1W4TA

X-ray crystallographic structure of pseudomonas aeruginosa arylamine n-acetyltransferase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
277
structure length
277
Chain Sequence
HMTPLTPEQTHAYLHHIGIDDPGPPSLANLDRLIDAHLRRVAFENLDVLLDRPIEIDADKVFAKVVEGSRGGYCFELNSLFARLLLALGYELELLVARVRWGLPDDAPLTQQSHLMLRLYLAEGEFLVDVGFGSANPPRALPLPGDEADAGQVHCVRLVDPHAGLYESAVRGRSGWLPLYRFDLRPQLWIDYIPRNWYTSTHPHSVFRQGLKAAITEGDLRLTLADGLFGQRAGNGETLQRQLRDVEELLDILQTRFRLRLDPASEVPALARRLAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylamine N-acetyltransferase
publication title Expression, purification, characterization and structure of Pseudomonas aeruginosa arylamine N-acetyltransferase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 87
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2004-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00797 Acetyltransf_2 N-acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.150 Mainly Beta Beta Barrel Lipocalin Cysteine proteinases 1w4tA02
3.30.2140.10 Alpha Beta 2-Layer Sandwich Arylamine N-acetyltransferase fold Arylamine N-acetyltransferase 1w4tA01
4C5PA 1GX3A 1E2TA 2BSZA 3D9WA 1W4TA 1W6FA 4NV8A 4BGFA 2VFCA 4B55A 4NV7A 2VFBA 3LTWA 1W5RA 4GUZA
chains in the Genus database with same CATH superfamily
2FWVA 4GGRA 4CDCA 3BS2A 1VWJB 3D4RA 4PSQA 2FLJA 2KD2A 4BX5B 1ICMA 4TKHA 1XCAA 3RDQA 2QM9A 3HWDA 1R0UA 1SLDB 2HKDA 2ALLX 4U8UO 3RY2A 5AJCA 1IW2A 1SY3A 3WYPA 1U17A 4Y0QA 4ALOA 1VWLB 5LJGA 1VWKB 4GZVA 1TXLA 5HCCC 1RBPA 4OMWA 4D6AA 2FTBA 5KICA 1IFBA 4ODDA 1VWHB 1I05A 1KQWA 2FHLA 4Y59A 1A3YA 4AZQA 3BU9A 3IA8A 2AT5X 1OBQA 1FTPA 1KFFA 2RA6A 2RCQA 2Z4IA 5CYBA 4GETA 3STNA 1UREA 2IZGB 3VG4A 4O4OA 2Q4NA 5IRUA 3FA9A 1BRQA 3BSZE 3FLLA 3EYCA 4LQZA 1HN2A 3DTQA 3EBKA 4MVKA 4ZHCA 2RTFB 1GT5A 1SLFB 4ZJ0A 1SXYA 4DNEA 5IRAA 3B2KA 3PQSA 4YDBA 3RDSA 4GGTA 1VWQB 1CBQA 3P24A 4GRJA 2MO5A 5D47A 4YCHA 4IB6A 5DG4A 2GTLN 3AUMO 2A2GA 2NNDA 2RTIB 4TNNA 3FDCA 2E4JA 1JMZA 2RQ0A 2X34A 2A0AA 3STKA 2A5BA 3P6HA 5LJHA 3NX2A 1ZNHA 2RTKA 1HMTA 1JIWI 4U46A 2WEXA 3RE5A 1BRPA 2I5VO 4INNA 1LDOA 3RY1A 3WZQA 2C1QA 1GT1A 2OF8A 1YWAA 5H9KA 4I6SA 1GT4A 4OS0A 1JMXA 1G7NA 5IO5A 1RAVA 3DSZA 3PK2A 1E02A 2KTDA 5F2BA 4Z28A 2A8GA 5L3YA 1SWCA 1SWHA 3F8AA 2VFCA 2BC3A 3KFIA 2FT9A 3CR6A 1GX9A 3ZW2A 1OPBA 4BQUA 1NDJA 3RZYA 1S44A 3V8UA 1HY2A 5B27A 1HBQA 5F6BA 4A1HA 1FEMA 3HWFA 1O1UA 4O3YA 1EUOA 1QFTA 3FA6A 1KGLA 4RUNA 4NNSA 1IJ8A 2RTCB 4L1NA 1TOUA 5F58A 2GC9A 3RKGA 1OSPO 3WJCA 5K06A 1K24A 4YFPA 4ES7A 2IZDB 2AH7X 3VHHA 3UEUA 4HPBA 4IMOA 1W5RA 4AZOA 4EEJA 3WJDA 1ZNDA 2C4IA 2ANSA 4WFUA 1LICA 1SWUA 3EM0A 3FEPA 2XSTA 1I06A 5FQ8E 5LJKA 4Z27A 3EBWA 3RDUA 1QY0A 5HZ9A 2GTLO 1DC9A 1SWKA 3Q6LA 4NYRA 3S5VA 2VDFA 2FR3A 2BLGA 1SY0A 1W4TA 4D6BA 1BSYA 2CBRA 4GD9A 4B55A 4O4XA 2OL7A 5AQ6A 1BSOA 1X8OA 1MX8A 1OEEA 1VYOA 4WBKA 1HQQA 1VWDB 3BY0A 2HMBA 4FBVA 2AF5A 2O62A 5D48A 1LCWA 4EKVA 1T68X 1VPRA 1BJ7A 2A2UA 2Q9SA 1SWQA 1U0XA 3EW2A 4YGGA 3WZPA 1AQBA 2X46A 1BBPA 4UU2A 1VWAB 4N7CA 4TLJA 1QWDA 5B5GA 4ZH9A 1X8UA 2Y3FA 4DMOA 4ORUA 1SRHA 5LKEA 2FGSA 1ACDA 5JR8A 1MUPA 3MG5A 3C78X 2AT3X 5LJBA 2Q2PA 4QAEA 4GJSA 2AT8X 1YWBA 3VG2A 1OEJA 1RSUB 2PI3O 3OJYC 5B10O 1O1VA 3C77X 1X8QA 3RDOA 2JU7A 5IO6A 1GM6A 1JJXA 1WUBA 4ZCBA 1PBYA 5D8JA 4I9SA 5KIDA 1D3SA 