 A;  4GRJ A;  4ORY A;  4M6S A;  5D47 A;  2FKG A;  3ZUI A;  2ZAG A;  4AYH A;  2FTB A;  4ZJ0 A;  4IB8 A;  4INN A;  1VWL B;  2C4I A;  5HWZ A;  1I04 A;  1LDQ A;  1HMR A;  1OPA A;  1VYG A;  4I9S A;  1ZNE A;  3U03 A;  3VG2 A;  4XMC A;  2OFA A;  1WUB A;  1LFO A;  3UAQ A;  1SLE B;  1JZU A;  2G78 A;  1BRP A;  3UEV A;  4BGF A;  4N7C A;  1RXH A;  2Q9S A;  5IXG A;  2BC3 A;  2JGS A;  5F6B A;  3T2X A;  1S7D A;  4YVB A;  4UU3 A;  2RTD B;  5HZ6 A;  3MX7 A;  4O3W A;  1GXA A;  1X8Q A;  5L8I A;  4YGZ A;  1VWK B;  1HXL A;  3D95 A;  3BSZ E;  5HZ5 A;  1S2P A;  4Y0S A;  4ZHG A;  5B2A O;  2FS6 A;  2QCB A;  1VWO B;  1N0S A;  3APX A;  1E5P A;  2PQT A;  3ZW1 B;  2OL8 O;  1N7Y A;  2Y3F A;  1VPR A;  5LJB A;  2KW1 A;  2IZC B;  5FQ7 E;  4A1H A;  3S5X A;  4AZM A;  1E02 A;  1JYJ A;  4Y5D A;  4EKV A;  4Z2O A;  2CAM A;  3PH6 A;  3WYP A;  1CBR A;  3ZW0 A;  3FYF A;  5L3Y A;  1LF7 A;  3P02 A;  1LEL A;  1YWA A;  5D45 A;  3ZW1 A;  2RTA A;  4QGV A;  3FA8 A;  1TOU A;  1B0O A;  1YUP A;  1KQX A;  1ACD A;  1RXJ A;  2PI3 O;  2W2F A;  1EI5 A;  2X56 A;  1BSQ A;  1H91 A;  4UU2 A;  4BX6 A;  4ZGU A;  4AZQ A;  1I4U A;  2MJI A;  3ZW0 B;  1TXL A;  3NR3 A; 
#chains in the Genus database with same CATH homology
 8PCH A;  5J94 A;  2IBI A;  4DMY A;  3PBH A;  2CIO A;  1U5I A;  1HUC B;  1EWM A;  1K3B B;  2JQF R;  3P5W A;  1GMY A;  1CJL A;  1MEG A;  2P0R A;  2XU4 A;  4QRV A;  1E2T A;  2PNS A;  1AEC A;  9PAP A;  3BCN A;  4HWY A;  2BDL A;  1YAL A;  2PBH A;  1AU0 A;  1PPD A;  4MZO A;  2DCD A;  4FK5 A;  2R9F A;  4MSX A;  3IOQ A;  1VJV A;  4I07 A;  4XUI A;  1S4V A;  3WXE A;  1PPN A;  3BC3 A;  3H6S A;  3IUT A;  1U9W A;  1AYW A;  3QSD A;  4YYU A;  2E02 A;  1YK8 A;  3P5V A;  3F5V A;  2HD5 A;  4P6E A;  3LFY A;  2DZY A;  1KFX L;  4PP1 A;  3BPM A;  3KWB X;  1ATK A;  3P5U A;  2R9O A;  4BQV A;  2NQA A;  5FPW A;  2G6D A;  3N3G A;  1NPZ A;  3USV A;  4Q8G A;  1GCB A;  1EWL A;  1PBH A;  2PRE A;  4PP2 E;  2ACT A;  4FJC A;  3RVV A;  1MIR A;  2ATO A;  3HHI A;  4QH6 A;  4CDE B;  1DEU A;  2OP3 A;  3B79 A;  1XKG A;  2HXZ A;  1PXV A;  3I3T A;  4P6G A;  1AU3 A;  2GHU A;  1CS8 A;  3H8B A;  2VFB A;  3C9E A;  1PIP A;  2AYN A;  1W5R A;  3MOR A;  2F1G A;  1Q6K A;  2XU1 A;  1SNK A;  3OVX A;  1FH0 A;  1CSB B;  3LXS A;  1KHQ A;  3RVX A;  1SP4 B;  4YV8 A;  2E01 A;  4X6I A;  1F2B A;  1THE A;  3IHP A;  2OUL A;  4K7C A;  1CB5 A;  4YYS A;  4PI3 A;  2ARY A;  2E00 A;  2FUD A;  3AI8 A;  1ME4 A;  3GCB A;  1Y4H A;  4X6H A;  3O0U A;  2BSZ A;  4NV8 A;  4QBB A;  4C5P A;  3N4C A;  1STF E;  2Y6E A;  3QJ3 A;  1GX3 A;  4B55 A;  3NHE A;  2NQG A;  3DF0 A;  2CB5 A;  3TNX A;  4W5C A;  2B1N A;  1U9X A;  2PAD A;  1GLO A;  3QT4 A;  5JA7 A;  1W6F A;  3O1G A;  3I06 A;  2AIM A;  5PAD A;  7PCK A;  3H7D A;  3MTN A;  1BQI A;  4G54 A;  2YJB A;  1NB5 A;  4NV7 A;  2JQG R;  3CBJ A;  1X9Y A;  3HWN A;  1EWO A;  2R9C A;  2IPP B;  2G8E A;  3IV2 A;  1NLJ A;  4W4U A;  3E1Z B;  2FYE A;  3KSE A;  2DC8 A;  1BY8 A;  1PCI A;  2AVW A;  1U9Q X;  3WXG A;  2VFC A;  3KFQ A;  1Y08 A;  5CHV A;  3KWZ A;  2HH5 A;  3H89 A;  1IWD A;  4PAD A;  2DCC A;  5CHT A;  1QDQ A;  1AYU A;  3WXF A;  4WA6 A;  3U8E A;  1TL9 A;  1W4T A;  2XU5 A;  4BPV A;  1KFU L;  2VHF A;  2VHS A;  3V6E A;  3S3R A;  2FQ9 A;  1ITO A;  3D9W A;  1MS6 A;  2C0Y A;  1BGO A;  4AXM A;  1YVB A;  3S3Q A;  2WBF X;  4YYV A;  5A24 A;  2DC6 A;  3LTW A;  5EGW A;  2FT2 A;  2G8J A;  1VSN A;  3KX1 A;  3K24 A;  4YYQ A;  4YVA A;  2P7U A;  4CDF B;  4BSQ A;  4RY2 A;  1F29 A;  2B1M A;  1MDW A;  5CVM A;  1YT7 A;  4XR7 A;  1QMY A;  3K9M A;  2FO5 A;  1POP A;  1ICF A;  2FTD A;  2AYO A;  3P5X A;  1AU4 A;  2F7D A;  1EWP A;  3BPF A;  5CVO B;  1EF7 A;  1MHW A;  2P86 A;  1BP4 A;  1KXR A;  4QRG A;  4GUZ A;  4MZS A;  2HHN A;  2OZ2 A;  1YK7 A;  1MEM A;  1TU6 A;  1CQD A;  1CPJ A;  4N79 A;  1AYV A;  1CTE A;  1NQC A;  4N4Z A;  3IEJ A;  3KW9 A;  5EF4 A;  2GFO A;  1ZIV A;  1O0E A;  2G7Y A;  3CH3 X;  2XU3 A;  4W5B A;  1NB3 A;  2DZZ A;  2Y5B A;  1JQP A;  2DCB A;  2AUX A;  4OEL A;  1M6D A;  5F02 A;  4I05 A;  1PPO A;  4KLB A;  2AU1 A;  4N8W A;  4CDC B;  3OVZ A;  2DC7 A;  1A6R A;  4Q8H A;  1CV8 A;  2BDZ A;  1DF0 A;  4DMX A;  3HHA A;  3N3K A;  5CVN B;  1GEC E;  3M99 A;  4AXL A;  1NL6 A;  1AIM A;  5JH3 A;  2AS8 A;  3PDF A;  2FRA A;  4OEM A;  5K16 A;  3D6S A;  2NQI A;  3KKU A;  4ZUX U;  4BS5 A;  3OF9 A;  3OF8 A;  2DC9 A;  2DCA A;  4BS6 A;  4X6J A;  1QOL A;  1KHP A;  2AUZ A;  4YYR A;  3F75 A;  3K8U A;  4QRX A;  2DJF B;  2E03 A;  3PW3 A;  4CZW A;  2YJ9 A;  2O6X A;  3ZUA A;  1PPP A;  2YJ8 A;  3H8C A;  1F2A A;  2YJ2 A;  2R9N A;  2R9M A;  1U9V A;  2FRQ A;  3V6C A;  3MHS A;  3PNR A;  2DJG B;  3OIS A;  4FIP A;  4BGF A;  3HD3 A;  2YJC A;  1ME3 A;  3MHH A;  3RVW A;  2H7J A;  2NQD B;  3IMA A;  1TLO A;  1CVZ A;  3BOW A;  3CH2 X;  6PAD A;  4I04 A;  4YYW A;  1PAD A;  2R6N A;  3BWK A;  3CBK A;  1F2C A;  1ZCM A;  1AU2 A;  1QXP A;  1PE6 A;  3ERV A;  4CDD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...