4BGFA 3SOTA 4I9RA 2GJ5A 4HPDA 1LCVA 1UZ2X 2HNXA 1YP7A 3KFHA 2QCBA 2EU7X 3CWKA 4YFQA 3P6EA 2R56A 1FELA 1QABE 3RDXA 1AELA 1AVEA 1VWEB 1Y9TA 2DJFA 2IZKA 2IZEB 1HXLA 2ZAGA 1HMRA 3HWGA 4IB7A 4WHIA 3TGAA 4L3RA 1E2TA 4ORWA 1CJ5A 2G79A 1LIEA 3FEKA 1JBHA 1LFOA 1O8VA 2MM3A 3BX7A 3X00A 1EIIA 2A5CA 3FYFA 3FENA 4MVIA 1WBIA 2FKJA 3CKFA 2BS5A 2JOZA 4BX5A 1LKEA 5D4AA 4CPEA 1JYDA 1I4UA 3CQRA 3NX1A 3Q34A 1ZNGA 4EDEA 1A2DA 2OF9A 3APUA 3RE6A 1RXKA 4HPCA 4BCSA 1ZNKA 5B11O 2UZ2A 2LFOA 1JJUA 4EXZA 1T0VA 5FFHA 4AW8A 5LJCA 1KT7A 3VG5A 4YFRA 4QQ1A 4Y0RA 2L68A 2LB6A 2PY1A 2G5LA 1SXXA 3NQKA 1KZXA 3BRNA 3UEWA 1CBIA 3D97A 1GKAB 2OZQA 4CK4A 3KQ0A 3ZW0B 3D9WA 4ORSA 1DV9A 4R0BA 1MX7A 2NNEA 3L4RA 1SRIA 3NQ3A 1SWRA 4O4UA 4XMFA 3SZIA 4EQAC 1B4MA 2QOSC 4U8UM 3O2YA 2FS7A 2CZTA 2CBSA 2UYWA 2K23A 5EEDA 3UEXA 3WJFA 1YWDA 1YWCA 4FBRA 3WJEA 3TGCA 4IMNA 2RTPB 2LKKA 3SAOA 1BLRA 2BS6A 3WJGA 2IZLB 1GT3A 2OVEA 3PH5A 4Z2VA 2ZAIA 4NW4A 5AEOA 2ASNX 1SREA 3B2LA 3T6LA 4CPHB 1E5PA 4OEMA 4CSBA 1LIFA 1STPA 4ZR2A 3VHMA 4MVLA 1VYGA 3APVA 1S2PA 1IIUA 1W6FA 2LA7A 2RTBB 2X8SA 3FA8A 1JYJA 1VWCB 2RTAA 1Y52X 1KQXA 2Q39A 4CDFA 4DCBA 4NLIA 4K19A 1ZRYA 2GH7A 3K3LA 1VWNB 1T8VA 1SRFA 4GUZA 1KXOA 4NNTA 2LBAA 1VYFA 3SLTA 2F09A 1JQPA 2WEWA 5H8TA 4ALBA 4COTA 4LKTA 1G85A 1SRGA 3P6CA 1KT5A 4IAXA 1UYNX 3O19A 2AMMX 3WXQA 2OVDA 5F1EA 1EXSA 1QQSA 2X32A 1RXJA 4LZVA 5HAEA 3QKGA 4YCEA 2OVAA 2QMIA 3MBTA 1SWTA 3SLJA 1KZWA 1PM1X 4GU8A 1LCZA 3HOEA 4YGZA 5EDCA 4I95A 1SLEB 1BEBA 1VWGB 5LJDA 3LHNA 2ACPX 3AKMA 3ZUOA 1OEKA 2RTHB 2WQAE 1N4JA 5HCDC 4OKAA 1N9YA 2HLVA 3ZUIA 2RTNB 4NP1A 2JN3A 1TVQA 2AL0X 4MEEA 3F9DA 3UEVA 5HWZA 5L8NA 2X4MA 5F6ZA 3WOVA 2RTGB 4NLJA 2Y3EA 4AYHA 4AZMA 1ICNA 3OBLA 5L8IA 3SLOA 4IB9A 1QY1A 4ZFXA 2YMSA 4GKCA 4RUUA 3HTYA 1GXAA 1NGLA 1SWPA 2QO5A 2QOMA 2XKLA 3HWEA 5JD2A 3FR5A 3HK1A 5H9AA 4Z2OA 2BT9A 2RTLA 2F01A 3D95A 3I0AA 2GTLM 3B2HA 3VU1A 1L6MA 3PQUA 1ALBA 1SWOA 3HPEA 3BX8A 4QRLA 2JU3A 5K68A 3PH6A 2BSZA 2K62A 2CM4A 2NNQA 3PDFA 5F7GA 3CMPA 4EFGA 5EEEA 5FENA 4BX7B 2Z4HA 2ZSCA 2AVIA 2WQ9A 2X56A 4TJZA 1IKJA 1Z24A 3WJBA 3ELZA 2X45A 4DQ3A 2X55A 5EPQA 3MVFA 2RD7C 1KT3A 4KH8A 2W2BA 1X89A 4ORYA 5L8OA 3T6FA 3EC5A 3F6ZB 1EQDA 1SWNA 1RLBE 2RTQB 2HZQA 2RTEB 1HMSA 4DQ4A 1SWLA 4XMCA 5HA1A 2OY7A 1BWYA 4I3DA 1LNMA 4FBOA 4QGXA 5HTDA 1DZMA 4QGVA 5HZ6A 2P8GA 4A60A 4TQ2A 1ZNLA 3VG3A 1SA8A 4XMHA 3JSQA 4PJ2A 3VGWA 1RXHA 1IKEA 1Y0GA 2L5PA 4YDAA 5HZ5A 1UYOX 1KL4A 1VWRB 4UU3A 4HPAA 1LIBA 3I17A 1YP6A 2Q2MA 1SWAA 1MVGA 1N43A 3TGBA 4M6SA 3PP6A 4O3XB 4GDZA 4Y0PA 1E06A 1PBOA 4KIIA 3N91A 5IRWA 1IFCA 4CDDA 3LV4A 4GE1A 1JV4A 1MEPA 3NBXX 4TKJA 2LBVA 4GNYA 5B3MO 2W2FA 5BYPA 5HZ8A 2AKQA 4ML7B 1GX3A 2FHNX 3P6GA 3TF6A 5FAZA 1QFVA 3FW4A 3NP1A 4XMEA 4OS8A 1NQMA 3P6FA 1EPBA 1LDQA 2MWHA 1YIVA 3RDMA 2KTSA 1SWGA 2PQTA 1GKAA 3O22A 4ZHHA 1X71A 1VWBB 1U18A 2L9CA 3ZW0A 1ADLA 1OBPA 1STSB 1SY2A 2GTFX 3ZW1B 4AZNA 4Z6JA 2AT0X 4A1YA 5FQ7E 4YBUA 5H9LA 3RSWA 2OY1O 1G5WA 3TZSA 3ZWEA 3WVMA 4JNJA 5CHKA 5EDBA 4OS3A 1LF7A 3EMMA 4YKMA 2R73A 5BVSA 2ACOA 4O49A 3D96A 1SLGB 2MJIA 4CPFA 1SWBA 1SWSA 1D2UA 4CPHA 1QG5A 5K67A 2A3FX 5KHPA 1KL3A 4I60A 1MDCA 2NP1A 4AZPA 1B0OA 3RWXA 2L67A 5HCEC 3ZZVA 1ERBA 3NPOA 4BX6B 1DF3A 1EIOA 2AT6X 3U9PC 4KT5A 2RCTA 2FRSA 4ID2A 5B5FA 1EALA 3E3CA 5BVTA 4OMXA 1HQPA 3MM0A 1DZKA 4ORRA 4JHQA 4CDEA 3KZAA 1SWJA 2IZAA 3T1DA 5DPQA 4KC7A 4TKBA 3S26A 2M4LA 3C76X 2G8CO 2F73A 3B2IA 1KT4A 1B56A 2RTRB 3HOLA 2KW1A 3WYQA 1FDQA 4NV7A 3LTWA 3MX7A 3NR3A 1JJJA 1GGLA 1LELA 4ZGFA 3PEDA 2KT4B 1EI5A 1NP1A 3OD9A 2PFRA 2OYBO 3PECA 1I9HA 5B29A 1KL5A 3KVNA 3GE2A 3ZQ3A 2X8TA 3KFFA 4YMYA 1H91A 5C0NA 1RSTB 1SWFA 1N9MA 3JS1A 3P02A 4IBAA 4QZTA 3STMX 4IABA 2IFBA 1HXZA 1LPJA 2OY5O 5CE4A 3PPTA 2OL6O 2FKGA 4GDAA 4I3CA 5HA0A 4ZHFA 2VFBA 3FR4A 4ON1A 4CV7A 3IFBA 4QNIA 1S7DA 1N0SA 2RN4A 4BVMA 1YUPA 1VWFB 3H3IA 4C5PA 3VG7A 4U9CA 1JZUA 1X8NA 2OFRX 1CBSA 4FQBB 3CBSA 2I5ZO 2OFAA 2DJGA 2RTMA 3NQ9A 1Y55X 1SWEA 1Y9LA 2OVSA 1EPAA 4YKOA 1VWPB 1NC9A 4YVBA 3BLGA 3BDRA 2CAMA 3KFGA 1A18A 1PEEA 1K3BA 3CBCA 1MM9A 4JO6A 3B2JA 4Y0SA 5AJBA 3VHIA 4HFOA 4BOEA 2MF6A 1MK5A 1TOWA 2N93A 1LIDA 3WZNA 1SXUA 2QO6A 3ELXA 5BVQA 1EW3A 4ZH6A 3T2XA 3FR2A 1AVDA 1VWOB 3RBYA 3U03A 4O4SA 1E00A 3BU1A 1OPAA 4BX7A 1G74A 4HWMA 4NV8A 2HYSA 4A8ZA 2W2AA 1I78A 1Y53X 3AKNA 2JGSA 1SRJA 5HZQA 2RTJA 3GAQA 4LZUA 1STRB 2WPUA 2JMBA 4KCAA 4O3ZA 2POAA 5LJEA 4YGHA 1FJ1E 1NQNA 1HBPA 2Y32A 2IZJA 4N7DA 3JQOA 4ZHGA 1AVGI 3UAQA 1DF8A 1ERXA 1DFVA 1X8PA 3CKGA 1BSQA 2IZFB 1DZPA 4JGLA 1PMPA 1LUQA 1PTSA 1TW4A 4IB8A 3VE1A 1GX8A 2IZBA 4MISA 4QYNA 3LNBA 1FE3A 3FA7A 2CM9A 5HBSA 2WUTA 1NBXA 2RTOB 4BJ8A 2RTDB 4ZGUA 2HZRA 4IRWA 3S60A 4ZHDA 2IZHB 2DM5A 4WFVA 3VG6A 4KC8A 4MIRA 2WSJA 3SZHA 4AZRA 4MVEA 1KT6A 2G78A 4LKPA 3T2WA 1VWMB 2R74A 3G7XA 4ARHA 5IO7A 2G7BA 4GJVA 4Y5DA 2OFBA 3P6DA 4GNWA 3OE3A 4XMGA 2CZUA 4M7MA 5IXGA 1FENA 1ML7A 4Z2PA 5D45A 4QGWA 4U8UN 4OELA 1QY2A 3QQ2A 3ZW1A 1VWIB 2JU8A 2IZIA 3VE2A 2OL8O 3NADA 5LKFA 1CBRA 3FIDA 2BHVA 4QYPA 1SWDA 2QO4A 2X8FA 2JW1A 4GK9A 5FQ6E 5EZ2A 3WZOA 3APXA 4CPIA 3VPJE 4FGIB 1DZJA 1AB0A 4O9SA 4BBOA 4IAWA 3FIQA 1P6PA 5HTEA 1OBUA 1N7YA 1A57A 2OFMX 2WR6A 4I3BA 2IJAA 2YG2A 4GGZA 4XMDA 1BM5A 1NP4A 2FS6A 2IZCB 2OY8A 3FELA 3WBGA 4QZUA 2A13A 2MHDA 3AEHA 3CQNA 3EW1A 1CRBA 3FW5A 5CSEA 1SMPI 4BX6A 2FR2A 5B2AO 3SZJA 1XKIA 4O3WA 2WWPA 1ZNEA 4ORXA 3ZI8A 4U3QA 1KOIA 4GH7A 1SY1A 1MOYA 4YH0A 2C1SA 1B8EA 4YBPA 4NYQA 5H9NA 3FMZA 3S5XA 3APWA 3U0DA 1SXWA 1I04A
chains in the Genus database with same CATH topology
2E01A 2AS8A 3PBHA 2GFOA 4CZWA 1O0EA 2CIOA 3P5WA 1AIMA 1ITOA 3LXSA 3PW3A 2DZYA 1Q6KA 2G7YA 1F2CA 1MHWA 1ZIVA 1CPJA 1TL9A 2G8JA 3KWBX 3WXEA 1KXRA 2IBIA 1ATKA 3P5XA 4PADA 1ME3A 6PADA 2BDLA 5CVNB 1KFXL 1CQDA 2NQGA 2AUXA 1GECE 4KLBA 1Y08A 1NLJA 3HHAA 1PADA 2HHNA 4X6HA 4N79A 4CDFB 2FYEA 2FUDA 1AYVA 2G6DA 2OP3A 3BOWA 1U9WA 2VFCA 1SNKA 2BDZA 1AYWA 1U9QX 3AI8A 1TLOA 8PCHA 3KKUA 2YJ2A 1CJLA 4DMYA 1W5RA 4PI3A 2Y6EA 3USVA 2PNSA 3O0UA 1EWPA 2HD5A 2XU1A 4AXMA 3CH3X 1VSNA 1DEUA 1K3BB 1W4TA 4QBBA 3H8CA 4YV8A 4B55A 3WXFA 2AIMA 3S3RA 1PPOA 1NPZA 2R9CA 3ERVA 3K24A 4Q8HA 1CSBB 4YYUA 2IPPB 1GLOA 3IOQA 1A6RA 4MZSA 3QSDA 1EWOA 4YYVA 1F2BA 2R9NA 3BC3A 1YVBA 3P5VA 3TNXA 4YVAA 1AU2A 2YJCA 4BGFA 3H7DA 1CB5A 1PPDA 1MEGA 3KSEA 2P86A 1CVZA 3H6SA 1XKGA 2R9OA 3P5UA 4BQVA 1E2TA 2DC9A 4HWYA 2DC8A 1FH0A 4CDDB 3F5VA 3CBKA 1EF7A 4W4UA 4FJCA 2E03A 4BSQA 1YK7A 2F7DA 1PPPA 1AU0A 3OF9A 2OZ2A 2B1NA 4BS5A 3KWZA 3D9WA 2FRAA 4N4ZA 4X6IA 3RVWA 4W5CA 1YK8A 3H89A 5J94A 1F29A 2OULA 4YYWA 4MZOA 4OEMA 4QRVA 1YALA 1CS8A 4AXLA 1W6FA 3N3KA 2R9FA 5CVOB 1X9YA 4FIPA 3K8UA 3BPFA 4CDCB 3B79A 2FQ9A 4CDEB 4GUZA 1M6DA 1NQCA 1EWLA 4XUIA 2AYNA 1JQPA 1KHPA 2XU5A 2AVWA 3K9MA 4PP2E 4WA6A 1IWDA 1ZCMA 1PE6A 1SP4B 2XU4A 3D6SA 3HD3A 3LFYA 2G8EA 2DJGB 3GCBA 2P0RA 4X6JA 3V6EA 1GCBA 1KFUL 3CH2X 1BY8A 4N8WA 4YYRA 2R6NA 3V6CA 3BPMA 4G54A 3E1ZB 1MEMA 1PCIA 3U8EA 2BSZA 3PDFA 4PP1A 5A24A 1HUCB 5F02A 3QJ3A 5CHTA 2AYOA 5FPWA 3OF8A 1NB3A 4I07A 5EGWA 2CB5A 3OVXA 4P6GA 2PREA 3BWKA 7PCKA 3KX1A 2FT2A 2DZZA 3MHSA 3N4CA 1AU3A 1U9VA 2R9MA 1U9XA 4I04A 3MORA 1KHQA 4BPVA 3ZUAA 3CBJA 1GX3A 3N3GA 4XR7A 4K7CA 3DF0A 1EWMA 1QXPA 1NB5A 2AU1A 3OISA 1PXVA 2Y5BA 1BGOA 5EF4A 2YJ9A 1NL6A 3C9EA 4QRXA 3NHEA 1QMYA 5CVMA 2DCCA 3M99A 3I06A 2DJFB 2F1GA 3IUTA 3I3TA 4W5BA 3IV2A 2PBHA 3O1GA 3MHHA 1PBHA 1THEA 4QH6A 2DCAA 4P6EA 4NV7A 3LTWA 1AYUA 3S3QA 2C0YA 1YT7A 2P7UA 2NQIA 3KW9A 5K16A 3OVZA 2FRQA 3IEJA 1S4VA 2VFBA 4C5PA 1F2AA 2VHSA 3RVVA 1QOLA 1MS6A 3F75A 3IHPA 2AUZA 2JQFR 1TU6A 2NQAA 4I05A 2PADA 2WBFX 2YJBA 1MDWA 4MSXA 2H7JA 2E02A 2VHFA 9PAPA 4Q8GA 2E00A 2YJ8A 1CTEA 4NV8A 1MIRA 2ARYA 3KFQA 5CHVA 1PPNA 2O6XA 4DMXA 1ICFA 2DC6A 3IMAA 1QDQA 3RVXA 5JA7A 2HH5A 2ACTA 2ATOA 2DCDA 4YYSA 1AU4A 2JQGR 1AECA 1BQIA 1VJVA 4RY2A 2DC7A 1GMYA 4YYQA 1Y4HA 1DF0A 2FTDA 3WXGA 4OELA 1PIPA 2B1MA 4BS6A 4FK5A 2FO5A 2NQDB 1CV8A 5JH3A 1U5IA 3QT4A 1BP4A 3HHIA 5PADA 3HWNA 1STFE 3MTNA 4ZUXU 3PNRA 2DCBA 1POPA 1ME4A 2HXZA 2XU3A 2GHUA 3BCNA 3H8BA 4QRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5P A;  1GX3 A;  1E2T A;  2BSZ A;  3D9W A;  1W4T A;  1W6F A;  4NV8 A;  4BGF A;  2VFC A;  4B55 A;  4NV7 A;  2VFB A;  3LTW A;  1W5R A;  4GUZ A; 
#chains in the Genus database with same CATH topology
 2FWV A;  4GGR A;  4CDC A;  3BS2 A;  1VWJ B;  3D4R A;  4PSQ A;  2FLJ A;  2KD2 A;  4BX5 B;  1ICM A;  4TKH A;  1XCA A;  3RDQ A;  2QM9 A;  3HWD A;  1R0U A;  1SLD B;  2HKD A;  2ALL X;  4U8U O;  3RY2 A;  5AJC A;  1IW2 A;  1SY3 A;  3WYP A;  1U17 A;  4Y0Q A;  4ALO A;  1VWL B;  5LJG A;  1VWK B;  4GZV A;  1TXL A;  5HCC C;  1RBP A;  4OMW A;  4D6A A;  2FTB A;  5KIC A;  1IFB A;  4ODD A;  1VWH B;  1I05 A;  1KQW A;  2FHL A;  4Y59 A;  1A3Y A;  4AZQ A;  3BU9 A;  3IA8 A;  2AT5 X;  1OBQ A;  1FTP A;  1KFF A;  2RA6 A;  2RCQ A;  2Z4I A;  5CYB A;  4GET A;  3STN A;  1URE A;  2IZG B;  3VG4 A;  4O4O A;  2Q4N A;  5IRU A;  3FA9 A;  1BRQ A;  3BSZ E;  3FLL A;  3EYC A;  4LQZ A;  1HN2 A;  3DTQ A;  3EBK A;  4MVK A;  4ZHC A;  2RTF B;  1GT5 A;  1SLF B;  4ZJ0 A;  1SXY A;  4DNE A;  5IRA A;  3B2K A;  3PQS A;  4YDB A;  3RDS A;  4GGT A;  1VWQ B;  1CBQ A;  3P24 A;  4GRJ A;  2MO5 A;  5D47 A;  4YCH A;  4IB6 A;  5DG4 A;  2GTL N;  3AUM O;  2A2G A;  2NND A;  2RTI B;  4TNN A;  3FDC A;  2E4J A;  1JMZ A;  2RQ0 A;  2X34 A;  2A0A A;  3STK A;  2A5B A;  3P6H A;  5LJH A;  3NX2 A;  1ZNH A;  2RTK A;  1HMT A;  1JIW I;  4U46 A;  2WEX A;  3RE5 A;  1BRP A;  2I5V O;  4INN A;  1LDO A;  3RY1 A;  3WZQ A;  2C1Q A;  1GT1 A;  2OF8 A;  1YWA A;  5H9K A;  4I6S A;  1GT4 A;  4OS0 A;  1JMX A;  1G7N A;  5IO5 A;  1RAV A;  3DSZ A;  3PK2 A;  1E02 A;  2KTD A;  5F2B A;  4Z28 A;  2A8G A;  5L3Y A;  1SWC A;  1SWH A;  3F8A A;  2VFC A;  2BC3 A;  3KFI A;  2FT9 A;  3CR6 A;  1GX9 A;  3ZW2 A;  1OPB A;  4BQU A;  1NDJ A;  3RZY A;  1S44 A;  3V8U A;  1HY2 A;  5B27 A;  1HBQ A;  5F6B A;  4A1H A;  1FEM A;  3HWF A;  1O1U A;  4O3Y A;  1EUO A;  1QFT A;  3FA6 A;  1KGL A;  4RUN A;  4NNS A;  1IJ8 A;  2RTC B;  4L1N A;  1TOU A;  5F58 A;  2GC9 A;  3RKG A;  1OSP O;  3WJC A;  5K06 A;  1K24 A;  4YFP A;  4ES7 A;  2IZD B;  2AH7 X;  3VHH A;  3UEU A;  4HPB A;  4IMO A;  1W5R A;  4AZO A;  4EEJ A;  3WJD A;  1ZND A;  2C4I A;  2ANS A;  4WFU A;  1LIC A;  1SWU A;  3EM0 A;  3FEP A;  2XST A;  1I06 A;  5FQ8 E;  5LJK A;  4Z27 A;  3EBW A;  3RDU A;  1QY0 A;  5HZ9 A;  2GTL O;  1DC9 A;  1SWK A;  3Q6L A;  4NYR A;  3S5V A;  2VDF A;  2FR3 A;  2BLG A;  1SY0 A;  1W4T A;  4D6B A;  1BSY A;  2CBR A;  4GD9 A;  4B55 A;  4O4X A;  2OL7 A;  5AQ6 A;  1BSO A;  1X8O A;  1MX8 A;  1OEE A;  1VYO A;  4WBK A;  1HQQ A;  1VWD B;  3BY0 A;  2HMB A;  4FBV A;  2AF5 A;  2O62 A;  5D48 A;  1LCW A;  4EKV A;  1T68 X;  1VPR A;  1BJ7 A;  2A2U A;  2Q9S A;  1SWQ A;  1U0X A;  3EW2 A;  4YGG A;  3WZP A;  1AQB A;  2X46 A;  1BBP A;  4UU2 A;  1VWA B;  4N7C A;  4TLJ A;  1QWD A;  5B5G A;  4ZH9 A;  1X8U A;  2Y3F A;  4DMO A;  4ORU A;  1SRH A;  5LKE A;  2FGS A;  1ACD A;  5JR8 A;  1MUP A;  3MG5 A;  3C78 X;  2AT3 X;  5LJB A;  2Q2P A;  4QAE A;  4GJS A;  2AT8 X;  1YWB A;  3VG2 A;  1OEJ A;  1RSU B;  2PI3 O;  3OJY C;  5B10 O;  1O1V A;  3C77 X;  1X8Q A;  3RDO A;  2JU7 A;  5IO6 A;  1GM6 A;  1JJX A;  1WUB A;  4ZCB A;  1PBY A;  5D8J A;  4I9S A;  5KID A;  1D3S A;  4BGF A;  3SOT A;  4I9R A;  2GJ5 A;  4HPD A;  1LCV A;  1UZ2 X;  2HNX A;  1YP7 A;  3KFH A;  2QCB A;  2EU7 X;  3CWK A;  4YFQ A;  3P6E A;  2R56 A;  1FEL A;  1QAB E;  3RDX A;  1AEL A;  1AVE A;  1VWE B;  1Y9T A;  2DJF A;  2IZK A;  2IZE B;  1HXL A;  2ZAG A;  1HMR A;  3HWG A;  4IB7 A;  4WHI A;  3TGA A;  4L3R A;  1E2T A;  4ORW A;  1CJ5 A;  2G79 A;  1LIE A;  3FEK A;  1JBH A;  1LFO A;  1O8V A;  2MM3 A;  3BX7 A;  3X00 A;  1EII A;  2A5C A;  3FYF A;  3FEN A;  4MVI A;  1WBI A;  2FKJ A;  3CKF A;  2BS5 A;  2JOZ A;  4BX5 A;  1LKE A;  5D4A A;  4CPE A;  1JYD A;  1I4U A;  3CQR A;  3NX1 A;  3Q34 A;  1ZNG A;  4EDE A;  1A2D A;  2OF9 A;  3APU A;  3RE6 A;  1RXK A;  4HPC A;  4BCS A;  1ZNK A;  5B11 O;  2UZ2 A;  2LFO A;  1JJU A;  4EXZ A;  1T0V A;  5FFH A;  4AW8 A;  5LJC A;  1KT7 A;  3VG5 A;  4YFR A;  4QQ1 A;  4Y0R A;  2L68 A;  2LB6 A;  2PY1 A;  2G5L A;  1SXX A;  3NQK A;  1KZX A;  3BRN A;  3UEW A;  1CBI A;  3D97 A;  1GKA B;  2OZQ A;  4CK4 A;  3KQ0 A;  3ZW0 B;  3D9W A;  4ORS A;  1DV9 A;  4R0B A;  1MX7 A;  2NNE A;  3L4R A;  1SRI A;  3NQ3 A;  1SWR A;  4O4U A;  4XMF A;  3SZI A;  4EQA C;  1B4M A;  2QOS C;  4U8U M;  3O2Y A;  2FS7 A;  2CZT A;  2CBS A;  2UYW A;  2K23 A;  5EED A;  3UEX A;  3WJF A;  1YWD A;  1YWC A;  4FBR A;  3WJE A;  3TGC A;  4IMN A;  2RTP B;  2LKK A;  3SAO A;  1BLR A;  2BS6 A;  3WJG A;  2IZL B;  1GT3 A;  2OVE A;  3PH5 A;  4Z2V A;  2ZAI A;  4NW4 A;  5AEO A;  2ASN X;  1SRE A;  3B2L A;  3T6L A;  4CPH B;  1E5P A;  4OEM A;  4CSB A;  1LIF A;  1STP A;  4ZR2 A;  3VHM A;  4MVL A;  1VYG A;  3APV A;  1S2P A;  1IIU A;  1W6F A;  2LA7 A;  2RTB B;  2X8S A;  3FA8 A;  1JYJ A;  1VWC B;  2RTA A;  1Y52 X;  1KQX A;  2Q39 A;  4CDF A;  4DCB A;  4NLI A;  4K19 A;  1ZRY A;  2GH7 A;  3K3L A;  1VWN B;  1T8V A;  1SRF A;  4GUZ A;  1KXO A;  4NNT A;  2LBA A;  1VYF A;  3SLT A;  2F09 A;  1JQP A;  2WEW A;  5H8T A;  4ALB A;  4COT A;  4LKT A;  1G85 A;  1SRG A;  3P6C A;  1KT5 A;  4IAX A;  1UYN X;  3O19 A;  2AMM X;  3WXQ A;  2OVD A;  5F1E A;  1EXS A;  1QQS A;  2X32 A;  1RXJ A;  4LZV A;  5HAE A;  3QKG A;  4YCE A;  2OVA A;  2QMI A;  3MBT A;  1SWT A;  3SLJ A;  1KZW A;  1PM1 X;  4GU8 A;  1LCZ A;  3HOE A;  4YGZ A;  5EDC A;  4I95 A;  1SLE B;  1BEB A;  1VWG B;  5LJD A;  3LHN A;  2ACP X;  3AKM A;  3ZUO A;  1OEK A;  2RTH B;  2WQA E;  1N4J A;  5HCD C;  4OKA A;  1N9Y A;  2HLV A;  3ZUI A;  2RTN B;  4NP1 A;  2JN3 A;  1TVQ A;  2AL0 X;  4MEE A;  3F9D A;  3UEV A;  5HWZ A;  5L8N A;  2X4M A;  5F6Z A;  3WOV A;  2RTG B;  4NLJ A;  2Y3E A;  4AYH A;  4AZM A;  1ICN A;  3OBL A;  5L8I A;  3SLO A;  4IB9 A;  1QY1 A;  4ZFX A;  2YMS A;  4GKC A;  4RUU A;  3HTY A;  1GXA A;  1NGL A;  1SWP A;  2QO5 A;  2QOM A;  2XKL A;  3HWE A;  5JD2 A;  3FR5 A;  3HK1 A;  5H9A A;  4Z2O A;  2BT9 A;  2RTL A;  2F01 A;  3D95 A;  3I0A A;  2GTL M;  3B2H A;  3VU1 A;  1L6M A;  3PQU A;  1ALB A;  1SWO A;  3HPE A;  3BX8 A;  4QRL A;  2JU3 A;  5K68 A;  3PH6 A;  2BSZ A;  2K62 A;  2CM4 A;  2NNQ A;  3PDF A;  5F7G A;  3CMP A;  4EFG A;  5EEE A;  5FEN A;  4BX7 B;  2Z4H A;  2ZSC A;  2AVI A;  2WQ9 A;  2X56 A;  4TJZ A;  1IKJ A;  1Z24 A;  3WJB A;  3ELZ A;  2X45 A;  4DQ3 A;  2X55 A;  5EPQ A;  3MVF A;  2RD7 C;  1KT3 A;  4KH8 A;  2W2B A;  1X89 A;  4ORY A;  5L8O A;  3T6F A;  3EC5 A;  3F6Z B;  1EQD A;  1SWN A;  1RLB E;  2RTQ B;  2HZQ A;  2RTE B;  1HMS A;  4DQ4 A;  1SWL A;  4XMC A;  5HA1 A;  2OY7 A;  1BWY A;  4I3D A;  1LNM A;  4FBO A;  4QGX A;  5HTD A;  1DZM A;  4QGV A;  5HZ6 A;  2P8G A;  4A60 A;  4TQ2 A;  1ZNL A;  3VG3 A;  1SA8 A;  4XMH A;  3JSQ A;  4PJ2 A;  3VGW A;  1RXH A;  1IKE A;  1Y0G A;  2L5P A;  4YDA A;  5HZ5 A;  1UYO X;  1KL4 A;  1VWR B;  4UU3 A;  4HPA A;  1LIB A;  3I17 A;  1YP6 A;  2Q2M A;  1SWA A;  1MVG A;  1N43 A;  3TGB A;  4M6S A;  3PP6 A;  4O3X B;  4GDZ A;  4Y0P A;  1E06 A;  1PBO A;  4KII A;  3N91 A;  5IRW A;  1IFC A;  4CDD A;  3LV4 A;  4GE1 A;  1JV4 A;  1MEP A;  3NBX X;  4TKJ A;  2LBV A;  4GNY A;  5B3M O;  2W2F A;  5BYP A;  5HZ8 A;  2AKQ A;  4ML7 B;  1GX3 A;  2FHN X;  3P6G A;  3TF6 A;  5FAZ A;  1QFV A;  3FW4 A;  3NP1 A;  4XME A;  4OS8 A;  1NQM A;  3P6F A;  1EPB A;  1LDQ A;  2MWH A;  1YIV A;  3RDM A;  2KTS A;  1SWG A;  2PQT A;  1GKA A;  3O22 A;  4ZHH A;  1X71 A;  1VWB B;  1U18 A;  2L9C A;  3ZW0 A;  1ADL A;  1OBP A;  1STS B;  1SY2 A;  2GTF X;  3ZW1 B;  4AZN A;  4Z6J A;  2AT0 X;  4A1Y A;  5FQ7 E;  4YBU A;  5H9L A;  3RSW A;  2OY1 O;  1G5W A;  3TZS A;  3ZWE A;  3WVM A;  4JNJ A;  5CHK A;  5EDB A;  4OS3 A;  1LF7 A;  3EMM A;  4YKM A;  2R73 A;  5BVS A;  2ACO A;  4O49 A;  3D96 A;  1SLG B;  2MJI A;  4CPF A;  1SWB A;  1SWS A;  1D2U A;  4CPH A;  1QG5 A;  5K67 A;  2A3F X;  5KHP A;  1KL3 A;  4I60 A;  1MDC A;  2NP1 A;  4AZP A;  1B0O A;  3RWX A;  2L67 A;  5HCE C;  3ZZV A;  1ERB A;  3NPO A;  4BX6 B;  1DF3 A;  1EIO A;  2AT6 X;  3U9P C;  4KT5 A;  2RCT A;  2FRS A;  4ID2 A;  5B5F A;  1EAL A;  3E3C A;  5BVT A;  4OMX A;  1HQP A;  3MM0 A;  1DZK A;  4ORR A;  4JHQ A;  4CDE A;  3KZA A;  1SWJ A;  2IZA A;  3T1D A;  5DPQ A;  4KC7 A;  4TKB A;  3S26 A;  2M4L A;  3C76 X;  2G8C O;  2F73 A;  3B2I A;  1KT4 A;  1B56 A;  2RTR B;  3HOL A;  2KW1 A;  3WYQ A;  1FDQ A;  4NV7 A;  3LTW A;  3MX7 A;  3NR3 A;  1JJJ A;  1GGL A;  1LEL A;  4ZGF A;  3PED A;  2KT4 B;  1EI5 A;  1NP1 A;  3OD9 A;  2PFR A;  2OYB O;  3PEC A;  1I9H A;  5B29 A;  1KL5 A;  3KVN A;  3GE2 A;  3ZQ3 A;  2X8T A;  3KFF A;  4YMY A;  1H91 A;  5C0N A;  1RST B;  1SWF A;  1N9M A;  3JS1 A;  3P02 A;  4IBA A;  4QZT A;  3STM X;  4IAB A;  2IFB A;  1HXZ A;  1LPJ A;  2OY5 O;  5CE4 A;  3PPT A;  2OL6 O;  2FKG A;  4GDA A;  4I3C A;  5HA0 A;  4ZHF A;  2VFB A;  3FR4 A;  4ON1 A;  4CV7 A;  3IFB A;  4QNI A;  1S7D A;  1N0S A;  2RN4 A;  4BVM A;  1YUP A;  1VWF B;  3H3I A;  4C5P A;  3VG7 A;  4U9C A;  1JZU A;  1X8N A;  2OFR X;  1CBS A;  4FQB B;  3CBS A;  2I5Z O;  2OFA A;  2DJG A;  2RTM A;  3NQ9 A;  1Y55 X;  1SWE A;  1Y9L A;  2OVS A;  1EPA A;  4YKO A;  1VWP B;  1NC9 A;  4YVB A;  3BLG A;  3BDR A;  2CAM A;  3KFG A;  1A18 A;  1PEE A;  1K3B A;  3CBC A;  1MM9 A;  4JO6 A;  3B2J A;  4Y0S A;  5AJB A;  3VHI A;  4HFO A;  4BOE A;  2MF6 A;  1MK5 A;  1TOW A;  2N93 A;  1LID A;  3WZN A;  1SXU A;  2QO6 A;  3ELX A;  5BVQ A;  1EW3 A;  4ZH6 A;  3T2X A;  3FR2 A;  1AVD A;  1VWO B;  3RBY A;  3U03 A;  4O4S A;  1E00 A;  3BU1 A;  1OPA A;  4BX7 A;  1G74 A;  4HWM A;  4NV8 A;  2HYS A;  4A8Z A;  2W2A A;  1I78 A;  1Y53 X;  3AKN A;  2JGS A;  1SRJ A;  5HZQ A;  2RTJ A;  3GAQ A;  4LZU A;  1STR B;  2WPU A;  2JMB A;  4KCA A;  4O3Z A;  2POA A;  5LJE A;  4YGH A;  1FJ1 E;  1NQN A;  1HBP A;  2Y32 A;  2IZJ A;  4N7D A;  3JQO A;  4ZHG A;  1AVG I;  3UAQ A;  1DF8 A;  1ERX A;  1DFV A;  1X8P A;  3CKG A;  1BSQ A;  2IZF B;  1DZP A;  4JGL A;  1PMP A;  1LUQ A;  1PTS A;  1TW4 A;  4IB8 A;  3VE1 A;  1GX8 A;  2IZB A;  4MIS A;  4QYN A;  3LNB A;  1FE3 A;  3FA7 A;  2CM9 A;  5HBS A;  2WUT A;  1NBX A;  2RTO B;  4BJ8 A;  2RTD B;  4ZGU A;  2HZR A;  4IRW A;  3S60 A;  4ZHD A;  2IZH B;  2DM5 A;  4WFV A;  3VG6 A;  4KC8 A;  4MIR A;  2WSJ A;  3SZH A;  4AZR A;  4MVE A;  1KT6 A;  2G78 A;  4LKP A;  3T2W A;  1VWM B;  2R74 A;  3G7X A;  4ARH A;  5IO7 A;  2G7B A;  4GJV A;  4Y5D A;  2OFB A;  3P6D A;  4GNW A;  3OE3 A;  4XMG A;  2CZU A;  4M7M A;  5IXG A;  1FEN A;  1ML7 A;  4Z2P A;  5D45 A;  4QGW A;  4U8U N;  4OEL A;  1QY2 A;  3QQ2 A;  3ZW1 A;  1VWI B;  2JU8 A;  2IZI A;  3VE2 A;  2OL8 O;  3NAD A;  5LKF A;  1CBR A;  3FID A;  2BHV A;  4QYP A;  1SWD A;  2QO4 A;  2X8F A;  2JW1 A;  4GK9 A;  5FQ6 E;  5EZ2 A;  3WZO A;  3APX A;  4CPI A;  3VPJ E;  4FGI B;  1DZJ A;  1AB0 A;  4O9S A;  4BBO A;  4IAW A;  3FIQ A;  1P6P A;  5HTE A;  1OBU A;  1N7Y A;  1A57 A;  2OFM X;  2WR6 A;  4I3B A;  2IJA A;  2YG2 A;  4GGZ A;  4XMD A;  1BM5 A;  1NP4 A;  2FS6 A;  2IZC B;  2OY8 A;  3FEL A;  3WBG A;  4QZU A;  2A13 A;  2MHD A;  3AEH A;  3CQN A;  3EW1 A;  1CRB A;  3FW5 A;  5CSE A;  1SMP I;  4BX6 A;  2FR2 A;  5B2A O;  3SZJ A;  1XKI A;  4O3W A;  2WWP A;  1ZNE A;  4ORX A;  3ZI8 A;  4U3Q A;  1KOI A;  4GH7 A;  1SY1 A;  1MOY A;  4YH0 A;  2C1S A;  1B8E A;  4YBP A;  4NYQ A;  5H9N A;  3FMZ A;  3S5X A;  3APW A;  3U0D A;  1SXW A;  1I04 A; 
#chains in the Genus database with same CATH homology
 2E01 A;  2AS8 A;  3PBH A;  2GFO A;  4CZW A;  1O0E A;  2CIO A;  3P5W A;  1AIM A;  1ITO A;  3LXS A;  3PW3 A;  2DZY A;  1Q6K A;  2G7Y A;  1F2C A;  1MHW A;  1ZIV A;  1CPJ A;  1TL9 A;  2G8J A;  3KWB X;  3WXE A;  1KXR A;  2IBI A;  1ATK A;  3P5X A;  4PAD A;  1ME3 A;  6PAD A;  2BDL A;  5CVN B;  1KFX L;  1CQD A;  2NQG A;  2AUX A;  1GEC E;  4KLB A;  1Y08 A;  1NLJ A;  3HHA A;  1PAD A;  2HHN A;  4X6H A;  4N79 A;  4CDF B;  2FYE A;  2FUD A;  1AYV A;  2G6D A;  2OP3 A;  3BOW A;  1U9W A;  2VFC A;  1SNK A;  2BDZ A;  1AYW A;  1U9Q X;  3AI8 A;  1TLO A;  8PCH A;  3KKU A;  2YJ2 A;  1CJL A;  4DMY A;  1W5R A;  4PI3 A;  2Y6E A;  3USV A;  2PNS A;  3O0U A;  1EWP A;  2HD5 A;  2XU1 A;  4AXM A;  3CH3 X;  1VSN A;  1DEU A;  1K3B B;  1W4T A;  4QBB A;  3H8C A;  4YV8 A;  4B55 A;  3WXF A;  2AIM A;  3S3R A;  1PPO A;  1NPZ A;  2R9C A;  3ERV A;  3K24 A;  4Q8H A;  1CSB B;  4YYU A;  2IPP B;  1GLO A;  3IOQ A;  1A6R A;  4MZS A;  3QSD A;  1EWO A;  4YYV A;  1F2B A;  2R9N A;  3BC3 A;  1YVB A;  3P5V A;  3TNX A;  4YVA A;  1AU2 A;  2YJC A;  4BGF A;  3H7D A;  1CB5 A;  1PPD A;  1MEG A;  3KSE A;  2P86 A;  1CVZ A;  3H6S A;  1XKG A;  2R9O A;  3P5U A;  4BQV A;  1E2T A;  2DC9 A;  4HWY A;  2DC8 A;  1FH0 A;  4CDD B;  3F5V A;  3CBK A;  1EF7 A;  4W4U A;  4FJC A;  2E03 A;  4BSQ A;  1YK7 A;  2F7D A;  1PPP A;  1AU0 A;  3OF9 A;  2OZ2 A;  2B1N A;  4BS5 A;  3KWZ A;  3D9W A;  2FRA A;  4N4Z A;  4X6I A;  3RVW A;  4W5C A;  1YK8 A;  3H89 A;  5J94 A;  1F29 A;  2OUL A;  4YYW A;  4MZO A;  4OEM A;  4QRV A;  1YAL A;  1CS8 A;  4AXL A;  1W6F A;  3N3K A;  2R9F A;  5CVO B;  1X9Y A;  4FIP A;  3K8U A;  3BPF A;  4CDC B;  3B79 A;  2FQ9 A;  4CDE B;  4GUZ A;  1M6D A;  1NQC A;  1EWL A;  4XUI A;  2AYN A;  1JQP A;  1KHP A;  2XU5 A;  2AVW A;  3K9M A;  4PP2 E;  4WA6 A;  1IWD A;  1ZCM A;  1PE6 A;  1SP4 B;  2XU4 A;  3D6S A;  3HD3 A;  3LFY A;  2G8E A;  2DJG B;  3GCB A;  2P0R A;  4X6J A;  3V6E A;  1GCB A;  1KFU L;  3CH2 X;  1BY8 A;  4N8W A;  4YYR A;  2R6N A;  3V6C A;  3BPM A;  4G54 A;  3E1Z B;  1MEM A;  1PCI A;  3U8E A;  2BSZ A;  3PDF A;  4PP1 A;  5A24 A;  1HUC B;  5F02 A;  3QJ3 A;  5CHT A;  2AYO A;  5FPW A;  3OF8 A;  1NB3 A;  4I07 A;  5EGW A;  2CB5 A;  3OVX A;  4P6G A;  2PRE A;  3BWK A;  7PCK A;  3KX1 A;  2FT2 A;  2DZZ A;  3MHS A;  3N4C A;  1AU3 A;  1U9V A;  2R9M A;  1U9X A;  4I04 A;  3MOR A;  1KHQ A;  4BPV A;  3ZUA A;  3CBJ A;  1GX3 A;  3N3G A;  4XR7 A;  4K7C A;  3DF0 A;  1EWM A;  1QXP A;  1NB5 A;  2AU1 A;  3OIS A;  1PXV A;  2Y5B A;  1BGO A;  5EF4 A;  2YJ9 A;  1NL6 A;  3C9E A;  4QRX A;  3NHE A;  1QMY A;  5CVM A;  2DCC A;  3M99 A;  3I06 A;  2DJF B;  2F1G A;  3IUT A;  3I3T A;  4W5B A;  3IV2 A;  2PBH A;  3O1G A;  3MHH A;  1PBH A;  1THE A;  4QH6 A;  2DCA A;  4P6E A;  4NV7 A;  3LTW A;  1AYU A;  3S3Q A;  2C0Y A;  1YT7 A;  2P7U A;  2NQI A;  3KW9 A;  5K16 A;  3OVZ A;  2FRQ A;  3IEJ A;  1S4V A;  2VFB A;  4C5P A;  1F2A A;  2VHS A;  3RVV A;  1QOL A;  1MS6 A;  3F75 A;  3IHP A;  2AUZ A;  2JQF R;  1TU6 A;  2NQA A;  4I05 A;  2PAD A;  2WBF X;  2YJB A;  1MDW A;  4MSX A;  2H7J A;  2E02 A;  2VHF A;  9PAP A;  4Q8G A;  2E00 A;  2YJ8 A;  1CTE A;  4NV8 A;  1MIR A;  2ARY A;  3KFQ A;  5CHV A;  1PPN A;  2O6X A;  4DMX A;  1ICF A;  2DC6 A;  3IMA A;  1QDQ A;  3RVX A;  5JA7 A;  2HH5 A;  2ACT A;  2ATO A;  2DCD A;  4YYS A;  1AU4 A;  2JQG R;  1AEC A;  1BQI A;  1VJV A;  4RY2 A;  2DC7 A;  1GMY A;  4YYQ A;  1Y4H A;  1DF0 A;  2FTD A;  3WXG A;  4OEL A;  1PIP A;  2B1M A;  4BS6 A;  4FK5 A;  2FO5 A;  2NQD B;  1CV8 A;  5JH3 A;  1U5I A;  3QT4 A;  1BP4 A;  3HHI A;  5PAD A;  3HWN A;  1STF E;  3MTN A;  4ZUX U;  3PNR A;  2DCB A;  1POP A;  1ME4 A;  2HXZ A;  2XU3 A;  2GHU A;  3BCN A;  3H8B A;  4QRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...